SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A089QRB9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A089QRB9
Domain Number 1 Region: 5-376
Classification Level Classification E-value
Superfamily Thiolase-like 2.08e-91
Family Thiolase-related 0.0013
Further Details:      
 
Domain Number 2 Region: 538-662,727-823
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 3.14e-61
Family FabD-like 0.00081
Further Details:      
 
Domain Number 3 Region: 1741-1987
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.65e-40
Family Tyrosine-dependent oxidoreductases 0.0000451
Further Details:      
 
Domain Number 4 Region: 1516-1676
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 4.45e-40
Family Alcohol dehydrogenase-like, C-terminal domain 0.0000236
Further Details:      
 
Domain Number 5 Region: 1404-1537
Classification Level Classification E-value
Superfamily GroES-like 9.43e-34
Family Alcohol dehydrogenase-like, N-terminal domain 0.0041
Further Details:      
 
Domain Number 6 Region: 1186-1383
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.91e-32
Family Tyrosine-dependent oxidoreductases 0.0091
Further Details:      
 
Domain Number 7 Region: 2003-2083
Classification Level Classification E-value
Superfamily ACP-like 0.000000000000353
Family Acyl-carrier protein (ACP) 0.027
Further Details:      
 
Domain Number 8 Region: 660-726
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.00000458
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A089QRB9
Sequence length 2085
Comment (sp|A0A089QRB9|MSL3_MYCTU) Mycolipanoic/mycolipenic acids synthase-like polyketide synthase {ECO:0000255|PROSITE-ProRule:PRU10022} KW=Complete proteome; Reference proteome OX=83332 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv). GN=LH57_06485 OC=Mycobacterium; Mycobacterium tuberculosis complex.
Sequence
MRTATATSVAVIGMACRLPGGIDSPQRLWEALLRGDDLVGEIPADRWDANVYYDPEPGVP
GRSVSRWGAFLDDVGGFDCDFFGLTEREATAIDPQHRLLLEVSWEAIEHAGVDPATLAES
QTGVFVGLTHGDYELLSADCGAAEGPYGFTGTSNSFASGRVAYTLGLHGPAVTVDTACSS
GLTAVHQACRSLDDGESDLALAGGVVVTLEPRKSVSGSLQGMLSPTGRCHAFDEAADGFV
SGEGCVVLLLKRLPDAVRDGDRVLAIVRGTAANQDGRTVNIAAPSAQAQIAVYQQALAAA
GVEASTVGMVEAHGTGTPVGDPVEYASLAAVYGTEGPCALTSVKTNFGHLQSASGPLGLM
KTILALRHGVVPQNLHFCRLPDQLAEIDTELFVPQANTSWPDNTGQPRRAAVSSYGMSGT
NVHAILEQAPVSEPAASGPELTPEAGGLALFPVSATSAEQLHVTAARLADWVDQNGNAGS
RVSMRDLGYTLSCRRAHRPVRTVVTASSFDELSAALRDVAGDQIPYQPAVGHDDRGPVWV
FSGQGSQWPGMGTELLVAEPVFAATVAAMEPVIARESGFSVTEAMSAPQTVSGIDRVQPT
IFAVQVALAAALKSYGVRPGAIIGHSLGEAAAAVVAGALSLHDGLRVICRRSRLMSRIAG
SGAMASVELPGQQVLSELAIRGISDVVLSVVASPTSTVVGGATQSIRDLVAAWEQQDVLA
REVAVDVASHTPQVDPILDELLEVLAEVDPTAPEIPYYSATLWDPRERPSFTGEYWVENL
RYTVRFAAAVQAALKDGYRVFGELAPHPLLTYAVEQNAASLDMPIATLAAMRRGEQLPFG
LRGFVADVHNAGAKVDFSVQYPDGRLVDAPLPSWTHRTLMLSREDSHRSHTGAVQAVHPL
LGAHVHLLEEPERHVWQAGVGTGAHPWLGDHRIHNVAAFPGAAYCEMALAAARTTLGELS
EVRDIKFEQTLLLDEQTVVSSAATIAAPGILQFAVESHQEGEPARRASAMLHALEEMPQP
PGYDTNALTAAHESSMSGEELRKMFNSLGIQYGPAFSGLVAVHTARGDVTTVLAEVALPG
AIRSQQSAYASHPALLDACFQSVLVHPEVQKATVGGLMLPVGVRRLRNYHSTRSAHYCLA
RVTSSSRAGECEADLDVFDQAGTVLLTVEGLRLAAGISEHERANRVFDERLLTIEWERGE
LPEVPQIDAGSWLLLSASEADPLTAQLADALNAVGAQSTSVASASDVAQLRSLLGGRLTG
VVVVTGPPTGGLTQCGRDYVSQLVGIARELAELPGEPPRLFVVTRSAASVLPSDLANLEQ
AGLRGLMRVIDSEHPHLGATAIDVDNDETVAALVASQLQSGSQEDETAWRNGIWYTARLR
PGPLRPAERRTAVVEYRRDGMRLQIRTPGDLESLEFVTFDRVAPGPGEIEVAVTASSVNF
ADVLVAFGRYPTFEGYRQQLGIDFAGVVTAVGPDVTEHRIGDHVGGMSANGCWSTFVRCD
ARLAVTLPPELPVAAAAAVPTASATAWYALHDLARICSDDKVLIHSGTGGVGQAAIAIAR
AAGCEIFATAGSAQRRQLLHDMGVEHVYDSRSTEFAEQIRGDTDGYGVDVVLNSLPGAAQ
RAGIELLAFGGRFVEIGKRDIYGDTRLGLFPFRRNLSLYAVDLALLTHSHPHTVRRLLKT
VYQHTVEGTLPVPQTTHYPIHDAAVAIRLVGGAGHTGKVVLDVPRTGEGVAVVPPEQVRT
SRPDGAYLVTGGLGGLGLFLAGELAAAGCGRIVLNSRSTPSPHATRVIERLRAAGADIQV
ECGDIADAATAHRVVAVATASGLPVRGVLHAAAVVEDATLANVTDELIDRCWAPKVHGAW
NIHRATAAQPLEWFCLFSSAAALVGSPGQGAYAAANSWLDAFAHWRRAQGLPATSIAWGA
WAEIGRATALAEGTGAAIAPAEGARAFQTLLRYGRAYSGYAPIMGTPWLTAFAQRSRFAE
AFHATGQNQPATGKFLAELGSLPREEWPRTVRRLVSDQISLLLRRTIDPDRPLSDYGLDS
LGNLELRTRIETETGIRVSPTKITTVRGLAEHVCDELAAAQSAPV
Download sequence
Identical sequences A0A089QRB9 A0A0E8NV99 A0A0H3L8P3 A5U1M9 M8D8M3
gi|506925645|ref|YP_008006095.1| gi|479055142|ref|YP_007350948.1| gi|148660968|ref|YP_001282491.1| WP_003406192.1.100021 WP_003406192.1.100069 WP_003406192.1.100087 WP_003406192.1.10015 WP_003406192.1.100208 WP_003406192.1.100216 WP_003406192.1.10022 WP_003406192.1.100255 WP_003406192.1.100260 WP_003406192.1.100270 WP_003406192.1.100279 WP_003406192.1.100286 WP_003406192.1.100308 WP_003406192.1.100309 WP_003406192.1.100318 WP_003406192.1.100338 WP_003406192.1.10037 WP_003406192.1.100383 WP_003406192.1.100396 WP_003406192.1.1004 WP_003406192.1.100401 WP_003406192.1.100459 WP_003406192.1.100460 WP_003406192.1.100552 WP_003406192.1.100581 WP_003406192.1.100600 WP_003406192.1.100625 WP_003406192.1.10064 WP_003406192.1.100666 WP_003406192.1.100671 WP_003406192.1.100677 WP_003406192.1.100697 WP_003406192.1.100703 WP_003406192.1.100716 WP_003406192.1.100722 WP_003406192.1.100754 WP_003406192.1.100757 WP_003406192.1.100772 WP_003406192.1.1008 WP_003406192.1.100812 WP_003406192.1.100845 WP_003406192.1.100866 WP_003406192.1.10088 WP_003406192.1.100889 WP_003406192.1.10090 WP_003406192.1.100910 WP_003406192.1.100915 WP_003406192.1.100918 WP_003406192.1.100935 WP_003406192.1.100984 