SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSTBEP00000000046 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000000046
Domain Number 1 Region: 231-402
Classification Level Classification E-value
Superfamily Hemopexin-like domain 7.2e-53
Family Hemopexin-like domain 0.0001
Further Details:      
 
Domain Number 2 Region: 33-185
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.16e-44
Family Matrix metalloproteases, catalytic domain 2.83e-05
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000000046
Domain Number - Region: 2-20
Classification Level Classification E-value
Superfamily PGBD-like 0.0108
Family MMP N-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
metallopeptidase activity 1.956 173.69
endopeptidase activity 1.539 149.07
zinc ion binding 1.658 43.61
integrin binding 1.752 17.74
growth factor receptor binding 1.996 15.08
cytokine receptor binding 2.034 15.08
enzyme activator activity 1.402 14.46
amide binding 1.71 13.19
collagen binding 1.837 10.43
protein complex binding 1.49 8.1
Cellular Component IC (bits) H-Score
brush border 1.481 22.53
Golgi lumen 2.24 12.28
secretory granule 1.827 10.56
neuron projection terminus 2.132 9.5
lysosomal membrane 2.005 8.2
trans-Golgi network 1.798 8.02
clathrin-coated vesicle 1.877 7.82
coated vesicle 1.745 7.82
dendrite 1.548 7.12
synapse part 1.513 5.74

Protein sequence

External link(s) Protein: ENSTBEP00000000046   Gene: ENSTBEG00000000053   Transcript: ENSTBET00000000052
Sequence length 437
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_5873:483:5365:-1 gene:ENSTBEG00000000053 transcript:ENSTBET00000000052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLDVTTRARMRQPRCGLEDPFNQKTLKYLLLGRWRKKHLTFRILNLPSTLPSDTARAALL
QAFQYWRNVAPLTFREVQAGWADIRLSFHGRQSPYCSNTFDGPGRVLAHADIPELGSVHF
DEDELWTEGTYRGVNLRIIAAHELGHALGLGHSRYTQALMAPVYAGYRPRFKLHPDDVAG
IQALYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPREKTYAFKGD
YVWTVTDSGLGPLFRVSALWEGLPGNLDAAVYSPRTQLIYFFKGDKVWCYINFKMAPGFP
KKLNGVGRNLDAALYWPLNQKVFLFKGSGYWQWDELARTDFSHYPKPIKGLFTGVPDQLS
AAMSWRDGRVYFFKGEKYWRLNRQLRVEKGYPRNIAHNWMHCRSRIPNTTPSSGDIMAFT
AGTKLDTTPSAKYTLEH
Download sequence
Identical sequences ENSTBEP00000000046 ENSTBEP00000000046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]