SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YPR160C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YPR160C-A   Protein: S000028726
Sequence length 94
Comment YPR160C-A SGDID:S000028726, Chr XVI from 862857-862573, reverse complement, Dubious ORF, "Identified by gene-trapping, microarray-based expression analysis, and genome-wide homology searching"
Sequence
MVVLINSECNSATPLTLCEPTIAKKAILICLSGEFSSMMDIRDKRSTSLGNFLATSCKKN
QLISYIISKCLGSKWPKRPTGHFSRASCITVWLV
Download sequence
Identical sequences C8ZJI6 Q8TGK8
YPR160C-A YPR160C-A YPR160C-A YPR160C-A YPR160C-A YPR160C-A YPR160C-A YPR160C-A YPR160C-A YPR160C-A YPR160C-A YPR160C-A YPR160C-A 4932.YPR160C-A YPR160C-A YPR160C-A YPR160C-A YPR160C-A YPR160C-A YPR160C-A YPR160C-A YPR160C-A YPR160C-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]