SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YPR074C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPR074C
Domain Number 1 Region: 11-335
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.56e-109
Family TK-like PP module 0.0000000000138
Further Details:      
 
Domain Number 2 Region: 338-534
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.06e-66
Family TK-like Pyr module 0.00000000443
Further Details:      
 
Domain Number 3 Region: 538-672
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 8.64e-43
Family Transketolase C-terminal domain-like 0.000000338
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
vitamin binding 2.226 21.15
oxidoreductase activity, acting on the aldehyde or oxo group of donors 1.874 9.78
sulfur compound binding 1.463 8.98
cofactor binding 1.604 6.69
lyase activity 1.477 6.1
magnesium ion binding 2.012 4.35
carboxy-lyase activity 2.067 3.07
Cellular Component IC (bits) H-Score
cytosol 1.305 10.12
mitochondrial matrix 1.716 8.58
microbody 1.955 6.53
plastid 1.6 6.14
lipid particle 1.519 4.63
external encapsulating structure 1.632 4.6
microtubule cytoskeleton 1.333 4.25
microtubule associated complex 1.998 4.25

Protein sequence

External link(s) Locus: YPR074C   Protein: S000006278
Sequence length 680
Comment TKL1 SGDID:S000006278, Chr XVI from 694835-692793, reverse complement, Verified ORF, "Transketolase, similar to Tkl2p; catalyzes conversion of xylulose-5-phosphate and ribose-5-phosphate to sedoheptulose-7-phosphate and glyceraldehyde-3-phosphate in the pentose phosphate pathway; needed for synthesis of aromatic amino acids"
Sequence
MTQFTDIDKLAVSTIRILAVDTVSKANSGHPGAPLGMAPAAHVLWSQMRMNPTNPDWINR
DRFVLSNGHAVALLYSMLHLTGYDLSIEDLKQFRQLGSRTPGHPEFELPGVEVTTGPLGQ
GISNAVGMAMAQANLAATYNKPGFTLSDNYTYVFLGDGCLQEGISSEASSLAGHLKLGNL
IAIYDDNKITIDGATSISFDEDVAKRYEAYGWEVLYVENGNEDLAGIAKAIAQAKLSKDK
PTLIKMTTTIGYGSLHAGSHSVHGAPLKADDVKQLKSKFGFNPDKSFVVPQEVYDHYQKT
ILKPGVEANNKWNKLFSEYQKKFPELGAELARRLSGQLPANWESKLPTYTAKDSAVATRK
LSETVLEDVYNQLPELIGGSADLTPSNLTRWKEALDFQPPSSGSGNYSGRYIRYGIREHA
MGAIMNGISAFGANYKPYGGTFLNFVSYAAGAVRLSALSGHPVIWVATHDSIGVGEDGPT
HQPIETLAHFRSLPNIQVWRPADGNEVSAAYKNSLESKHTPSIIALSRQNLPQLEGSSIE
SASKGGYVLQDVANPDIILVATGSEVSLSVEAAKTLAAKNIKARVVSLPDFFTFDKQPLE
YRLSVLPDNVPIMSVEVLATTCWGKYAHQSFGIDRFGASGKAPEVFKFFGFTPEGVAERA
QKTIAFYKGDKLISPLKKAF
Download sequence
Identical sequences A6ZWW1 C7GY00 E7KIQ8 E7M1R1 G2WPP6 N1NXM0 P23254 W7P8W3 W7QRD5
4932.YPR074C YPR074c___KOG0523 YPR074C tr|A6ZWW1|A6ZWW1_YEAS7 YPR074C YPR074C YPR074C YPR074C 1gpu.A 1gpu.B 1ngs.A 1ngs.B 1trk.A 1trk.B 1gpuA YPR074C YPR074C YPR074C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]