SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YPR035W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPR035W
Domain Number 1 Region: 108-358
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 4.32e-76
Family Glutamine synthetase catalytic domain 0.0025
Further Details:      
 
Domain Number 2 Region: 18-105
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 9.94e-19
Family Glutamine synthetase, N-terminal domain 0.0083
Further Details:      
 

Protein sequence

External link(s) Locus: YPR035W   Protein: S000006239
Sequence length 370
Comment GLN1 SGDID:S000006239, Chr XVI from 642205-643317, Verified ORF, "Glutamine synthetase (GS), synthesizes glutamine from glutamate and ammonia; with Glt1p, forms the secondary pathway for glutamate biosynthesis from ammonia; expression regulated by nitrogen source and by amino acid limitation"
Sequence
MAEASIEKTQILQKYLELDQRGRIIAEYVWIDGTGNLRSKGRTLKKRITSIDQLPEWNFD
GSSTNQAPGHDSDIYLKPVAYYPDPFRRGDNIVVLAACYNNDGTPNKFNHRHEAAKLFAA
HKDEEIWFGLEQEYTLFDMYDDVYGWPKGGYPAPQGPYYCGVGAGKVYARDMIEAHYRAC
LYAGLEISGINAEVMPSQWEFQVGPCTGIDMGDQLWMARYFLHRVAEEFGIKISFHPKPL
KGDWNGAGCHANVSTKEMRQPGGTKYIEQAIEKLSKRHAEHIKLYGSDNDMRLTGRHETA
SMTAFSSGVANRGSSIRIPRSVAKEGYGYFEDRRPASNIDPYLVTGIMCETVCGAIDNAD
MTKEFERESS
Download sequence
Identical sequences 3fky.A 3fky.B 3fky.C 3fky.D 3fky.E 3fky.F 3fky.G 3fky.H 3fky.I 3fky.J 3fky.K 3fky.L 3fky.M 3fky.N 3fky.O 3fky.P 3fky.Q 3fky.R 3fky.S 3fky.T YPR035W 4932.YPR035W YPR035w___KOG0683

Jump to [ Top of page · Domain architecture · Domain assignment details ]