SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000013822 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000013822
Domain Number 1 Region: 90-196
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 9.81e-22
Family L-aminoacid/polyamine oxidase 0.00011
Further Details:      
 
Domain Number 2 Region: 11-109,200-244
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.75e-20
Family FAD-linked reductases, N-terminal domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000013822   Gene: ENSOARG00000012906   Transcript: ENSOART00000014027
Sequence length 265
Comment pep:novel chromosome:Oar_v3.1:5:40130037:40130831:-1 gene:ENSOARG00000012906 transcript:ENSOART00000014027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPCLLTLRFDEITGGFDQLSHAALLPGTVQLRSPPEEVESYGDHMHITYQTPDTLTADYM
IVATTATAAQLLRSQPPLSHGKENALRSFHYSGVTKVFLACMQSFWEHEGISGDESSTDW
PSCFIHYPSHTFPSGTQVILASFTMDDNSFFAQAADVVLDDLATVHDLSKEELRALCPYS
MIKHWSQDSYSMGGFALFTPYQYVDYAQELGWVHFAGEHTNLPDGWTDTSTKSGLKTAQN
IQEAMGLALTKGPRDPKEPHPKMEL
Download sequence
Identical sequences W5PTP1
ENSOARP00000013822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]