SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YPR014C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YPR014C   Protein: S000006218
Sequence length 109
Comment YPR014C SGDID:S000006218, Chr XVI from 587515-587186, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; YPR014C is not an essential gene"
Sequence
MSCIFSADLGVEYSCAESRITNLVLCILCIREEKAAPVVKKDKFLFFIFLSSKENLFCEI
SSRSSVSEVKSLRAKNNFICPHAVIGFQGAKAQLGIRFPQLNGLLRLQH
Download sequence
Identical sequences B3LL75 Q6B0W2 Q7LID7
YPR014C YPR014C YPR014C YPR014C YPR014C YPR014C YPR014C YPR014C YPR014C 4932.YPR014C SCRT_02504 YPR014C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]