SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YPR167C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPR167C
Domain Number 1 Region: 25-213
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.33e-37
Family PAPS reductase-like 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
RNA modification 2.178 61.97
ncRNA processing 1.877 48.52
ncRNA metabolic process 1.572 40.84
RNA processing 1.458 30.47
response to fungus 2.216 24.02
cofactor metabolic process 1.433 22.11
coenzyme biosynthetic process 1.925 22.11
sulfur compound metabolic process 1.55 21.34
oxidation-reduction process 1.416 21.34
cellular amino acid biosynthetic process 1.597 17.21
Cellular Component IC (bits) H-Score
cytosol 1.307 17.56
external encapsulating structure 1.635 3.87
cell wall 1.752 3.87

Protein sequence

External link(s) Locus: YPR167C   Protein: S000006371
Sequence length 261
Comment MET16 SGDID:S000006371, Chr XVI from 877628-876843, reverse complement, Verified ORF, "3'-phosphoadenylsulfate reductase, reduces 3'-phosphoadenylyl sulfate to adenosine-3',5'-bisphosphate and free sulfite using reduced thioredoxin as cosubstrate, involved in sulfate assimilation and methionine metabolism"
Sequence
MKTYHLNNDIIVTQEQLDHWNEQLIKLETPQEIIAWSIVTFPHLFQTTAFGLTGLVTIDM
LSKLSEKYYMPELLFIDTLHHFPQTLTLKNEIEKKYYQPKNQTIHVYKPDGCESEADFAS
KYGDFLWEKDDDKYDYLAKVEPAHRAYKELHISAVFTGRRKSQGSARSQLSIIEIDELNG
ILKINPLINWTFEQVKQYIDANNVPYNELLDLGYRSIGDYHSTQPVKEGEDERAGRWKGK
AKTECGIHEASRFAQFLKQDA
Download sequence
Identical sequences B3LKC8 B5VTV1 C7GP50 C8ZJJ3 E7KIZ4 E7KVQ1 E7M1A6 E7NP40 E7QM19 H0GQ72 N1NXV3 P18408
YPR167C YPR167C YPR167C YPR167C 4932.YPR167C SCRT_02642 YPR167C YPR167C YPR167C YPR167C YPR167C YPR167C YPR167C YPR167C YPR167C YPR167C YPR167C YPR167C YPR167C YPR167C YPR167C YPR167C YPR167C 2oq2.A 2oq2.B 2oq2.C 2oq2.D

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]