WP_003406192.1.100992 WP_003406192.1.100998 WP_003406192.1.101 WP_003406192.1.101025 WP_003406192.1.101028 WP_003406192.1.10104 WP_003406192.1.101048 WP_003406192.1.101054 WP_003406192.1.101075 WP_003406192.1.101143 WP_003406192.1.10116 WP_003406192.1.10117 WP_003406192.1.101209 WP_003406192.1.10125 WP_003406192.1.101290 WP_003406192.1.101323 WP_003406192.1.101324 WP_003406192.1.101350 WP_003406192.1.101367 WP_003406192.1.101398 WP_003406192.1.101403 WP_003406192.1.101421 WP_003406192.1.10144 WP_003406192.1.10145 WP_003406192.1.101452 WP_003406192.1.101456 WP_003406192.1.101481 WP_003406192.1.101493 WP_003406192.1.101496 WP_003406192.1.101525 WP_003406192.1.101533 WP_003406192.1.101535 WP_003406192.1.101553 WP_003406192.1.101558 WP_003406192.1.10156 WP_003406192.1.101573 WP_003406192.1.101576 WP_003406192.1.10159 WP_003406192.1.101592 WP_003406192.1.101604 WP_003406192.1.101607 WP_003406192.1.101622 WP_003406192.1.101644 WP_003406192.1.101687 WP_003406192.1.101698 WP_003406192.1.10170 WP_003406192.1.101713 WP_003406192.1.101722 WP_003406192.1.101733 WP_003406192.1.101743 WP_003406192.1.101754 WP_003406192.1.101764 WP_003406192.1.101795 WP_003406192.1.101797 WP_003406192.1.101798 WP_003406192.1.101802 WP_003406192.1.101826 WP_003406192.1.101836 WP_003406192.1.101858 WP_003406192.1.101859 WP_003406192.1.101888 WP_003406192.1.101894 WP_003406192.1.101899 WP_003406192.1.1019 WP_003406192.1.101923 WP_003406192.1.101925 WP_003406192.1.10193 WP_003406192.1.102 WP_003406192.1.102008 WP_003406192.1.102017 WP_003406192.1.102053 WP_003406192.1.102055 WP_003406192.1.102063 WP_003406192.1.102099 WP_003406192.1.1021 WP_003406192.1.10211 WP_003406192.1.102119 WP_003406192.1.102121 WP_003406192.1.102143 WP_003406192.1.10216 WP_003406192.1.10224 WP_003406192.1.10253 WP_003406192.1.10262 WP_003406192.1.10272 WP_003406192.1.10277 WP_003406192.1.1033 WP_003406192.1.10350 WP_003406192.1.10362 WP_003406192.1.10366 WP_003406192.1.10376 WP_003406192.1.10396 WP_003406192.1.10410 WP_003406192.1.10430 WP_003406192.1.1044 WP_003406192.1.10440 WP_003406192.1.10471 WP_003406192.1.10472 WP_003406192.1.10489 WP_003406192.1.105 WP_003406192.1.10518 WP_003406192.1.10545 WP_003406192.1.1057 WP_003406192.1.10594 WP_003406192.1.10603 WP_003406192.1.10606 WP_003406192.1.10615 WP_003406192.1.10623 WP_003406192.1.10635 WP_003406192.1.10643 WP_003406192.1.10648 WP_003406192.1.10662 WP_003406192.1.10709 WP_003406192.1.10735 WP_003406192.1.10740 WP_003406192.1.10756 WP_003406192.1.1078 WP_003406192.1.10791 WP_003406192.1.10799 WP_003406192.1.10825 WP_003406192.1.10879 WP_003406192.1.10912 WP_003406192.1.10916 WP_003406192.1.10923 WP_003406192.1.10927 WP_003406192.1.1095 WP_003406192.1.10956 WP_003406192.1.10958 WP_003406192.1.10962 WP_003406192.1.10980 WP_003406192.1.10981 WP_003406192.1.10993 WP_003406192.1.11040 WP_003406192.1.11061 WP_003406192.1.11070 WP_003406192.1.11175 WP_003406192.1.11176 WP_003406192.1.11236 WP_003406192.1.11329 WP_003406192.1.1133 WP_003406192.1.11342 WP_003406192.1.11373 WP_003406192.1.11376 WP_003406192.1.11390 WP_003406192.1.11402 WP_003406192.1.11481 WP_003406192.1.11487 WP_003406192.1.11489 WP_003406192.1.11514 WP_003406192.1.11589 WP_003406192.1.11596 WP_003406192.1.11604 WP_003406192.1.11610 WP_003406192.1.11697 WP_003406192.1.11707 WP_003406192.1.11752 WP_003406192.1.11758 WP_003406192.1.11761 WP_003406192.1.11775 WP_003406192.1.11804 WP_003406192.1.11822 WP_003406192.1.11826 WP_003406192.1.11856 WP_003406192.1.11898 WP_003406192.1.11906 WP_003406192.1.11939 WP_003406192.1.11960 WP_003406192.1.11961 WP_003406192.1.11972 WP_003406192.1.12001 WP_003406192.1.12049 WP_003406192.1.12052 WP_003406192.1.12100 WP_003406192.1.12116 WP_003406192.1.12161 WP_003406192.1.12165 WP_003406192.1.12184 WP_003406192.1.12190 WP_003406192.1.12265 WP_003406192.1.12275 WP_003406192.1.12293 WP_003406192.1.12294 WP_003406192.1.123 WP_003406192.1.1231 WP_003406192.1.12314 WP_003406192.1.12327 WP_003406192.1.12338 WP_003406192.1.12371 WP_003406192.1.12372 WP_003406192.1.12389 WP_003406192.1.12406 WP_003406192.1.1241 WP_003406192.1.12421 WP_003406192.1.12446 WP_003406192.1.12464 WP_003406192.1.12479 WP_003406192.1.12519 WP_003406192.1.12523 WP_003406192.1.12526 WP_003406192.1.1255 WP_003406192.1.12550 WP_003406192.1.12551 WP_003406192.1.12563 WP_003406192.1.12611 WP_003406192.1.12669 WP_003406192.1.1267 WP_003406192.1.12672 WP_003406192.1.12692 WP_003406192.1.1271 WP_003406192.1.12768 WP_003406192.1.1279 WP_003406192.1.12794 WP_003406192.1.12804 WP_003406192.1.12821 WP_003406192.1.12841 WP_003406192.1.12854 WP_003406192.1.12871 WP_003406192.1.12901 WP_003406192.1.12941 WP_003406192.1.12947 WP_003406192.1.12957 WP_003406192.1.12972 WP_003406192.1.13028 WP_003406192.1.13043 WP_003406192.1.13087 WP_003406192.1.13090 WP_003406192.1.13096 WP_003406192.1.13163 WP_003406192.1.13175 WP_003406192.1.13183 WP_003406192.1.132 WP_003406192.1.13249 WP_003406192.1.13284 WP_003406192.1.13296 WP_003406192.1.13298 WP_003406192.1.13306 WP_003406192.1.13312 WP_003406192.1.13313 WP_003406192.1.13321 WP_003406192.1.13345 WP_003406192.1.13370 WP_003406192.1.1338 WP_003406192.1.13420 WP_003406192.1.13433 WP_003406192.1.13435 WP_003406192.1.13438 WP_003406192.1.13461 WP_003406192.1.13466 WP_003406192.1.13489 