SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YPR085C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPR085C
Domain Number 1 Region: 19-360
Classification Level Classification E-value
Superfamily WD40 repeat-like 8.61e-15
Family WD40-repeat 0.045
Further Details:      
 

Protein sequence

External link(s) Locus: YPR085C   Protein: S000006289
Sequence length 443
Comment YPR085C SGDID:S000006289, Chr XVI from 709826-708495, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; YPR085C is an essential gene"
Sequence
MRGFSNEIILKRTLTLSDFTLRYHKRGITALQVIKAPSVSNVPVLLSGDNYGYFVMWDLV
TKRPITHIEIEGNSHIIAFWWVETTNVLYILSKDSMLRIFELDSSTQLSIDLVRKLSQAN
KTDHLQWTKIYEMPINTLNFANFIIEAEVKPTKDNKSYRLVCCHTDDSETIDIYQIIEDS
TFKLKRPFNNINFPRFLKQQNFLGISKDSKFGIIMRFAKLNDVIFLGYENGFVVGFKITF
DEGLQRDIAELVHVSNDHYPNPILDMCVSGDELYSCSTDDFITKYKIPVNLQLETKYLRD
DALLIKCPSSLRVSEPSKVHLPLKNIGHIDKVKDDYLVVSSWSGMTIVYNMRTSEVEQTF
VKSKNNLVVSDSSMGDLTNGSGSNTESSSKSHNYKVGAMTCLESFDVQSDGLRLGQLRRI
KALAKCNWCLIGYEDGTIKLNKI
Download sequence
Identical sequences A6ZWX0 B3LK55 C8ZJB0 E7KV26 E7M1R8 E7QLW6 Q06822
YPR085C YPR085C 4932.YPR085C YPR085C YPR085C SCRT_02567 YPR085C tr|A6ZWX0|A6ZWX0_YEAS7 YPR085C YPR085C YPR085C YPR085C YPR085C YPR085C YPR085C YPR085C YPR085C

Jump to [ Top of page · Domain architecture · Domain assignment details ]