SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YPR029C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPR029C
Domain Number 1 Region: 20-642
Classification Level Classification E-value
Superfamily ARM repeat 1.02e-69
Family Clathrin adaptor core protein 0.0000154
Further Details:      
 
Domain Number 2 Region: 721-818
Classification Level Classification E-value
Superfamily Clathrin adaptor appendage domain 0.00000000384
Family gamma-adaptin C-terminal appendage domain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
membrane coat 2.107 29.29
transferase complex 1.423 23.98
trans-Golgi network 1.793 19.11
cytosol 1.301 13.3
side of membrane 1.701 12.74
extrinsic component of plasma membrane 1.992 12.34
chromosomal part 1.477 11.08
endocytic vesicle 1.433 10.75
clathrin-coated vesicle 2.107 10.75
adherens junction 1.365 9.56

Protein sequence

External link(s) Locus: YPR029C   Protein: S000006233
Sequence length 832
Comment APL4 SGDID:S000006233, Chr XVI from 626964-624466, reverse complement, Verified ORF, "Gamma-adaptin, large subunit of the clathrin-associated protein (AP-1) complex; binds clathrin; involved in vesicle mediated transport"
Sequence
MGSSLRSFIKDVRGAKTLADERAIITKQSAKIRTKLRDDHLPHEKRRVNIQKLLYLYILG
EKTHFGQVESINLIASDDFVDKRLGYLAATLLLDESEDLLTLLTNMLNNDLHHPNKYAVS
LALTSLGFLSSPELARDLYPDVENIIKNSRDPFLLKKALQCAAKLIFKDVSLLEIFNIED
ITKILSSHSICTHGVLLGVTKIIQSILLIGLNRKKDEDEDEDGIDYSNDILSPLSLLLRD
FFIRLENMNSKNIEPGYDVQGICDPFLQCEIIYTLKLYFQVGELLNSNNVLDYKDNFCDL
LTRIATNTDSTKNSGQAILYETVKTIFSLDLNQPLRVLGINILAKFLAGKDNNTKYVSLN
TLLKVVPQEPTAVQRHRKFISHCLQDTDVSIRMRALELSFAILDDSNLVELVNELMKFLA
KQDEDSKDLIIYTIDHLIDTFDTRVVKDESWKLDVFFNILKLVGSFINYEKINDILIIIN
NTSQLSDKSEFLRKMLTISLNGTSAEISEENIGWQLVLIWCIGEYGDLVLNEGNKNGADI
INESSITDYLLTLQELYTATNLKIINYILTAALKLSVRFHDAKNIEKLRQLILSYTDSTD
LSLQMKSNQYEIFFNQSISVKKIILETMPKFEKITEEQDNGKALSKNLISNEPVDLLSDL
LGEDSKAESKASTGDNVKPIDILEEIFGEKNDIAQVPKNANKEESINHSSAVEANSGVTL
PLDANKIYDSSSLNVYASLLSANSGLAHLDLYFQAKSLISDLKTFCAVPKAQKLTLGQLY
PSSTINASQICKQSLKISGSGKLKLRVKLDFHLNGSSSITNEQFDHKFDETL
Download sequence
Identical sequences N1NW08 Q12028
YPR029C YPR029C 4932.YPR029C YPR029c___KOG1062 YPR029C YPR029C YPR029C YPR029C YPR029C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]