SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YPR085C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPR085C
Domain Number 1 Region: 19-360
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000000000861
Family WD40-repeat 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
regulation of organ morphogenesis 1.683 29.68
kidney development 1.515 26.51
digestive tract development 2.033 24.08
rRNA metabolic process 2.071 23.36
cilium assembly 1.378 22.22
RNA processing 1.499 17.76
telomere organization 2.237 16.58
microtubule-based movement 1.993 16.43
process utilizing autophagic mechanism 2.127 15.81
microtubule-based process 1.532 14.67
Cellular Component IC (bits) H-Score
cullin-RING ubiquitin ligase complex 2.116 52.17
transferase complex 1.369 36.23
organelle envelope 1.405 25.6
methyltransferase complex 2.143 21.65
cilium 1.675 18.56
nuclear transcription factor complex 2.016 13.21
membrane coat 2.044 11.36
cytoplasmic vesicle part 1.417 9.77
endosome 1.351 9.77
endosome membrane 1.934 9.77

Protein sequence

External link(s) Locus: YPR085C   Protein: S000006289
Sequence length 443
Comment YPR085C SGDID:S000006289, Chr XVI from 709826-708495, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; YPR085C is an essential gene"
Sequence
MRGFSNEIILKRTLTLSDFTLRYHKRGITALQVIKAPSVSNVPVLLSGDNYGYFVMWDLV
TKRPITHIEIEGNSHIIAFWWVETTNVLYILSKDSMLRIFELDSSTQLSIDLVRKLSQAN
KTDHLQWTKIYEMPINTLNFANFIIEAEVKPTKDNKSYRLVCCHTDDSETIDIYQIIEDS
TFKLKRPFNNINFPRFLKQQNFLGISKDSKFGIIMRFAKLNDVIFLGYENGFVVGFKITF
DEGLQRDIAELVHVSNDHYPNPILDMCVSGDELYSCSTDDFITKYKIPVNLQLETKYLRD
DALLIKCPSSLRVSEPSKVHLPLKNIGHIDKVKDDYLVVSSWSGMTIVYNMRTSEVEQTF
VKSKNNLVVSDSSMGDLTNGSGSNTESSSKSHNYKVGAMTCLESFDVQSDGLRLGQLRRI
KALAKCNWCLIGYEDGTIKLNKI
Download sequence
Identical sequences A6ZWX0 B3LK55 C8ZJB0 E7KV26 E7M1R8 E7QLW6 Q06822
YPR085C YPR085C YPR085C YPR085C YPR085C YPR085C YPR085C tr|A6ZWX0|A6ZWX0_YEAS7 YPR085C 4932.YPR085C YPR085C YPR085C SCRT_02567 YPR085C YPR085C YPR085C YPR085C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]