WP_003406192.1.13551 WP_003406192.1.13564 WP_003406192.1.13579 WP_003406192.1.13647 WP_003406192.1.13697 WP_003406192.1.13719 WP_003406192.1.13763 WP_003406192.1.1377 WP_003406192.1.13774 WP_003406192.1.13786 WP_003406192.1.13793 WP_003406192.1.13794 WP_003406192.1.13817 WP_003406192.1.13834 WP_003406192.1.13899 WP_003406192.1.13909 WP_003406192.1.13910 WP_003406192.1.13919 WP_003406192.1.13920 WP_003406192.1.13952 WP_003406192.1.13953 WP_003406192.1.13962 WP_003406192.1.1398 WP_003406192.1.13988 WP_003406192.1.14027 WP_003406192.1.14046 WP_003406192.1.14115 WP_003406192.1.1415 WP_003406192.1.14152 WP_003406192.1.14158 WP_003406192.1.14162 WP_003406192.1.14175 WP_003406192.1.14178 WP_003406192.1.14194 WP_003406192.1.14195 WP_003406192.1.14208 WP_003406192.1.14238 WP_003406192.1.14273 WP_003406192.1.14303 WP_003406192.1.14306 WP_003406192.1.14307 WP_003406192.1.14310 WP_003406192.1.14382 WP_003406192.1.14416 WP_003406192.1.14428 WP_003406192.1.14441 WP_003406192.1.14469 WP_003406192.1.14477 WP_003406192.1.14504 WP_003406192.1.14514 WP_003406192.1.1452 WP_003406192.1.14527 WP_003406192.1.1454 WP_003406192.1.14544 WP_003406192.1.14548 WP_003406192.1.14551 WP_003406192.1.14561 WP_003406192.1.14573 WP_003406192.1.1462 WP_003406192.1.14667 WP_003406192.1.14668 WP_003406192.1.14675 WP_003406192.1.14694 WP_003406192.1.14695 WP_003406192.1.14709 WP_003406192.1.14766 WP_003406192.1.14783 WP_003406192.1.14872 WP_003406192.1.14905 WP_003406192.1.14926 WP_003406192.1.14951 WP_003406192.1.14955 WP_003406192.1.15003 WP_003406192.1.15009 WP_003406192.1.15028 WP_003406192.1.15040 WP_003406192.1.15065 WP_003406192.1.15072 WP_003406192.1.15089 WP_003406192.1.1509 WP_003406192.1.15126 WP_003406192.1.15131 WP_003406192.1.15168 WP_003406192.1.15174 WP_003406192.1.15187 WP_003406192.1.15196 WP_003406192.1.15210 WP_003406192.1.15216 WP_003406192.1.15217 WP_003406192.1.1523 WP_003406192.1.15232 WP_003406192.1.15238 WP_003406192.1.15240 WP_003406192.1.15253 WP_003406192.1.1527 WP_003406192.1.15292 WP_003406192.1.15299 WP_003406192.1.15302 WP_003406192.1.15322 WP_003406192.1.1534 WP_003406192.1.15386 WP_003406192.1.15387 WP_003406192.1.15442 WP_003406192.1.15447 WP_003406192.1.15449 WP_003406192.1.15477 WP_003406192.1.15481 WP_003406192.1.15492 WP_003406192.1.15511 WP_003406192.1.15512 WP_003406192.1.15558 WP_003406192.1.15559 WP_003406192.1.15566 WP_003406192.1.15599 WP_003406192.1.1560 WP_003406192.1.15611 WP_003406192.1.1563 WP_003406192.1.15633 WP_003406192.1.15643 WP_003406192.1.15688 WP_003406192.1.15755 WP_003406192.1.15763 WP_003406192.1.15774 WP_003406192.1.15780 WP_003406192.1.15834 WP_003406192.1.15842 WP_003406192.1.15853 WP_003406192.1.15870 WP_003406192.1.15877 WP_003406192.1.15893 WP_003406192.1.15896 WP_003406192.1.15926 WP_003406192.1.15933 WP_003406192.1.15946 WP_003406192.1.15958 WP_003406192.1.15973 WP_003406192.1.15987 WP_003406192.1.15993 WP_003406192.1.16009 WP_003406192.1.16025 WP_003406192.1.16043 WP_003406192.1.16069 WP_003406192.1.16077 WP_003406192.1.16106 WP_003406192.1.16108 WP_003406192.1.16130 WP_003406192.1.16136 WP_003406192.1.16139 WP_003406192.1.16141 WP_003406192.1.16143 WP_003406192.1.1630 WP_003406192.1.16318 WP_003406192.1.1632 WP_003406192.1.16327 WP_003406192.1.16334 WP_003406192.1.16341 WP_003406192.1.16345 WP_003406192.1.16374 WP_003406192.1.16386 WP_003406192.1.164 WP_003406192.1.1642 WP_003406192.1.16424 WP_003406192.1.16431 WP_003406192.1.16442 WP_003406192.1.16448 WP_003406192.1.16451 WP_003406192.1.16476 WP_003406192.1.16480 WP_003406192.1.16494 WP_003406192.1.1652 WP_003406192.1.16549 WP_003406192.1.16560 WP_003406192.1.16598 WP_003406192.1.16609 WP_003406192.1.16619 WP_003406192.1.16622 WP_003406192.1.16637 WP_003406192.1.1669 WP_003406192.1.16707 WP_003406192.1.16724 WP_003406192.1.16731 WP_003406192.1.16743 WP_003406192.1.1683 WP_003406192.1.16852 WP_003406192.1.16937 WP_003406192.1.16940 WP_003406192.1.16950 WP_003406192.1.16959 WP_003406192.1.16968 WP_003406192.1.1697 WP_003406192.1.16977 WP_003406192.1.16987 WP_003406192.1.17005 WP_003406192.1.17006 WP_003406192.1.17010 WP_003406192.1.17015 WP_003406192.1.17019 WP_003406192.1.17041 WP_003406192.1.17052 WP_003406192.1.17057 WP_003406192.1.17062 WP_003406192.1.17094 WP_003406192.1.17138 WP_003406192.1.17147 WP_003406192.1.17224 WP_003406192.1.17251 WP_003406192.1.17288 WP_003406192.1.17304 WP_003406192.1.17345 WP_003406192.1.17381 WP_003406192.1.17391 WP_003406192.1.17412 WP_003406192.1.1743 WP_003406192.1.17440 WP_003406192.1.17466 WP_003406192.1.17477 WP_003406192.1.17483 WP_003406192.1.17527 WP_003406192.1.17535 WP_003406192.1.17540 WP_003406192.1.17553 WP_003406192.1.17558 WP_003406192.1.17599 WP_003406192.1.17635 WP_003406192.1.17655 WP_003406192.1.17679 WP_003406192.1.17687 WP_003406192.1.17700 WP_003406192.1.17710 WP_003406192.1.17713 WP_003406192.1.17722 WP_003406192.1.17746 WP_003406192.1.17788 WP_003406192.1.17798 WP_003406192.1.17803 WP_003406192.1.17816 WP_003406192.1.17821 WP_003406192.1.17830 WP_003406192.1.17868 WP_003406192.1.17878 WP_003406192.1.17923 WP_003406192.1.1795 WP_003406192.1.17955 WP_003406192.1.17973 WP_003406192.1.18009 WP_003406192.1.18033 WP_003406192.1.18057 WP_003406192.1.18070 WP_003406192.1.18116 WP_003406192.1.18120 WP_003406192.1.18126 