SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YPR074C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPR074C
Domain Number 1 Region: 11-335
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.56e-109
Family TK-like PP module 0.0000000000138
Further Details:      
 
Domain Number 2 Region: 338-534
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.06e-66
Family TK-like Pyr module 0.00000000443
Further Details:      
 
Domain Number 3 Region: 538-672
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 8.64e-43
Family Transketolase C-terminal domain-like 0.000000338
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
transferase complex 1.369 49.94
cytosol 1.295 10.78
mitochondrial matrix 1.611 8.62
plastid 1.525 5.46
oxidoreductase complex 1.828 5.25
external encapsulating structure 1.722 4.52
cell wall 1.824 4.52

Protein sequence

External link(s) Locus: YPR074C   Protein: S000006278
Sequence length 680
Comment TKL1 SGDID:S000006278, Chr XVI from 694835-692793, reverse complement, Verified ORF, "Transketolase, similar to Tkl2p; catalyzes conversion of xylulose-5-phosphate and ribose-5-phosphate to sedoheptulose-7-phosphate and glyceraldehyde-3-phosphate in the pentose phosphate pathway; needed for synthesis of aromatic amino acids"
Sequence
MTQFTDIDKLAVSTIRILAVDTVSKANSGHPGAPLGMAPAAHVLWSQMRMNPTNPDWINR
DRFVLSNGHAVALLYSMLHLTGYDLSIEDLKQFRQLGSRTPGHPEFELPGVEVTTGPLGQ
GISNAVGMAMAQANLAATYNKPGFTLSDNYTYVFLGDGCLQEGISSEASSLAGHLKLGNL
IAIYDDNKITIDGATSISFDEDVAKRYEAYGWEVLYVENGNEDLAGIAKAIAQAKLSKDK
PTLIKMTTTIGYGSLHAGSHSVHGAPLKADDVKQLKSKFGFNPDKSFVVPQEVYDHYQKT
ILKPGVEANNKWNKLFSEYQKKFPELGAELARRLSGQLPANWESKLPTYTAKDSAVATRK
LSETVLEDVYNQLPELIGGSADLTPSNLTRWKEALDFQPPSSGSGNYSGRYIRYGIREHA
MGAIMNGISAFGANYKPYGGTFLNFVSYAAGAVRLSALSGHPVIWVATHDSIGVGEDGPT
HQPIETLAHFRSLPNIQVWRPADGNEVSAAYKNSLESKHTPSIIALSRQNLPQLEGSSIE
SASKGGYVLQDVANPDIILVATGSEVSLSVEAAKTLAAKNIKARVVSLPDFFTFDKQPLE
YRLSVLPDNVPIMSVEVLATTCWGKYAHQSFGIDRFGASGKAPEVFKFFGFTPEGVAERA
QKTIAFYKGDKLISPLKKAF
Download sequence
Identical sequences A0A0L8VG37 A6ZWW1 C7GY00 E7KIQ8 E7M1R1 G2WPP6 N1NXM0 P23254
tr|A6ZWW1|A6ZWW1_YEAS7 YPR074C YPR074c___KOG0523 YPR074C YPR074C YPR074C 4932.YPR074C 1gpuA YPR074C 1gpu.A 1gpu.B 1ngs.A 1ngs.B 1trk.A 1trk.B YPR074C YPR074C YPR074C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]