SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YPR029C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPR029C
Domain Number 1 Region: 20-642
Classification Level Classification E-value
Superfamily ARM repeat 1.02e-69
Family Clathrin adaptor core protein 1.54e-05
Further Details:      
 
Domain Number 2 Region: 721-818
Classification Level Classification E-value
Superfamily Clathrin adaptor appendage domain 3.84e-09
Family gamma-adaptin C-terminal appendage domain-like 0.014
Further Details:      
 

Protein sequence

External link(s) Locus: YPR029C   Protein: S000006233
Sequence length 832
Comment APL4 SGDID:S000006233, Chr XVI from 626964-624466, reverse complement, Verified ORF, "Gamma-adaptin, large subunit of the clathrin-associated protein (AP-1) complex; binds clathrin; involved in vesicle mediated transport"
Sequence
MGSSLRSFIKDVRGAKTLADERAIITKQSAKIRTKLRDDHLPHEKRRVNIQKLLYLYILG
EKTHFGQVESINLIASDDFVDKRLGYLAATLLLDESEDLLTLLTNMLNNDLHHPNKYAVS
LALTSLGFLSSPELARDLYPDVENIIKNSRDPFLLKKALQCAAKLIFKDVSLLEIFNIED
ITKILSSHSICTHGVLLGVTKIIQSILLIGLNRKKDEDEDEDGIDYSNDILSPLSLLLRD
FFIRLENMNSKNIEPGYDVQGICDPFLQCEIIYTLKLYFQVGELLNSNNVLDYKDNFCDL
LTRIATNTDSTKNSGQAILYETVKTIFSLDLNQPLRVLGINILAKFLAGKDNNTKYVSLN
TLLKVVPQEPTAVQRHRKFISHCLQDTDVSIRMRALELSFAILDDSNLVELVNELMKFLA
KQDEDSKDLIIYTIDHLIDTFDTRVVKDESWKLDVFFNILKLVGSFINYEKINDILIIIN
NTSQLSDKSEFLRKMLTISLNGTSAEISEENIGWQLVLIWCIGEYGDLVLNEGNKNGADI
INESSITDYLLTLQELYTATNLKIINYILTAALKLSVRFHDAKNIEKLRQLILSYTDSTD
LSLQMKSNQYEIFFNQSISVKKIILETMPKFEKITEEQDNGKALSKNLISNEPVDLLSDL
LGEDSKAESKASTGDNVKPIDILEEIFGEKNDIAQVPKNANKEESINHSSAVEANSGVTL
PLDANKIYDSSSLNVYASLLSANSGLAHLDLYFQAKSLISDLKTFCAVPKAQKLTLGQLY
PSSTINASQICKQSLKISGSGKLKLRVKLDFHLNGSSSITNEQFDHKFDETL
Download sequence
Identical sequences N1NW08 Q12028
YPR029C 4932.YPR029C YPR029C YPR029C YPR029C YPR029C YPR029c___KOG1062 YPR029C YPR029C

Jump to [ Top of page · Domain architecture · Domain assignment details ]