WP_003406192.1.1817 WP_003406192.1.18170 WP_003406192.1.18206 WP_003406192.1.18216 WP_003406192.1.18240 WP_003406192.1.18257 WP_003406192.1.18297 WP_003406192.1.18306 WP_003406192.1.18364 WP_003406192.1.18399 WP_003406192.1.18411 WP_003406192.1.18444 WP_003406192.1.18448 WP_003406192.1.18467 WP_003406192.1.18476 WP_003406192.1.18522 WP_003406192.1.18580 WP_003406192.1.18582 WP_003406192.1.18587 WP_003406192.1.186 WP_003406192.1.18601 WP_003406192.1.18639 WP_003406192.1.18646 WP_003406192.1.18647 WP_003406192.1.1868 WP_003406192.1.18694 WP_003406192.1.18710 WP_003406192.1.18751 WP_003406192.1.18793 WP_003406192.1.18804 WP_003406192.1.18816 WP_003406192.1.18823 WP_003406192.1.18827 WP_003406192.1.18838 WP_003406192.1.18849 WP_003406192.1.18856 WP_003406192.1.18945 WP_003406192.1.1898 WP_003406192.1.19005 WP_003406192.1.19066 WP_003406192.1.19071 WP_003406192.1.19085 WP_003406192.1.19094 WP_003406192.1.19144 WP_003406192.1.19159 WP_003406192.1.19193 WP_003406192.1.19231 WP_003406192.1.19243 WP_003406192.1.19264 WP_003406192.1.19295 WP_003406192.1.19326 WP_003406192.1.1933 WP_003406192.1.19364 WP_003406192.1.19382 WP_003406192.1.19400 WP_003406192.1.19426 WP_003406192.1.19429 WP_003406192.1.19480 WP_003406192.1.19553 WP_003406192.1.19562 WP_003406192.1.19564 WP_003406192.1.19568 WP_003406192.1.19572 WP_003406192.1.19595 WP_003406192.1.19596 WP_003406192.1.19630 WP_003406192.1.19694 WP_003406192.1.1970 WP_003406192.1.19707 WP_003406192.1.19742 WP_003406192.1.19785 WP_003406192.1.19820 WP_003406192.1.19868 WP_003406192.1.19874 WP_003406192.1.19890 WP_003406192.1.19900 WP_003406192.1.19922 WP_003406192.1.19936 WP_003406192.1.19946 WP_003406192.1.19949 WP_003406192.1.19960 WP_003406192.1.19964 WP_003406192.1.20007 WP_003406192.1.20016 WP_003406192.1.2003 WP_003406192.1.20037 WP_003406192.1.20039 WP_003406192.1.20082 WP_003406192.1.20085 WP_003406192.1.20097 WP_003406192.1.20116 WP_003406192.1.20130 WP_003406192.1.20140 WP_003406192.1.20141 WP_003406192.1.20142 WP_003406192.1.20158 WP_003406192.1.20239 WP_003406192.1.20243 WP_003406192.1.20259 WP_003406192.1.20262 WP_003406192.1.20272 WP_003406192.1.20280 WP_003406192.1.20294 WP_003406192.1.20300 WP_003406192.1.20309 WP_003406192.1.20322 WP_003406192.1.2037 WP_003406192.1.20372 WP_003406192.1.20381 WP_003406192.1.204 WP_003406192.1.20427 WP_003406192.1.20457 WP_003406192.1.20459 WP_003406192.1.20460 WP_003406192.1.20542 WP_003406192.1.20578 WP_003406192.1.20608 WP_003406192.1.20624 WP_003406192.1.20628 WP_003406192.1.2066 WP_003406192.1.20707 WP_003406192.1.20722 WP_003406192.1.20729 WP_003406192.1.20742 WP_003406192.1.20751 WP_003406192.1.20776 WP_003406192.1.20843 WP_003406192.1.20850 WP_003406192.1.20868 WP_003406192.1.20876 WP_003406192.1.20897 WP_003406192.1.2090 WP_003406192.1.20911 WP_003406192.1.20921 WP_003406192.1.20927 WP_003406192.1.20951 WP_003406192.1.20970 WP_003406192.1.21070 WP_003406192.1.21127 WP_003406192.1.21135 WP_003406192.1.21173 WP_003406192.1.21187 WP_003406192.1.212 WP_003406192.1.2120 WP_003406192.1.21218 WP_003406192.1.21219 WP_003406192.1.2123 WP_003406192.1.21231 WP_003406192.1.21234 WP_003406192.1.2126 WP_003406192.1.21292 WP_003406192.1.21307 WP_003406192.1.2131 WP_003406192.1.21311 WP_003406192.1.21321 WP_003406192.1.21365 WP_003406192.1.21392 WP_003406192.1.21397 WP_003406192.1.21415 WP_003406192.1.21430 WP_003406192.1.21434 WP_003406192.1.21444 WP_003406192.1.21468 WP_003406192.1.21498 WP_003406192.1.21509 WP_003406192.1.21513 WP_003406192.1.21560 WP_003406192.1.21565 WP_003406192.1.21586 WP_003406192.1.21591 WP_003406192.1.21594 WP_003406192.1.21602 WP_003406192.1.21615 WP_003406192.1.21638 WP_003406192.1.21639 WP_003406192.1.21655 WP_003406192.1.21658 WP_003406192.1.2168 WP_003406192.1.2174 WP_003406192.1.21777 WP_003406192.1.21786 WP_003406192.1.21795 WP_003406192.1.218 WP_003406192.1.21826 WP_003406192.1.21829 WP_003406192.1.21840 WP_003406192.1.21843 WP_003406192.1.21872 WP_003406192.1.2188 WP_003406192.1.21882 WP_003406192.1.21906 WP_003406192.1.21912 WP_003406192.1.2194 WP_003406192.1.21941 WP_003406192.1.21956 WP_003406192.1.21958 WP_003406192.1.21960 WP_003406192.1.21971 WP_003406192.1.21973 WP_003406192.1.21983 WP_003406192.1.22003 WP_003406192.1.22013 WP_003406192.1.22025 WP_003406192.1.22036 WP_003406192.1.22075 WP_003406192.1.2212 WP_003406192.1.22127 WP_003406192.1.22140 WP_003406192.1.22233 WP_003406192.1.22277 WP_003406192.1.22348 WP_003406192.1.22366 WP_003406192.1.2238 WP_003406192.1.22380 WP_003406192.1.22437 WP_003406192.1.22438 WP_003406192.1.22511 WP_003406192.1.22524 WP_003406192.1.22585 WP_003406192.1.22606 WP_003406192.1.22608 WP_003406192.1.22609 WP_003406192.1.22618 WP_003406192.1.2262 WP_003406192.1.22624 WP_003406192.1.22629 WP_003406192.1.22647 WP_003406192.1.22664 WP_003406192.1.22665 WP_003406192.1.22670 WP_003406192.1.22725 WP_003406192.1.22728 WP_003406192.1.22733 WP_003406192.1.22737 WP_003406192.1.22754 WP_003406192.1.22800 WP_003406192.1.22804 WP_003406192.1.22829 WP_003406192.1.22840 WP_003406192.1.22844 WP_003406192.1.22970 WP_003406192.1.22996 WP_003406192.1.22997 WP_003406192.1.22999 WP_003406192.1.23015 WP_003406192.1.23032 WP_003406192.1.231 WP_003406192.1.23101 WP_003406192.1.2312 WP_003406192.1.23153 WP_003406192.1.23171 