SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YPR074C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPR074C
Domain Number 1 Region: 11-335
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.56e-109
Family TK-like PP module 1.38e-11
Further Details:      
 
Domain Number 2 Region: 338-534
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.06e-66
Family TK-like Pyr module 4.43e-09
Further Details:      
 
Domain Number 3 Region: 538-672
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 8.64e-43
Family Transketolase C-terminal domain-like 3.38e-07
Further Details:      
 

Protein sequence

External link(s) Locus: YPR074C   Protein: S000006278
Sequence length 680
Comment TKL1 SGDID:S000006278, Chr XVI from 694835-692793, reverse complement, Verified ORF, "Transketolase, similar to Tkl2p; catalyzes conversion of xylulose-5-phosphate and ribose-5-phosphate to sedoheptulose-7-phosphate and glyceraldehyde-3-phosphate in the pentose phosphate pathway; needed for synthesis of aromatic amino acids"
Sequence
MTQFTDIDKLAVSTIRILAVDTVSKANSGHPGAPLGMAPAAHVLWSQMRMNPTNPDWINR
DRFVLSNGHAVALLYSMLHLTGYDLSIEDLKQFRQLGSRTPGHPEFELPGVEVTTGPLGQ
GISNAVGMAMAQANLAATYNKPGFTLSDNYTYVFLGDGCLQEGISSEASSLAGHLKLGNL
IAIYDDNKITIDGATSISFDEDVAKRYEAYGWEVLYVENGNEDLAGIAKAIAQAKLSKDK
PTLIKMTTTIGYGSLHAGSHSVHGAPLKADDVKQLKSKFGFNPDKSFVVPQEVYDHYQKT
ILKPGVEANNKWNKLFSEYQKKFPELGAELARRLSGQLPANWESKLPTYTAKDSAVATRK
LSETVLEDVYNQLPELIGGSADLTPSNLTRWKEALDFQPPSSGSGNYSGRYIRYGIREHA
MGAIMNGISAFGANYKPYGGTFLNFVSYAAGAVRLSALSGHPVIWVATHDSIGVGEDGPT
HQPIETLAHFRSLPNIQVWRPADGNEVSAAYKNSLESKHTPSIIALSRQNLPQLEGSSIE
SASKGGYVLQDVANPDIILVATGSEVSLSVEAAKTLAAKNIKARVVSLPDFFTFDKQPLE
YRLSVLPDNVPIMSVEVLATTCWGKYAHQSFGIDRFGASGKAPEVFKFFGFTPEGVAERA
QKTIAFYKGDKLISPLKKAF
Download sequence
Identical sequences A6ZWW1 C7GY00 E7KIQ8 E7M1R1 G2WPP6 N1NXM0 P23254 W7P8W3 W7QRD5
YPR074C 1gpuA 4932.YPR074C YPR074C YPR074C tr|A6ZWW1|A6ZWW1_YEAS7 YPR074C 1gpu.A 1gpu.B 1ngs.A 1ngs.B 1trk.A 1trk.B YPR074C YPR074c___KOG0523 YPR074C YPR074C YPR074C

Jump to [ Top of page · Domain architecture · Domain assignment details ]