SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YPR162C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPR162C
Domain Number 1 Region: 69-274
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000954
Family G proteins 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
actin cytoskeleton 1.39 26.96
microtubule associated complex 2.062 25.24
cilium 1.637 21.89
ciliary part 1.792 20.48
chromosomal part 1.471 20.12
transporter complex 1.657 19
midbody 2.148 18.28
side of membrane 1.57 16.03
endosome 1.318 12.91
nucleoplasm part 1.424 12.35

Protein sequence

External link(s) Locus: YPR162C   Protein: S000006366
Sequence length 529
Comment ORC4 SGDID:S000006366, Chr XVI from 868300-866711, reverse complement, Verified ORF, "Subunit of the origin recognition complex, which directs DNA replication by binding to replication origins and is also involved in transcriptional silencing"
Sequence
MTISEARLSPQVNLLPIKRHSNEEVEETAAILKKRTIDNEKCKDSDPGFGSLQRRLLQQL
YGTLPTDEKIIFTYLQDCQQEIDRIIKQSIIQKESHSVILVGPRQSYKTYLLDYELSLLQ
QSYKEQFITIRLNGFIHSEQTAINGIATQLEQQLQKIHGSEEKIDDTSLETISSGSLTEV
FEKILLLLDSTTKTRNEDSGEVDRESITKITVVFIFDEIDTFAGPVRQTLLYNLFDMVEH
SRVPVCIFGCTTKLNILEYLEKRVKSRFSQRVIYMPQIQNLDDMVDAVRNLLTVRSEISP
WVSQWNETLEKELSDPRSNLNRHIRMNFETFRSLPTLKNSIIPLVATSKNFGSLCTAIKS
CSFLDIYNKNQLSNNLTGRLQSLSDLELAILISAARVALRAKDGSFNFNLAYAEYEKMIK
AINSRIPTVAPTTNVGTGQSTFSIDNTIKLWLKKDVKNVWENLVQLDFFTEKSAVGLRDN
ATAAFYASNYQFQGTMIPFDLRSYQMQIILQELRRIIPKSNMYYSWTQL
Download sequence
Identical sequences A6ZX38 B3LKC3 C7GP45 E7KIZ0 N1NWJ7 P54791 W7PJA9
YPR162C 4932.YPR162C YPR162C YPR162C YPR162C YPR162C YPR162C YPR162C YPR162C 355027 YPR162C SCRT_02637 YPR162C YPR162C tr|A6ZX38|A6ZX38_YEAS7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]