WP_003406192.1.23199 WP_003406192.1.2320 WP_003406192.1.23204 WP_003406192.1.23216 WP_003406192.1.23229 WP_003406192.1.23233 WP_003406192.1.2326 WP_003406192.1.23261 WP_003406192.1.23272 WP_003406192.1.23289 WP_003406192.1.2329 WP_003406192.1.23308 WP_003406192.1.23316 WP_003406192.1.23321 WP_003406192.1.2339 WP_003406192.1.23406 WP_003406192.1.23445 WP_003406192.1.23447 WP_003406192.1.23452 WP_003406192.1.23461 WP_003406192.1.2349 WP_003406192.1.23496 WP_003406192.1.23506 WP_003406192.1.23530 WP_003406192.1.23539 WP_003406192.1.23546 WP_003406192.1.23551 WP_003406192.1.23573 WP_003406192.1.23583 WP_003406192.1.23588 WP_003406192.1.23628 WP_003406192.1.23677 WP_003406192.1.23683 WP_003406192.1.23692 WP_003406192.1.23694 WP_003406192.1.23699 WP_003406192.1.2371 WP_003406192.1.23807 WP_003406192.1.2384 WP_003406192.1.23843 WP_003406192.1.23863 WP_003406192.1.2387 WP_003406192.1.23894 WP_003406192.1.23993 WP_003406192.1.2400 WP_003406192.1.24007 WP_003406192.1.24008 WP_003406192.1.24046 WP_003406192.1.24113 WP_003406192.1.24119 WP_003406192.1.24176 WP_003406192.1.24190 WP_003406192.1.24202 WP_003406192.1.24261 WP_003406192.1.24294 WP_003406192.1.24357 WP_003406192.1.24396 WP_003406192.1.24423 WP_003406192.1.2443 WP_003406192.1.24446 WP_003406192.1.24461 WP_003406192.1.24500 WP_003406192.1.24507 WP_003406192.1.24509 WP_003406192.1.24529 WP_003406192.1.24553 WP_003406192.1.24638 WP_003406192.1.24648 WP_003406192.1.2466 WP_003406192.1.24824 WP_003406192.1.24831 WP_003406192.1.24840 WP_003406192.1.24848 WP_003406192.1.24857 WP_003406192.1.2487 WP_003406192.1.24893 WP_003406192.1.24933 WP_003406192.1.24956 WP_003406192.1.24958 WP_003406192.1.24985 WP_003406192.1.2499 WP_003406192.1.25004 WP_003406192.1.25051 WP_003406192.1.2507 WP_003406192.1.25129 WP_003406192.1.25171 WP_003406192.1.25184 WP_003406192.1.25247 WP_003406192.1.25278 WP_003406192.1.25309 WP_003406192.1.25313 WP_003406192.1.25338 WP_003406192.1.25342 WP_003406192.1.25343 WP_003406192.1.25367 WP_003406192.1.25393 WP_003406192.1.25406 WP_003406192.1.25435 WP_003406192.1.25437 WP_003406192.1.25445 WP_003406192.1.25455 WP_003406192.1.25473 WP_003406192.1.25504 WP_003406192.1.25513 WP_003406192.1.25542 WP_003406192.1.25579 WP_003406192.1.25594 WP_003406192.1.25606 WP_003406192.1.25645 WP_003406192.1.2566 WP_003406192.1.25673 WP_003406192.1.25674 WP_003406192.1.25693 WP_003406192.1.25699 WP_003406192.1.25727 WP_003406192.1.25736 WP_003406192.1.25738 WP_003406192.1.25756 WP_003406192.1.25759 WP_003406192.1.2580 WP_003406192.1.25813 WP_003406192.1.25854 WP_003406192.1.25874 WP_003406192.1.25885 WP_003406192.1.25892 WP_003406192.1.25914 WP_003406192.1.25916 WP_003406192.1.2594 WP_003406192.1.25972 WP_003406192.1.26017 WP_003406192.1.26032 WP_003406192.1.26038 WP_003406192.1.26072 WP_003406192.1.26089 WP_003406192.1.26097 WP_003406192.1.26098 WP_003406192.1.26108 WP_003406192.1.26118 WP_003406192.1.26126 WP_003406192.1.2614 WP_003406192.1.26168 WP_003406192.1.26182 WP_003406192.1.26190 WP_003406192.1.2620 WP_003406192.1.26267 WP_003406192.1.26292 WP_003406192.1.26310 WP_003406192.1.26328 WP_003406192.1.26349 WP_003406192.1.26366 WP_003406192.1.26374 WP_003406192.1.26407 WP_003406192.1.26454 WP_003406192.1.26464 WP_003406192.1.2653 WP_003406192.1.26571 WP_003406192.1.2659 WP_003406192.1.26597 WP_003406192.1.26603 WP_003406192.1.26629 WP_003406192.1.26651 WP_003406192.1.26702 WP_003406192.1.26707 WP_003406192.1.26710 WP_003406192.1.26737 WP_003406192.1.26738 WP_003406192.1.26745 WP_003406192.1.26756 WP_003406192.1.2676 WP_003406192.1.2677 WP_003406192.1.26779 WP_003406192.1.26780 WP_003406192.1.26854 WP_003406192.1.26868 WP_003406192.1.26888 WP_003406192.1.26914 WP_003406192.1.26945 WP_003406192.1.26959 WP_003406192.1.26969 WP_003406192.1.26984 WP_003406192.1.26992 WP_003406192.1.27017 WP_003406192.1.27074 WP_003406192.1.27075 WP_003406192.1.27128 WP_003406192.1.27130 WP_003406192.1.27139 WP_003406192.1.27152 WP_003406192.1.27162 WP_003406192.1.27164 WP_003406192.1.27193 WP_003406192.1.27235 WP_003406192.1.27278 WP_003406192.1.27343 WP_003406192.1.27352 WP_003406192.1.27369 WP_003406192.1.27391 WP_003406192.1.27398 WP_003406192.1.27402 WP_003406192.1.27410 WP_003406192.1.27411 WP_003406192.1.27449 WP_003406192.1.27460 WP_003406192.1.27463 WP_003406192.1.2749 WP_003406192.1.27492 WP_003406192.1.27528 WP_003406192.1.27541 WP_003406192.1.27576 WP_003406192.1.27582 WP_003406192.1.27596 WP_003406192.1.27607 WP_003406192.1.2766 WP_003406192.1.277 WP_003406192.1.27730 WP_003406192.1.27736 WP_003406192.1.27743 WP_003406192.1.27750 WP_003406192.1.27771 WP_003406192.1.27779 WP_003406192.1.27795 WP_003406192.1.27819 WP_003406192.1.27835 WP_003406192.1.27915 WP_003406192.1.27935 WP_003406192.1.27962 WP_003406192.1.28053 WP_003406192.1.28092 WP_003406192.1.28106 WP_003406192.1.28131 WP_003406192.1.28142 WP_003406192.1.28159 WP_003406192.1.2816 WP_003406192.1.28161 WP_003406192.1.28192 WP_003406192.1.28202 WP_003406192.1.28242 WP_003406192.1.28251 WP_003406192.1.28255 WP_003406192.1.28269 WP_003406192.1.28276 WP_003406192.1.28293 WP_003406192.1.28331 WP_003406192.1.28367 WP_003406192.1.28391 WP_003406192.1.2842 WP_003406192.1.28448 WP_003406192.1.2847 WP_003406192.1.28471 WP_003406192.1.28473 WP_003406192.1.28493 