SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YPR159W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPR159W
Domain Number 1 Region: 319-450,496-661
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.62e-41
Family Glycosyl hydrolases family 16 0.013
Further Details:      
 
Weak hits

Sequence:  YPR159W
Domain Number - Region: 238-285
Classification Level Classification E-value
Superfamily Photosystem I subunits PsaA/PsaB 0.0994
Family Photosystem I subunits PsaA/PsaB 0.032
Further Details:      
 

Protein sequence

External link(s) Locus: YPR159W   Protein: S000006363
Sequence length 720
Comment KRE6 SGDID:S000006363, Chr XVI from 857579-859741, Verified ORF, "Protein required for beta-1,6 glucan biosynthesis; putative beta-glucan synthase; appears functionally redundant with Skn1p"
Sequence
MPLRNLTETHNFSSTNLDTDGTGDDHDGAPLSSSPSFGQQNDNSTNDNAGLTNPFMGSDE
ESNARDGESLSSSVHYQPQGSDSSLLHDNSRLDLSQNKGVSDYKGYYSRNNSRAVSTAND
NSFLQPPHRAIASSPSLNSNLSKNDILSPPEFDRYPLVGSRVTSMTQLNHHGRSPTSSPG
NESSASFSSNPFLGEQDFSPFGGYPASSFPLMIDEKEEDDYLHNPDPEEEARLDRRRFID
DFKYMDKRSASGLAGVLLLFLAAIFIFIVLPALTFTGAIDHESNTEEVTYLTQYQYPQLS
AIRTSLVDPDTPDTAKTREAMDGSKWELVFSDEFNAEGRTFYDGDDPYWTAPDVHYDATK
DLEWYSPDASTTVNGTLQLRMDAFKNHGLYYRSGMLQSWNKVCFTQGALEISANLPNYGR
VSGLWPGLWTMGNLGRPGYLASTQGVWPYSYESCDAGITPNQSSPDGISYLPGQKLSICT
CDGEDHPNQGVGRGAPEIDVLEGETDTKIGVGIASQSLQIAPFDIWYMPDYDFIEVYNFT
TTTMNTYAGGPFQQAVSAVSTLNVTWYEFGEYGGYFQKYAIEYLNDDDNGYIRWFVGDTP
TYTIHAKALHPDGNIGWRRISKEPMSIILNLGISNNWAYIDWQYIFFPVVMSIDYVRIYQ
PSNAISVTCDPSDYPTYDYIQSHLNAFQNANLTTWEDAGYTFPKNILTGKCTSSKFKLSS
Download sequence
Identical sequences A6ZX34 B3LKB9 B5VTU3 C8ZJI2 E7M199 N1NW62 P32486 W7PKB5
YPR159W YPR159W 4932.YPR159W YPR159W YPR159W SCRT_02633 YPR159W tr|A6ZX34|A6ZX34_YEAS7 YPR159W YPR159W YPR159W YPR159W YPR159W YPR159W YPR159W

Jump to [ Top of page · Domain architecture · Domain assignment details ]