SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YPR159W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPR159W
Domain Number 1 Region: 319-450,496-661
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.62e-41
Family Glycosyl hydrolases family 16 0.013
Further Details:      
 
Weak hits

Sequence:  YPR159W
Domain Number - Region: 238-285
Classification Level Classification E-value
Superfamily Photosystem I subunits PsaA/PsaB 0.0994
Family Photosystem I subunits PsaA/PsaB 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
basal lamina 1.529 37.46
stereocilia ankle link complex 1.853 18.94
ribonucleoprotein complex 1.415 18.28
endoplasmic reticulum lumen 2.106 13.94
ribonucleoprotein granule 1.998 12.96
endoplasmic reticulum part 1.429 12.66
nucleoplasm part 1.419 12.46
nuclear body 1.911 12.46
methyltransferase complex 2.218 10.71
sarcoplasmic reticulum 1.985 9.55

Protein sequence

External link(s) Locus: YPR159W   Protein: S000006363
Sequence length 720
Comment KRE6 SGDID:S000006363, Chr XVI from 857579-859741, Verified ORF, "Protein required for beta-1,6 glucan biosynthesis; putative beta-glucan synthase; appears functionally redundant with Skn1p"
Sequence
MPLRNLTETHNFSSTNLDTDGTGDDHDGAPLSSSPSFGQQNDNSTNDNAGLTNPFMGSDE
ESNARDGESLSSSVHYQPQGSDSSLLHDNSRLDLSQNKGVSDYKGYYSRNNSRAVSTAND
NSFLQPPHRAIASSPSLNSNLSKNDILSPPEFDRYPLVGSRVTSMTQLNHHGRSPTSSPG
NESSASFSSNPFLGEQDFSPFGGYPASSFPLMIDEKEEDDYLHNPDPEEEARLDRRRFID
DFKYMDKRSASGLAGVLLLFLAAIFIFIVLPALTFTGAIDHESNTEEVTYLTQYQYPQLS
AIRTSLVDPDTPDTAKTREAMDGSKWELVFSDEFNAEGRTFYDGDDPYWTAPDVHYDATK
DLEWYSPDASTTVNGTLQLRMDAFKNHGLYYRSGMLQSWNKVCFTQGALEISANLPNYGR
VSGLWPGLWTMGNLGRPGYLASTQGVWPYSYESCDAGITPNQSSPDGISYLPGQKLSICT
CDGEDHPNQGVGRGAPEIDVLEGETDTKIGVGIASQSLQIAPFDIWYMPDYDFIEVYNFT
TTTMNTYAGGPFQQAVSAVSTLNVTWYEFGEYGGYFQKYAIEYLNDDDNGYIRWFVGDTP
TYTIHAKALHPDGNIGWRRISKEPMSIILNLGISNNWAYIDWQYIFFPVVMSIDYVRIYQ
PSNAISVTCDPSDYPTYDYIQSHLNAFQNANLTTWEDAGYTFPKNILTGKCTSSKFKLSS
Download sequence
Identical sequences A6ZX34 B3LKB9 B5VTU3 C8ZJI2 E7M199 N1NW62 P32486 W7PKB5
YPR159W YPR159W 4932.YPR159W YPR159W YPR159W SCRT_02633 YPR159W tr|A6ZX34|A6ZX34_YEAS7 YPR159W YPR159W YPR159W YPR159W YPR159W YPR159W YPR159W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]