SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YPR014C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YPR014C   Protein: S000006218
Sequence length 109
Comment YPR014C SGDID:S000006218, Chr XVI from 587515-587186, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; YPR014C is not an essential gene"
Sequence
MSCIFSADLGVEYSCAESRITNLVLCILCIREEKAAPVVKKDKFLFFIFLSSKENLFCEI
SSRSSVSEVKSLRAKNNFICPHAVIGFQGAKAQLGIRFPQLNGLLRLQH
Download sequence
Identical sequences B3LL75 Q6B0W2
YPR014C YPR014C 4932.YPR014C YPR014C YPR014C SCRT_02504 YPR014C YPR014C YPR014C YPR014C YPR014C YPR014C

Jump to [ Top of page · Domain architecture · Domain assignment details ]