WP_003406192.1.28497 WP_003406192.1.28530 WP_003406192.1.28561 WP_003406192.1.28567 WP_003406192.1.28585 WP_003406192.1.286 WP_003406192.1.28610 WP_003406192.1.28617 WP_003406192.1.28634 WP_003406192.1.28642 WP_003406192.1.28671 WP_003406192.1.28698 WP_003406192.1.28703 WP_003406192.1.28739 WP_003406192.1.28781 WP_003406192.1.28787 WP_003406192.1.28827 WP_003406192.1.28847 WP_003406192.1.28850 WP_003406192.1.28851 WP_003406192.1.28865 WP_003406192.1.28897 WP_003406192.1.28914 WP_003406192.1.28935 WP_003406192.1.28936 WP_003406192.1.28939 WP_003406192.1.28943 WP_003406192.1.28952 WP_003406192.1.28975 WP_003406192.1.2899 WP_003406192.1.28993 WP_003406192.1.29000 WP_003406192.1.2901 WP_003406192.1.29028 WP_003406192.1.29058 WP_003406192.1.29115 WP_003406192.1.2916 WP_003406192.1.29217 WP_003406192.1.29234 WP_003406192.1.29264 WP_003406192.1.29275 WP_003406192.1.29306 WP_003406192.1.29339 WP_003406192.1.29348 WP_003406192.1.29364 WP_003406192.1.29367 WP_003406192.1.29426 WP_003406192.1.2944 WP_003406192.1.29449 WP_003406192.1.29450 WP_003406192.1.29452 WP_003406192.1.29510 WP_003406192.1.29515 WP_003406192.1.29525 WP_003406192.1.2953 WP_003406192.1.29587 WP_003406192.1.2959 WP_003406192.1.29592 WP_003406192.1.29599 WP_003406192.1.29611 WP_003406192.1.29632 WP_003406192.1.29649 WP_003406192.1.2965 WP_003406192.1.29659 WP_003406192.1.2969 WP_003406192.1.29696 WP_003406192.1.29698 WP_003406192.1.29745 WP_003406192.1.29747 WP_003406192.1.29769 WP_003406192.1.29825 WP_003406192.1.29830 WP_003406192.1.29847 WP_003406192.1.29861 WP_003406192.1.29869 WP_003406192.1.29883 WP_003406192.1.29890 WP_003406192.1.299 WP_003406192.1.29931 WP_003406192.1.30014 WP_003406192.1.3004 WP_003406192.1.30040 WP_003406192.1.30043 WP_003406192.1.30074 WP_003406192.1.30097 WP_003406192.1.30106 WP_003406192.1.30114 WP_003406192.1.30126 WP_003406192.1.30131 WP_003406192.1.30138 WP_003406192.1.30139 WP_003406192.1.30145 WP_003406192.1.30235 WP_003406192.1.30237 WP_003406192.1.3027 WP_003406192.1.30279 WP_003406192.1.30283 WP_003406192.1.30288 WP_003406192.1.30291 WP_003406192.1.30363 WP_003406192.1.30374 WP_003406192.1.30404 WP_003406192.1.30433 WP_003406192.1.30438 WP_003406192.1.30462 WP_003406192.1.30464 WP_003406192.1.30468 WP_003406192.1.30500 WP_003406192.1.3057 WP_003406192.1.30574 WP_003406192.1.30628 WP_003406192.1.30641 WP_003406192.1.30642 WP_003406192.1.30661 WP_003406192.1.30683 WP_003406192.1.30699 WP_003406192.1.30709 WP_003406192.1.30713 WP_003406192.1.30716 WP_003406192.1.30719 WP_003406192.1.30730 WP_003406192.1.30736 WP_003406192.1.30760 WP_003406192.1.30791 WP_003406192.1.308 WP_003406192.1.30807 WP_003406192.1.30818 WP_003406192.1.30824 WP_003406192.1.30877 WP_003406192.1.30888 WP_003406192.1.30901 WP_003406192.1.30903 WP_003406192.1.30912 WP_003406192.1.30913 WP_003406192.1.30914 WP_003406192.1.30919 WP_003406192.1.30977 WP_003406192.1.3100 WP_003406192.1.31002 WP_003406192.1.3101 WP_003406192.1.31034 WP_003406192.1.31047 WP_003406192.1.31074 WP_003406192.1.31102 WP_003406192.1.31127 WP_003406192.1.31184 WP_003406192.1.31199 WP_003406192.1.31226 WP_003406192.1.31230 WP_003406192.1.31233 WP_003406192.1.31263 WP_003406192.1.31270 WP_003406192.1.31287 WP_003406192.1.31290 WP_003406192.1.31304 WP_003406192.1.31346 WP_003406192.1.31348 WP_003406192.1.31354 WP_003406192.1.31390 WP_003406192.1.31414 WP_003406192.1.31417 WP_003406192.1.31428 WP_003406192.1.3143 WP_003406192.1.31483 WP_003406192.1.3149 WP_003406192.1.31498 WP_003406192.1.31507 WP_003406192.1.31537 WP_003406192.1.31548 WP_003406192.1.316 WP_003406192.1.31629 WP_003406192.1.31666 WP_003406192.1.31693 WP_003406192.1.31703 WP_003406192.1.31744 WP_003406192.1.31770 WP_003406192.1.31776 WP_003406192.1.31783 WP_003406192.1.318 WP_003406192.1.3184 WP_003406192.1.31840 WP_003406192.1.31911 WP_003406192.1.31930 WP_003406192.1.31932 WP_003406192.1.31955 WP_003406192.1.31985 WP_003406192.1.31991 WP_003406192.1.31995 WP_003406192.1.32004 WP_003406192.1.32039 WP_003406192.1.3204 WP_003406192.1.32045 WP_003406192.1.32071 WP_003406192.1.32098 WP_003406192.1.32132 WP_003406192.1.32157 WP_003406192.1.32164 WP_003406192.1.32179 WP_003406192.1.32198 WP_003406192.1.32297 WP_003406192.1.32317 WP_003406192.1.32383 WP_003406192.1.32403 WP_003406192.1.32416 WP_003406192.1.32421 WP_003406192.1.32433 WP_003406192.1.32461 WP_003406192.1.32482 WP_003406192.1.32503 WP_003406192.1.32556 WP_003406192.1.32562 WP_003406192.1.32569 WP_003406192.1.32592 WP_003406192.1.32620 WP_003406192.1.32647 WP_003406192.1.32653 WP_003406192.1.32654 WP_003406192.1.3268 WP_003406192.1.32695 WP_003406192.1.32706 WP_003406192.1.32716 WP_003406192.1.32752 WP_003406192.1.32780 WP_003406192.1.32781 WP_003406192.1.32793 WP_003406192.1.32799 WP_003406192.1.32833 WP_003406192.1.32862 WP_003406192.1.32880 WP_003406192.1.32897 WP_003406192.1.32909 WP_003406192.1.32935 WP_003406192.1.32974 WP_003406192.1.33007 WP_003406192.1.3302 WP_003406192.1.33028 WP_003406192.1.33054 WP_003406192.1.33141 WP_003406192.1.33148 WP_003406192.1.33155 WP_003406192.1.3321 WP_003406192.1.33215 WP_003406192.1.3325 WP_003406192.1.3327 WP_003406192.1.33278 WP_003406192.1.33288 WP_003406192.1.3331 WP_003406192.1.33319 WP_003406192.1.3333 WP_003406192.1.33393 WP_003406192.1.33403 