SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9606.ENSP00000265840 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9606.ENSP00000265840
Sequence length 334
Comment (Homo sapiens)
Sequence
MKHFLRMLIQVCLYFYCKFLWRCLKFVMRKLTGRCELQRICYNTKPGASRTMKIETSLRD
SKSKLLQTSVSVHPDAIEKTIEDIMELKKINPDVNPQLGISLQACLLQIVGYRNLIADVE
KLRREAYDSDNPQHEEMLLKLWKFLKPNTPLESRISKQWCEIGFQGDDPKTDFRGMGLLG
LYNLQYFAERDATAAQQVLSDSLHPKCRDITKEEISKFSKAEWEKKRMDKAIGYSFAIVG
INITDLAYNLLVSGALKTHFYNIAPEAPTLSHFQQTFCYLMHEFHKFWIEEDPMDIMEFN
RVREKFRKRIIKQLQNPDMALCPHFAASEGLINM
Download sequence
Identical sequences Q8N336
9606.ENSP00000265840 gi|112181294|ref|NP_061182.3| ENSP00000265840 ENSP00000265840 NP_061182.3.87134 NP_061182.3.92137 HR5237 ENSP00000412257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]