SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YPR162C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPR162C
Domain Number 1 Region: 69-274
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.54e-12
Family G proteins 0.073
Further Details:      
 

Protein sequence

External link(s) Locus: YPR162C   Protein: S000006366
Sequence length 529
Comment ORC4 SGDID:S000006366, Chr XVI from 868300-866711, reverse complement, Verified ORF, "Subunit of the origin recognition complex, which directs DNA replication by binding to replication origins and is also involved in transcriptional silencing"
Sequence
MTISEARLSPQVNLLPIKRHSNEEVEETAAILKKRTIDNEKCKDSDPGFGSLQRRLLQQL
YGTLPTDEKIIFTYLQDCQQEIDRIIKQSIIQKESHSVILVGPRQSYKTYLLDYELSLLQ
QSYKEQFITIRLNGFIHSEQTAINGIATQLEQQLQKIHGSEEKIDDTSLETISSGSLTEV
FEKILLLLDSTTKTRNEDSGEVDRESITKITVVFIFDEIDTFAGPVRQTLLYNLFDMVEH
SRVPVCIFGCTTKLNILEYLEKRVKSRFSQRVIYMPQIQNLDDMVDAVRNLLTVRSEISP
WVSQWNETLEKELSDPRSNLNRHIRMNFETFRSLPTLKNSIIPLVATSKNFGSLCTAIKS
CSFLDIYNKNQLSNNLTGRLQSLSDLELAILISAARVALRAKDGSFNFNLAYAEYEKMIK
AINSRIPTVAPTTNVGTGQSTFSIDNTIKLWLKKDVKNVWENLVQLDFFTEKSAVGLRDN
ATAAFYASNYQFQGTMIPFDLRSYQMQIILQELRRIIPKSNMYYSWTQL
Download sequence
Identical sequences A6ZX38 B3LKC3 C7GP45 E7KIZ0 P54791
YPR162C YPR162C YPR162C YPR162C YPR162C YPR162C 355027 4932.YPR162C YPR162C SCRT_02637 YPR162C tr|A6ZX38|A6ZX38_YEAS7 YPR162C YPR162C YPR162C

Jump to [ Top of page · Domain architecture · Domain assignment details ]