SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YPR110C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPR110C
Domain Number 1 Region: 76-221
Classification Level Classification E-value
Superfamily Insert subdomain of RNA polymerase alpha subunit 4.71e-39
Family Insert subdomain of RNA polymerase alpha subunit 0.00087
Further Details:      
 
Domain Number 2 Region: 38-81,248-331
Classification Level Classification E-value
Superfamily RBP11-like subunits of RNA polymerase 4.51e-38
Family RNA polymerase alpha subunit dimerisation domain 0.0096
Further Details:      
 

Protein sequence

External link(s) Locus: YPR110C   Protein: S000006314
Sequence length 335
Comment RPC40 SGDID:S000006314, Chr XVI from 746833-745826, reverse complement, Verified ORF, "RNA polymerase subunit, common to RNA polymerase I and III"
Sequence
MSNIVGIEYNRVTNTTSTDFPGFSKDAENEWNVEKFKKDFEVNISSLDAREANFDLINID
TSIANAFRRIMISEVPSVAAEYVYFFNNTSVIQDEVLAHRIGLVPLKVDPDMLTWVDSNL
PDDEKFTDENTIVLSLNVKCTRNPDAPKGSTDPKELYNNAHVYARDLKFEPQGRQSTTFA
DCPVVPADPDILLAKLRPGQEISLKAHCILGIGGDHAKFSPVSTASYRLLPQINILQPIK
GESARRFQKCFPPGVIGIDEGSDEAYVKDARKDTVSREVLRYEEFADKVKLGRVRNHFIF
NVESAGAMTPEEIFFKSVRILKNKAEYLKNCPITQ
Download sequence
Identical sequences A6ZWZ1 C7GXS2 E7NP09 G2WPS7 N1NWG0 P07703
YPR110C YPR110C YPR110C YPR110C YPR110C YPR110C 4932.YPR110C YPR110C YPR110C YPR110C tr|A6ZWZ1|A6ZWZ1_YEAS7 YPR110C YPR110C YPR110C YPR110C

Jump to [ Top of page · Domain architecture · Domain assignment details ]