SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YPR029C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPR029C
Domain Number 1 Region: 20-642
Classification Level Classification E-value
Superfamily ARM repeat 1.02e-69
Family Clathrin adaptor core protein 0.0000154
Further Details:      
 
Domain Number 2 Region: 721-818
Classification Level Classification E-value
Superfamily Clathrin adaptor appendage domain 0.00000000384
Family gamma-adaptin C-terminal appendage domain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
transferase complex 1.369 31.58
membrane coat 2.044 26.91
organelle envelope 1.405 21.18
cytosol 1.295 15.81
nucleoplasm part 1.369 10.12
methyltransferase complex 2.143 10.12
coated vesicle membrane 2.075 9.81
transport vesicle membrane 2.03 9.64
clathrin-coated vesicle 1.989 9.64
side of membrane 1.633 8.85
Biological Process IC (bits) H-Score
nucleocytoplasmic transport 1.987 31.52
peptidyl-amino acid modification 1.432 22.31
peptidyl-lysine modification 1.895 22.31
cell cycle process 1.35 21.42
protein import 2.058 20.3
gliogenesis 1.492 18.6
nuclear division 1.865 17.9
microtubule-based process 1.532 15.82
regulation of cell activation 1.625 14.67
regulation of cell adhesion 1.406 14.67

Protein sequence

External link(s) Locus: YPR029C   Protein: S000006233
Sequence length 832
Comment APL4 SGDID:S000006233, Chr XVI from 626964-624466, reverse complement, Verified ORF, "Gamma-adaptin, large subunit of the clathrin-associated protein (AP-1) complex; binds clathrin; involved in vesicle mediated transport"
Sequence
MGSSLRSFIKDVRGAKTLADERAIITKQSAKIRTKLRDDHLPHEKRRVNIQKLLYLYILG
EKTHFGQVESINLIASDDFVDKRLGYLAATLLLDESEDLLTLLTNMLNNDLHHPNKYAVS
LALTSLGFLSSPELARDLYPDVENIIKNSRDPFLLKKALQCAAKLIFKDVSLLEIFNIED
ITKILSSHSICTHGVLLGVTKIIQSILLIGLNRKKDEDEDEDGIDYSNDILSPLSLLLRD
FFIRLENMNSKNIEPGYDVQGICDPFLQCEIIYTLKLYFQVGELLNSNNVLDYKDNFCDL
LTRIATNTDSTKNSGQAILYETVKTIFSLDLNQPLRVLGINILAKFLAGKDNNTKYVSLN
TLLKVVPQEPTAVQRHRKFISHCLQDTDVSIRMRALELSFAILDDSNLVELVNELMKFLA
KQDEDSKDLIIYTIDHLIDTFDTRVVKDESWKLDVFFNILKLVGSFINYEKINDILIIIN
NTSQLSDKSEFLRKMLTISLNGTSAEISEENIGWQLVLIWCIGEYGDLVLNEGNKNGADI
INESSITDYLLTLQELYTATNLKIINYILTAALKLSVRFHDAKNIEKLRQLILSYTDSTD
LSLQMKSNQYEIFFNQSISVKKIILETMPKFEKITEEQDNGKALSKNLISNEPVDLLSDL
LGEDSKAESKASTGDNVKPIDILEEIFGEKNDIAQVPKNANKEESINHSSAVEANSGVTL
PLDANKIYDSSSLNVYASLLSANSGLAHLDLYFQAKSLISDLKTFCAVPKAQKLTLGQLY
PSSTINASQICKQSLKISGSGKLKLRVKLDFHLNGSSSITNEQFDHKFDETL
Download sequence
Identical sequences N1NW08 Q12028
YPR029C YPR029C YPR029C YPR029C YPR029C YPR029C YPR029c___KOG1062 4932.YPR029C YPR029C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]