SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YPR104C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPR104C
Domain Number 1 Region: 460-547
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.76e-25
Family Forkhead DNA-binding domain 0.00083
Further Details:      
 
Domain Number 2 Region: 237-394
Classification Level Classification E-value
Superfamily SMAD/FHA domain 8.99e-23
Family FHA domain 0.0049
Further Details:      
 

Protein sequence

External link(s) Locus: YPR104C   Protein: S000006308
Sequence length 936
Comment FHL1 SGDID:S000006308, Chr XVI from 736431-733621, reverse complement, Verified ORF, "Transcriptional activator with similarity to DNA-binding domain of Drosophila forkhead but unable to bind DNA in vitro; required for rRNA processing; isolated as a suppressor of splicing factor prp4"
Sequence
MDGEMAIIESSNHVGTSSPTTETQFTIDSSALKDQETKESITNSPTSEVPIETKLPKSSD
IVTEEKHPQNTTTDIENEVENPVTDDNGNLKLELPDNLDNADFSKLLEFDAKNDEALFNS
NELLSHTMDPVNNIDLTHDHSREVSSKEDINIEPVNPDEDEREKTQDNTAAVKTEGIRNS
EDTSIQKDEPTADAIYTDVHKLSVNKDTETLPTLVDEKNNMLHMRNNSITPIMFQQHELV
GQPPQNTVTENNSTDAETTQRKLSEPIDASLPLPNEQPTIFAYARLDFQSFTFYVQTLHA
IIGRRSENDFSHKVDVNLGPSKSISRRHAQIFYNFGTGRFELSIIGKNGAFVDDIFVEKG
NTVPLRNKTKIQIGQIPFQFILPEQERNDDSKSPENADIAESEINTRNLKKNEPKSKKKI
TTGAKPKKAQTKPAVKKEKKPPKIPKKVYTLEEIPVEYRTKPTVSYSAMLTTCIRKYSTA
KGMSLSEIYAGIRELFPYYKYCPDGWQSSVRHNLSLNKSFRKVSKEGKGWLWGLDEEYIA
ERERQKKKQSEIAVAKAQAAQLKLEQQQHKLQQVPQRGKKDIVSQRSNVNARKQNISQTL
AANRAASNRKNTASDNQRTMKYLQEQLVILTRDRKGLSKQVIAAILTQALAMTINQVTQA
AKNKGITGNPLTALMDKNPQHLNLILAAAVNAATAKVTKGEVKQLVNPETTAAAALAAKA
QHSKPIRQPIVQTPHVPDRPPSQLSASASSHPNNYLHDKQPGSFDPSSLSRFFQPRQNAR
ATSSVAATSVPAAASQNVDAQPKPKPAQDNDLESESGTSSSSSSSSESGSESDSGSDDGS
ASGSGDNSSTSSESESESDSGSEVDEKNNKNEKIDSESIKNNESKDDIPSKDENSSNDNR
EISKTDEEGHDSKRRKVSEDINEGITEVNVSLEEKL
Download sequence
Identical sequences A6ZWY4 B3LK68 P39521 W7R6B5
YPR104C 4932.YPR104C YPR104C YPR104C SCRT_02581 YPR104C tr|A6ZWY4|A6ZWY4_YEAS7 YPR104C

Jump to [ Top of page · Domain architecture · Domain assignment details ]