SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 477974.Daud_1616 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  477974.Daud_1616
Domain Number 1 Region: 145-223
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000736
Family HtrA-like serine proteases 0.028
Further Details:      
 
Domain Number 2 Region: 363-422
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.0000449
Family Eukaryotic proteases 0.094
Further Details:      
 
Domain Number 3 Region: 244-274,303-416
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.0000552
Family Prokaryotic proteases 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 477974.Daud_1616
Sequence length 440
Comment (Candidatus Desulforudis audaxviator MP104C)
Sequence
MPGSIRKRISQAGFIFFAILLIFGCFTPFSRSFFGLPVYQNILVGESVAPSLQVPGSLKS
VLQWESDRPEAIRLLETGGSPVIREAGEYRLSLKLFGFIPLRHLTVSAVPEVKVLPGGQS
IGVLLHSRGVIVIGEAPLESGEREYSPAYQAGIREGDVILSINGREVRCEADVREMVNEV
GGNGERLAVRLKRNGVEFLVGVTPDYCERTGRYRVGLLVRDSAAGVGTLTFHDPKTGSYG
ALGHVITDGRSPQRLELTDGRIVEAEIRGVHPGMRGRPGEKLGAFAGEGSFTGSIDRNTT
YGIFGTLEGNISNPYFREPIPVALLHHVRPGPAVMLTVLHDRQIERFNLMIEEVRPENGG
DGKGLVIRIDDERLLERSGGIIQGMSGSPIIQNGRLVGAVTHVFINNPSRGYGVPIEWML
RESGLLKKPTEVSIQWRKVG
Download sequence
Identical sequences B1I568
477974.Daud_1616 gi|169831768|ref|YP_001717750.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]