SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSTBEP00000000046 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000000046
Domain Number 1 Region: 231-402
Classification Level Classification E-value
Superfamily Hemopexin-like domain 7.2e-53
Family Hemopexin-like domain 0.0001
Further Details:      
 
Domain Number 2 Region: 33-185
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.16e-44
Family Matrix metalloproteases, catalytic domain 2.83e-05
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000000046
Domain Number - Region: 2-20
Classification Level Classification E-value
Superfamily PGBD-like 0.0108
Family MMP N-terminal domain 0.016
Further Details:      
 

Protein sequence

External link(s) Protein: ENSTBEP00000000046   Gene: ENSTBEG00000000053   Transcript: ENSTBET00000000052
Sequence length 437
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_5873:483:5365:-1 gene:ENSTBEG00000000053 transcript:ENSTBET00000000052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLDVTTRARMRQPRCGLEDPFNQKTLKYLLLGRWRKKHLTFRILNLPSTLPSDTARAALL
QAFQYWRNVAPLTFREVQAGWADIRLSFHGRQSPYCSNTFDGPGRVLAHADIPELGSVHF
DEDELWTEGTYRGVNLRIIAAHELGHALGLGHSRYTQALMAPVYAGYRPRFKLHPDDVAG
IQALYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPREKTYAFKGD
YVWTVTDSGLGPLFRVSALWEGLPGNLDAAVYSPRTQLIYFFKGDKVWCYINFKMAPGFP
KKLNGVGRNLDAALYWPLNQKVFLFKGSGYWQWDELARTDFSHYPKPIKGLFTGVPDQLS
AAMSWRDGRVYFFKGEKYWRLNRQLRVEKGYPRNIAHNWMHCRSRIPNTTPSSGDIMAFT
AGTKLDTTPSAKYTLEH
Download sequence
Identical sequences ENSTBEP00000000046 ENSTBEP00000000046

Jump to [ Top of page · Domain architecture · Domain assignment details ]