SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YPR188C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPR188C
Domain Number 1 Region: 12-144
Classification Level Classification E-value
Superfamily EF-hand 4.7e-21
Family Calmodulin-like 0.0047
Further Details:      
 

Protein sequence

External link(s) Locus: YPR188C   Protein: S000006392
Sequence length 163
Comment MLC2 SGDID:S000006392, Chr XVI from 912475-911984, reverse complement, Verified ORF, "Regulatory light chain for the type II myosin, Myo1p; binds to an IQ motif of Myo1p, localization to the bud neck depends on Myo1p; involved in the disassembly of the Myo1p ring"
Sequence
MDHSESLTFNQLTQDYINKLKDAFQMLDEDEDGLISRGDLTKIYATLGKTLTDEEWSKMV
PDNDTSTAEVGEEGVSFPIFLSIMGKNLSQFPEREELEESLKAIGRGHDLNVPLNEVIDS
LKEAGFENPEEEFAKLFKLFTTNQQATEERTFRGKLFLDSITD
Download sequence
Identical sequences B3LKE7 C7GP69 C8ZJL7 E7KJ14 E7KVR3 E7QM28 G2WPZ9 H0GQ88 Q06580
YPR188C YPR188C YPR188C YPR188C YPR188C YPR188C YPR188C YPR188C YPR188C YPR188C 4932.YPR188C YPR188C SCRT_02661 YPR188C YPR188C YPR188C YPR188C YPR188C YPR188C YPR188C YPR188C

Jump to [ Top of page · Domain architecture · Domain assignment details ]