WP_003406192.1.33452 WP_003406192.1.33467 WP_003406192.1.33477 WP_003406192.1.3349 WP_003406192.1.33519 WP_003406192.1.33542 WP_003406192.1.33601 WP_003406192.1.33602 WP_003406192.1.33646 WP_003406192.1.33673 WP_003406192.1.3369 WP_003406192.1.33705 WP_003406192.1.33762 WP_003406192.1.33783 WP_003406192.1.33789 WP_003406192.1.3383 WP_003406192.1.33832 WP_003406192.1.33839 WP_003406192.1.33848 WP_003406192.1.3387 WP_003406192.1.33886 WP_003406192.1.33895 WP_003406192.1.33912 WP_003406192.1.33954 WP_003406192.1.34042 WP_003406192.1.3405 WP_003406192.1.34055 WP_003406192.1.34056 WP_003406192.1.34065 WP_003406192.1.34090 WP_003406192.1.34109 WP_003406192.1.34152 WP_003406192.1.34163 WP_003406192.1.34181 WP_003406192.1.34197 WP_003406192.1.34198 WP_003406192.1.34215 WP_003406192.1.34219 WP_003406192.1.34255 WP_003406192.1.34260 WP_003406192.1.343 WP_003406192.1.34347 WP_003406192.1.34392 WP_003406192.1.344 WP_003406192.1.34428 WP_003406192.1.3443 WP_003406192.1.34435 WP_003406192.1.34446 WP_003406192.1.34499 WP_003406192.1.34505 WP_003406192.1.34516 WP_003406192.1.34529 WP_003406192.1.34551 WP_003406192.1.34563 WP_003406192.1.34576 WP_003406192.1.34581 WP_003406192.1.34588 WP_003406192.1.34596 WP_003406192.1.34599 WP_003406192.1.34639 WP_003406192.1.34724 WP_003406192.1.34740 WP_003406192.1.34755 WP_003406192.1.34777 WP_003406192.1.34783 WP_003406192.1.34841 WP_003406192.1.34908 WP_003406192.1.34919 WP_003406192.1.3492 WP_003406192.1.34933 WP_003406192.1.34945 WP_003406192.1.34946 WP_003406192.1.34960 WP_003406192.1.34961 WP_003406192.1.34965 WP_003406192.1.34968 WP_003406192.1.35023 WP_003406192.1.35069 WP_003406192.1.35072 WP_003406192.1.35078 WP_003406192.1.35156 WP_003406192.1.35160 WP_003406192.1.35162 WP_003406192.1.35176 WP_003406192.1.3520 WP_003406192.1.35213 WP_003406192.1.35221 WP_003406192.1.35246 WP_003406192.1.35301 WP_003406192.1.35311 WP_003406192.1.35312 WP_003406192.1.35317 WP_003406192.1.35319 WP_003406192.1.35347 WP_003406192.1.35363 WP_003406192.1.35382 WP_003406192.1.35396 WP_003406192.1.35397 WP_003406192.1.35426 WP_003406192.1.35439 WP_003406192.1.35455 WP_003406192.1.3548 WP_003406192.1.35484 WP_003406192.1.35492 WP_003406192.1.3553 WP_003406192.1.35553 WP_003406192.1.35555 WP_003406192.1.35561 WP_003406192.1.35610 WP_003406192.1.35635 WP_003406192.1.35657 WP_003406192.1.35687 WP_003406192.1.35689 WP_003406192.1.35707 WP_003406192.1.35732 WP_003406192.1.35754 WP_003406192.1.35767 WP_003406192.1.35770 WP_003406192.1.35771 WP_003406192.1.35780 WP_003406192.1.35805 WP_003406192.1.3584 WP_003406192.1.35848 WP_003406192.1.35864 WP_003406192.1.35874 WP_003406192.1.35876 WP_003406192.1.35899 WP_003406192.1.35954 WP_003406192.1.36014 WP_003406192.1.36023 WP_003406192.1.36051 WP_003406192.1.36053 WP_003406192.1.36075 WP_003406192.1.36089 WP_003406192.1.36097 WP_003406192.1.36098 WP_003406192.1.36116 WP_003406192.1.36145 WP_003406192.1.36205 WP_003406192.1.36228 WP_003406192.1.36252 WP_003406192.1.36260 WP_003406192.1.36271 WP_003406192.1.36303 WP_003406192.1.36309 WP_003406192.1.36315 WP_003406192.1.36319 WP_003406192.1.36321 WP_003406192.1.36326 WP_003406192.1.3634 WP_003406192.1.36356 WP_003406192.1.36357 WP_003406192.1.3636 WP_003406192.1.36385 WP_003406192.1.36399 WP_003406192.1.36436 WP_003406192.1.36465 WP_003406192.1.36469 WP_003406192.1.36473 WP_003406192.1.36485 WP_003406192.1.36508 WP_003406192.1.36540 WP_003406192.1.36561 WP_003406192.1.36571 WP_003406192.1.36573 WP_003406192.1.36578 WP_003406192.1.36597 WP_003406192.1.36614 WP_003406192.1.36674 WP_003406192.1.36720 WP_003406192.1.36727 WP_003406192.1.36733 WP_003406192.1.36810 WP_003406192.1.36862 WP_003406192.1.36893 WP_003406192.1.36901 WP_003406192.1.36921 WP_003406192.1.36935 WP_003406192.1.36941 WP_003406192.1.3695 WP_003406192.1.36968 WP_003406192.1.3700 WP_003406192.1.37004 WP_003406192.1.37012 WP_003406192.1.37071 WP_003406192.1.37088 WP_003406192.1.37131 WP_003406192.1.37157 WP_003406192.1.37175 WP_003406192.1.37188 WP_003406192.1.37213 WP_003406192.1.37229 WP_003406192.1.3724 WP_003406192.1.37277 WP_003406192.1.37305 WP_003406192.1.37330 WP_003406192.1.37389 WP_003406192.1.37400 WP_003406192.1.37440 WP_003406192.1.37459 WP_003406192.1.37468 WP_003406192.1.37475 WP_003406192.1.37484 WP_003406192.1.37601 WP_003406192.1.37612 WP_003406192.1.37632 WP_003406192.1.37643 WP_003406192.1.37660 WP_003406192.1.37674 WP_003406192.1.37700 WP_003406192.1.37701 WP_003406192.1.37709 WP_003406192.1.37711 WP_003406192.1.37721 WP_003406192.1.37722 WP_003406192.1.37747 WP_003406192.1.37765 WP_003406192.1.37772 WP_003406192.1.37809 WP_003406192.1.37859 WP_003406192.1.37877 WP_003406192.1.37912 WP_003406192.1.37913 WP_003406192.1.37943 WP_003406192.1.37950 WP_003406192.1.37973 WP_003406192.1.37975 WP_003406192.1.37983 WP_003406192.1.38002 WP_003406192.1.38039 WP_003406192.1.38040 WP_003406192.1.38067 WP_003406192.1.38068 WP_003406192.1.38138 WP_003406192.1.38144 WP_003406192.1.38158 WP_003406192.1.38159 WP_003406192.1.38210 WP_003406192.1.38233 WP_003406192.1.38240 WP_003406192.1.38299 WP_003406192.1.38332 WP_003406192.1.38347 WP_003406192.1.38354 WP_003406192.1.38389 WP_003406192.1.38398 WP_003406192.1.38402 WP_003406192.1.38418 WP_003406192.1.38421 WP_003406192.1.38483 WP_003406192.1.3849 