SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YPR167C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPR167C
Domain Number 1 Region: 25-213
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.33e-37
Family PAPS reductase-like 0.00033
Further Details:      
 

Protein sequence

External link(s) Locus: YPR167C   Protein: S000006371
Sequence length 261
Comment MET16 SGDID:S000006371, Chr XVI from 877628-876843, reverse complement, Verified ORF, "3'-phosphoadenylsulfate reductase, reduces 3'-phosphoadenylyl sulfate to adenosine-3',5'-bisphosphate and free sulfite using reduced thioredoxin as cosubstrate, involved in sulfate assimilation and methionine metabolism"
Sequence
MKTYHLNNDIIVTQEQLDHWNEQLIKLETPQEIIAWSIVTFPHLFQTTAFGLTGLVTIDM
LSKLSEKYYMPELLFIDTLHHFPQTLTLKNEIEKKYYQPKNQTIHVYKPDGCESEADFAS
KYGDFLWEKDDDKYDYLAKVEPAHRAYKELHISAVFTGRRKSQGSARSQLSIIEIDELNG
ILKINPLINWTFEQVKQYIDANNVPYNELLDLGYRSIGDYHSTQPVKEGEDERAGRWKGK
AKTECGIHEASRFAQFLKQDA
Download sequence
Identical sequences B3LKC8 B5VTV1 C7GP50 C8ZJJ3 E7KIZ4 E7KVQ1 E7M1A6 E7NP40 E7QM19 H0GQ72 N1NXV3 P18408
YPR167C YPR167C YPR167C YPR167C YPR167C YPR167C YPR167C YPR167C YPR167C YPR167C YPR167C YPR167C YPR167C YPR167C YPR167C 4932.YPR167C YPR167C SCRT_02642 2oq2.A 2oq2.B 2oq2.C 2oq2.D YPR167C YPR167C YPR167C YPR167C YPR167C

Jump to [ Top of page · Domain architecture · Domain assignment details ]