SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YPR133W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YPR133W-A   Protein: S000006433
Sequence length 50
Comment TOM5 SGDID:S000006433, Chr XVI from 797553-797705, Verified ORF, "Small mitochondrial outer membrane protein crucial to a binding relay for the import of proteins into mitochondria; subunit on the outer mouth of the TOM channel that accepts precursors from the receptors Tom20p and Tom22p"
Sequence
MFGLPQQEVSEEEKRAHQEQTEKTLKQAAYVAAFLWVSPMIWHLVKKQWK
Download sequence
Identical sequences A6ZX11 B3LK95 B5VTR9 C7GLJ4 C8ZJF6 G2WPU8 N1NVL5 P80967 W7P905 W7R6D8
YPR133W-A YPR133W-A YPR133W-A YPR133W-A YPR133W-A YPR133W-A YPR133W-A YPR133W-A YPR133W-A YPR133W-A YPR133W-A YPR133W-A YPR133W-A 4932.YPR133W-A YPR133W-A YPR133W-A SCRT_02609 YPR133W-A YPR133W-A tr|A6ZX11|A6ZX11_YEAS7 YPR133W-A YPR133W-A YPR133W-A YPR133W-A YPR133W-A YPR133W-A YPR133W-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]