SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YPR160C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YPR160C-A   Protein: S000028726
Sequence length 94
Comment YPR160C-A SGDID:S000028726, Chr XVI from 862857-862573, reverse complement, Dubious ORF, "Identified by gene-trapping, microarray-based expression analysis, and genome-wide homology searching"
Sequence
MVVLINSECNSATPLTLCEPTIAKKAILICLSGEFSSMMDIRDKRSTSLGNFLATSCKKN
QLISYIISKCLGSKWPKRPTGHFSRASCITVWLV
Download sequence
Identical sequences C8ZJI6 Q8TGK8
YPR160C-A YPR160C-A YPR160C-A YPR160C-A YPR160C-A YPR160C-A YPR160C-A YPR160C-A YPR160C-A YPR160C-A YPR160C-A YPR160C-A YPR160C-A 4932.YPR160C-A YPR160C-A YPR160C-A YPR160C-A YPR160C-A YPR160C-A YPR160C-A YPR160C-A YPR160C-A YPR160C-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]