SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YPR086W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPR086W
Domain Number 1 Region: 238-328
Classification Level Classification E-value
Superfamily Cyclin-like 2.68e-23
Family Transcription factor IIB (TFIIB), core domain 0.0018
Further Details:      
 
Domain Number 2 Region: 127-214
Classification Level Classification E-value
Superfamily Cyclin-like 4.54e-19
Family Transcription factor IIB (TFIIB), core domain 0.0023
Further Details:      
 
Domain Number 3 Region: 18-70
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 5.95e-14
Family Transcriptional factor domain 0.0025
Further Details:      
 

Protein sequence

External link(s) Locus: YPR086W   Protein: S000006290
Sequence length 345
Comment SUA7 SGDID:S000006290, Chr XVI from 710099-711136, Verified ORF, "Transcription factor TFIIB, a general transcription factor required for transcription initiation and start site selection by RNA polymerase II"
Sequence
MMTRESIDKRAGRRGPNLNIVLTCPECKVYPPKIVERFSEGDVVCALCGLVLSDKLVDTR
SEWRTFSNDDHNGDDPSRVGEASNPLLDGNNLSTRIGKGETTDMRFTKELNKAQGKNVMD
KKDNEVQAAFAKITMLCDAAELPKIVKDCAKEAYKLCHDEKTLKGKSMESIMAASILIGC
RRAEVARTFKEIQSLIHVKTKEFGKTLNIMKNILRGKSEDGFLKIDTDNMSGAQNLTYIP
RFCSHLGLPMQVTTSAEYTAKKCKEIKEIAGKSPITIAVVSIYLNILLFQIPITAAKVGQ
TLQVTEGTIKSGYKILYEHRDKLVDPQLIANGVVSLDNLPGVEKK
Download sequence
Identical sequences N1NXN0 P29055
YPR086W 4932.YPR086W YPR086W YPR086W YPR086W 3k7a.M 4bbr.M 4bbs.M YPR086w___KOG1597 YPR086W

Jump to [ Top of page · Domain architecture · Domain assignment details ]