SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YPR085C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPR085C
Domain Number 1 Region: 19-360
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000000000861
Family WD40-repeat 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
regulation of organ morphogenesis 1.688 29.77
kidney development 1.512 26.59
rRNA metabolic process 2.096 23.81
cilium assembly 1.371 22.68
RNA processing 1.496 18.18
microtubule-based movement 2.007 16.81
telomere organization 2.228 16.63
autophagy 2.133 16.23
microtubule-based process 1.533 14.77
sulfur compound metabolic process 1.496 14.2
Cellular Component IC (bits) H-Score
cullin-RING ubiquitin ligase complex 2.091 51.78
transferase complex 1.334 36.03
methyltransferase complex 2.1 21.1
cilium 1.616 18.76
nuclear transcription factor complex 1.972 13.26
membrane coat 2.031 10.66
vesicle membrane 1.602 9.39
cytoplasmic vesicle part 1.377 9.39
ciliary part 1.785 9.39
DNA-directed RNA polymerase II, holoenzyme 1.966 8.78

Protein sequence

External link(s) Locus: YPR085C   Protein: S000006289
Sequence length 443
Comment YPR085C SGDID:S000006289, Chr XVI from 709826-708495, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; YPR085C is an essential gene"
Sequence
MRGFSNEIILKRTLTLSDFTLRYHKRGITALQVIKAPSVSNVPVLLSGDNYGYFVMWDLV
TKRPITHIEIEGNSHIIAFWWVETTNVLYILSKDSMLRIFELDSSTQLSIDLVRKLSQAN
KTDHLQWTKIYEMPINTLNFANFIIEAEVKPTKDNKSYRLVCCHTDDSETIDIYQIIEDS
TFKLKRPFNNINFPRFLKQQNFLGISKDSKFGIIMRFAKLNDVIFLGYENGFVVGFKITF
DEGLQRDIAELVHVSNDHYPNPILDMCVSGDELYSCSTDDFITKYKIPVNLQLETKYLRD
DALLIKCPSSLRVSEPSKVHLPLKNIGHIDKVKDDYLVVSSWSGMTIVYNMRTSEVEQTF
VKSKNNLVVSDSSMGDLTNGSGSNTESSSKSHNYKVGAMTCLESFDVQSDGLRLGQLRRI
KALAKCNWCLIGYEDGTIKLNKI
Download sequence
Identical sequences A6ZWX0 B3LK55 C8ZJB0 E7KV26 E7M1R8 E7QLW6 Q06822 W7PK64 W7R673
YPR085C YPR085C YPR085C YPR085C YPR085C 4932.YPR085C YPR085C SCRT_02567 YPR085C YPR085C YPR085C tr|A6ZWX0|A6ZWX0_YEAS7 YPR085C YPR085C YPR085C YPR085C YPR085C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]