SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YPR104C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPR104C
Domain Number 1 Region: 460-547
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.76e-25
Family Forkhead DNA-binding domain 0.00083
Further Details:      
 
Domain Number 2 Region: 237-394
Classification Level Classification E-value
Superfamily SMAD/FHA domain 8.99e-23
Family FHA domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
protein-DNA complex 1.923 57.09
cell-substrate junction 1.548 53.12
cytoplasmic vesicle part 1.417 32.5
endosome 1.351 32.5
endosome membrane 1.934 32.5
chromosomal part 1.512 14.52
transferase complex 1.369 13.95
nucleoplasm part 1.369 13.95
DNA-directed RNA polymerase II, holoenzyme 2.009 10.79
cell-cell junction 1.461 10.18

Protein sequence

External link(s) Locus: YPR104C   Protein: S000006308
Sequence length 936
Comment FHL1 SGDID:S000006308, Chr XVI from 736431-733621, reverse complement, Verified ORF, "Transcriptional activator with similarity to DNA-binding domain of Drosophila forkhead but unable to bind DNA in vitro; required for rRNA processing; isolated as a suppressor of splicing factor prp4"
Sequence
MDGEMAIIESSNHVGTSSPTTETQFTIDSSALKDQETKESITNSPTSEVPIETKLPKSSD
IVTEEKHPQNTTTDIENEVENPVTDDNGNLKLELPDNLDNADFSKLLEFDAKNDEALFNS
NELLSHTMDPVNNIDLTHDHSREVSSKEDINIEPVNPDEDEREKTQDNTAAVKTEGIRNS
EDTSIQKDEPTADAIYTDVHKLSVNKDTETLPTLVDEKNNMLHMRNNSITPIMFQQHELV
GQPPQNTVTENNSTDAETTQRKLSEPIDASLPLPNEQPTIFAYARLDFQSFTFYVQTLHA
IIGRRSENDFSHKVDVNLGPSKSISRRHAQIFYNFGTGRFELSIIGKNGAFVDDIFVEKG
NTVPLRNKTKIQIGQIPFQFILPEQERNDDSKSPENADIAESEINTRNLKKNEPKSKKKI
TTGAKPKKAQTKPAVKKEKKPPKIPKKVYTLEEIPVEYRTKPTVSYSAMLTTCIRKYSTA
KGMSLSEIYAGIRELFPYYKYCPDGWQSSVRHNLSLNKSFRKVSKEGKGWLWGLDEEYIA
ERERQKKKQSEIAVAKAQAAQLKLEQQQHKLQQVPQRGKKDIVSQRSNVNARKQNISQTL
AANRAASNRKNTASDNQRTMKYLQEQLVILTRDRKGLSKQVIAAILTQALAMTINQVTQA
AKNKGITGNPLTALMDKNPQHLNLILAAAVNAATAKVTKGEVKQLVNPETTAAAALAAKA
QHSKPIRQPIVQTPHVPDRPPSQLSASASSHPNNYLHDKQPGSFDPSSLSRFFQPRQNAR
ATSSVAATSVPAAASQNVDAQPKPKPAQDNDLESESGTSSSSSSSSESGSESDSGSDDGS
ASGSGDNSSTSSESESESDSGSEVDEKNNKNEKIDSESIKNNESKDDIPSKDENSSNDNR
EISKTDEEGHDSKRRKVSEDINEGITEVNVSLEEKL
Download sequence
Identical sequences A0A0L8VG68 A6ZWY4 B3LK68 P39521
YPR104C tr|A6ZWY4|A6ZWY4_YEAS7 SCRT_02581 YPR104C 4932.YPR104C YPR104C YPR104C YPR104C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]