SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YPR188C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPR188C
Domain Number 1 Region: 12-144
Classification Level Classification E-value
Superfamily EF-hand 4.7e-21
Family Calmodulin-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
cell-cell junction 1.461 59.62
sarcolemma 1.691 53.74
actomyosin 2.172 47.35
actin filament bundle 1.881 45.18
cortical actin cytoskeleton 1.946 43.48
lateral plasma membrane 2.075 43.15
actin cytoskeleton 1.374 40.06
occluding junction 2.083 36.75
cell-cell adherens junction 2.009 35.78
cell-substrate junction 1.548 33.66
Biological Process IC (bits) H-Score
sarcomere organization 1.822 55.36
muscle fiber development 2.077 47.96
myotube differentiation 2.098 44.66
regulation of wound healing 1.869 39.77
proteolysis 1.316 36.03
programmed cell death 1.494 32.79
mitochondrion organization 1.723 32.79
apoptotic signaling pathway 1.971 32.79
response to calcium ion 2.218 31.33
cell-cell signaling 1.346 31.01

Protein sequence

External link(s) Locus: YPR188C   Protein: S000006392
Sequence length 163
Comment MLC2 SGDID:S000006392, Chr XVI from 912475-911984, reverse complement, Verified ORF, "Regulatory light chain for the type II myosin, Myo1p; binds to an IQ motif of Myo1p, localization to the bud neck depends on Myo1p; involved in the disassembly of the Myo1p ring"
Sequence
MDHSESLTFNQLTQDYINKLKDAFQMLDEDEDGLISRGDLTKIYATLGKTLTDEEWSKMV
PDNDTSTAEVGEEGVSFPIFLSIMGKNLSQFPEREELEESLKAIGRGHDLNVPLNEVIDS
LKEAGFENPEEEFAKLFKLFTTNQQATEERTFRGKLFLDSITD
Download sequence
Identical sequences A0A0L8VH67 B3LKE7 C7GP69 C8ZJL7 E7KJ14 E7KVR3 E7QM28 G2WPZ9 H0GQ88 Q06580
YPR188C YPR188C YPR188C YPR188C YPR188C YPR188C YPR188C 4932.YPR188C YPR188C YPR188C YPR188C YPR188C YPR188C YPR188C SCRT_02661 YPR188C YPR188C YPR188C YPR188C YPR188C YPR188C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]