SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YPR188C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPR188C
Domain Number 1 Region: 12-144
Classification Level Classification E-value
Superfamily EF-hand 4.7e-21
Family Calmodulin-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
sarcolemma 1.917 25.56
microtubule cytoskeleton 1.334 24.06
cell leading edge 1.447 14.99
nuclear outer membrane-endoplasmic reticulum membrane network 1.559 12.47
endoplasmic reticulum part 1.433 12.47
fusome 2.198 12.27
vacuole 1.428 11.77
adherens junction 1.367 11.2
endosome 1.325 10.4
endosome membrane 1.968 10.36
Biological Process IC (bits) H-Score
regulation of chemotaxis 1.523 32.34
organelle localization 1.529 32.04
apoptotic process 1.321 30.34
mitochondrion organization 1.55 30.34
response to calcium ion 2.247 28.01
cell-cell adhesion 1.519 26.4
response to organic cyclic compound 1.38 26.3
cellular response to nitrogen compound 1.511 26.3
nerve development 1.951 23.07
myofibril assembly 1.356 22.6

Protein sequence

External link(s) Locus: YPR188C   Protein: S000006392
Sequence length 163
Comment MLC2 SGDID:S000006392, Chr XVI from 912475-911984, reverse complement, Verified ORF, "Regulatory light chain for the type II myosin, Myo1p; binds to an IQ motif of Myo1p, localization to the bud neck depends on Myo1p; involved in the disassembly of the Myo1p ring"
Sequence
MDHSESLTFNQLTQDYINKLKDAFQMLDEDEDGLISRGDLTKIYATLGKTLTDEEWSKMV
PDNDTSTAEVGEEGVSFPIFLSIMGKNLSQFPEREELEESLKAIGRGHDLNVPLNEVIDS
LKEAGFENPEEEFAKLFKLFTTNQQATEERTFRGKLFLDSITD
Download sequence
Identical sequences B3LKE7 C7GP69 C8ZJL7 E7KJ14 E7KVR3 E7QM28 G2WPZ9 H0GQ88 Q06580 W7PV40 W7QUK6
YPR188C YPR188C YPR188C YPR188C YPR188C YPR188C YPR188C YPR188C YPR188C YPR188C 4932.YPR188C YPR188C SCRT_02661 YPR188C YPR188C YPR188C YPR188C YPR188C YPR188C YPR188C YPR188C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]