SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YPR110C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPR110C
Domain Number 1 Region: 76-221
Classification Level Classification E-value
Superfamily Insert subdomain of RNA polymerase alpha subunit 4.71e-39
Family Insert subdomain of RNA polymerase alpha subunit 0.00087
Further Details:      
 
Domain Number 2 Region: 38-81,248-331
Classification Level Classification E-value
Superfamily RBP11-like subunits of RNA polymerase 4.51e-38
Family RNA polymerase alpha subunit dimerisation domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
nucleotidyltransferase activity 1.652 40.23
Cellular Component IC (bits) H-Score
DNA-directed RNA polymerase complex 2.004 86.28
nucleoplasm part 1.419 6.44
plastid 1.6 5.07
nucleolus 1.651 3.67
Biological Process IC (bits) H-Score
RNA biosynthetic process 1.536 24.68
macropinocytosis 2.207 4.51

Protein sequence

External link(s) Locus: YPR110C   Protein: S000006314
Sequence length 335
Comment RPC40 SGDID:S000006314, Chr XVI from 746833-745826, reverse complement, Verified ORF, "RNA polymerase subunit, common to RNA polymerase I and III"
Sequence
MSNIVGIEYNRVTNTTSTDFPGFSKDAENEWNVEKFKKDFEVNISSLDAREANFDLINID
TSIANAFRRIMISEVPSVAAEYVYFFNNTSVIQDEVLAHRIGLVPLKVDPDMLTWVDSNL
PDDEKFTDENTIVLSLNVKCTRNPDAPKGSTDPKELYNNAHVYARDLKFEPQGRQSTTFA
DCPVVPADPDILLAKLRPGQEISLKAHCILGIGGDHAKFSPVSTASYRLLPQINILQPIK
GESARRFQKCFPPGVIGIDEGSDEAYVKDARKDTVSREVLRYEEFADKVKLGRVRNHFIF
NVESAGAMTPEEIFFKSVRILKNKAEYLKNCPITQ
Download sequence
Identical sequences A6ZWZ1 C7GXS2 E7NP09 G2WPS7 N1NWG0 P07703
YPR110C YPR110C YPR110C YPR110C YPR110C YPR110C 4932.YPR110C YPR110C YPR110C YPR110C tr|A6ZWZ1|A6ZWZ1_YEAS7 4c2m.C 4c2m.R 4c3h.C 4c3i.C 4c3j.C YPR110C YPR110C YPR110C YPR110C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]