WP_003406192.1.385 WP_003406192.1.38594 WP_003406192.1.38638 WP_003406192.1.38639 WP_003406192.1.38646 WP_003406192.1.38648 WP_003406192.1.38654 WP_003406192.1.38660 WP_003406192.1.38666 WP_003406192.1.38671 WP_003406192.1.38672 WP_003406192.1.38677 WP_003406192.1.38750 WP_003406192.1.38772 WP_003406192.1.38812 WP_003406192.1.38821 WP_003406192.1.38844 WP_003406192.1.38863 WP_003406192.1.38873 WP_003406192.1.3889 WP_003406192.1.38894 WP_003406192.1.38909 WP_003406192.1.38939 WP_003406192.1.38974 WP_003406192.1.38975 WP_003406192.1.38991 WP_003406192.1.39025 WP_003406192.1.39070 WP_003406192.1.39072 WP_003406192.1.39095 WP_003406192.1.39106 WP_003406192.1.39165 WP_003406192.1.39174 WP_003406192.1.39176 WP_003406192.1.39178 WP_003406192.1.39190 WP_003406192.1.39201 WP_003406192.1.39207 WP_003406192.1.39236 WP_003406192.1.39239 WP_003406192.1.39252 WP_003406192.1.39288 WP_003406192.1.39295 WP_003406192.1.39306 WP_003406192.1.39359 WP_003406192.1.39364 WP_003406192.1.39400 WP_003406192.1.39447 WP_003406192.1.3945 WP_003406192.1.39450 WP_003406192.1.39521 WP_003406192.1.39560 WP_003406192.1.39593 WP_003406192.1.396 WP_003406192.1.3960 WP_003406192.1.39616 WP_003406192.1.39654 WP_003406192.1.39674 WP_003406192.1.39678 WP_003406192.1.3968 WP_003406192.1.39694 WP_003406192.1.3971 WP_003406192.1.39718 WP_003406192.1.39728 WP_003406192.1.39739 WP_003406192.1.39748 WP_003406192.1.39751 WP_003406192.1.39759 WP_003406192.1.39801 WP_003406192.1.39804 WP_003406192.1.39848 WP_003406192.1.39877 WP_003406192.1.39925 WP_003406192.1.3994 WP_003406192.1.39959 WP_003406192.1.3996 WP_003406192.1.39960 WP_003406192.1.3997 WP_003406192.1.39980 WP_003406192.1.40000 WP_003406192.1.40028 WP_003406192.1.4003 WP_003406192.1.40094 WP_003406192.1.40150 WP_003406192.1.40156 WP_003406192.1.40174 WP_003406192.1.40186 WP_003406192.1.40277 WP_003406192.1.40323 WP_003406192.1.40336 WP_003406192.1.40353 WP_003406192.1.4036 WP_003406192.1.40402 WP_003406192.1.40413 WP_003406192.1.40446 WP_003406192.1.40451 WP_003406192.1.40455 WP_003406192.1.40523 WP_003406192.1.40641 WP_003406192.1.40646 WP_003406192.1.40651 WP_003406192.1.40653 WP_003406192.1.4067 WP_003406192.1.40705 WP_003406192.1.40723 WP_003406192.1.40731 WP_003406192.1.40735 WP_003406192.1.40799 WP_003406192.1.40876 WP_003406192.1.40881 WP_003406192.1.40922 WP_003406192.1.4095 WP_003406192.1.40956 WP_003406192.1.40957 WP_003406192.1.410 WP_003406192.1.41000 WP_003406192.1.41055 WP_003406192.1.41108 WP_003406192.1.41123 WP_003406192.1.41177 WP_003406192.1.41202 WP_003406192.1.41219 WP_003406192.1.41231 WP_003406192.1.41249 WP_003406192.1.4127 WP_003406192.1.41355 WP_003406192.1.41376 WP_003406192.1.41430 WP_003406192.1.41469 WP_003406192.1.41504 WP_003406192.1.41553 WP_003406192.1.41564 WP_003406192.1.41632 WP_003406192.1.41635 WP_003406192.1.41648 WP_003406192.1.41685 WP_003406192.1.41695 WP_003406192.1.41704 WP_003406192.1.4171 WP_003406192.1.41719 WP_003406192.1.41733 WP_003406192.1.41744 WP_003406192.1.41774 WP_003406192.1.41791 WP_003406192.1.41803 WP_003406192.1.41820 WP_003406192.1.41828 WP_003406192.1.41829 WP_003406192.1.41860 WP_003406192.1.41912 WP_003406192.1.41921 WP_003406192.1.41933 WP_003406192.1.41944 WP_003406192.1.42043 WP_003406192.1.42094 WP_003406192.1.42112 WP_003406192.1.4212 WP_003406192.1.42122 WP_003406192.1.42134 WP_003406192.1.42183 WP_003406192.1.42188 WP_003406192.1.42202 WP_003406192.1.42208 WP_003406192.1.42247 WP_003406192.1.42255 WP_003406192.1.42273 WP_003406192.1.42278 WP_003406192.1.42304 WP_003406192.1.42309 WP_003406192.1.42370 WP_003406192.1.42385 WP_003406192.1.42400 WP_003406192.1.42414 WP_003406192.1.42430 WP_003406192.1.42461 WP_003406192.1.42465 WP_003406192.1.42467 WP_003406192.1.42473 WP_003406192.1.42474 WP_003406192.1.4248 WP_003406192.1.42494 WP_003406192.1.42519 WP_003406192.1.42524 WP_003406192.1.42534 WP_003406192.1.4255 WP_003406192.1.42562 WP_003406192.1.42568 WP_003406192.1.42570 WP_003406192.1.42660 WP_003406192.1.42695 WP_003406192.1.42704 WP_003406192.1.42705 WP_003406192.1.42722 WP_003406192.1.42777 WP_003406192.1.42835 WP_003406192.1.42839 WP_003406192.1.42905 WP_003406192.1.42916 WP_003406192.1.42930 WP_003406192.1.42971 WP_003406192.1.43005 WP_003406192.1.43009 WP_003406192.1.43053 WP_003406192.1.43082 WP_003406192.1.43087 WP_003406192.1.43098 WP_003406192.1.43208 WP_003406192.1.43236 WP_003406192.1.43255 WP_003406192.1.43266 WP_003406192.1.43269 WP_003406192.1.43273 WP_003406192.1.43296 WP_003406192.1.43306 WP_003406192.1.4335 WP_003406192.1.43368 WP_003406192.1.43395 WP_003406192.1.43475 WP_003406192.1.43478 WP_003406192.1.43484 WP_003406192.1.43557 WP_003406192.1.43578 WP_003406192.1.43588 WP_003406192.1.43643 WP_003406192.1.43664 WP_003406192.1.43684 WP_003406192.1.43686 WP_003406192.1.43706 WP_003406192.1.43716 WP_003406192.1.4377 WP_003406192.1.43781 WP_003406192.1.43794 WP_003406192.1.43815 WP_003406192.1.43846 WP_003406192.1.43861 WP_003406192.1.43863 WP_003406192.1.43866 WP_003406192.1.43872 WP_003406192.1.43885 WP_003406192.1.43897 WP_003406192.1.43902 WP_003406192.1.43921 WP_003406192.1.43936 WP_003406192.1.43960 WP_003406192.1.43965 WP_003406192.1.4399 WP_003406192.1.43993 WP_003406192.1.43996 WP_003406192.1.44 WP_003406192.1.44001 WP_003406192.1.44008 WP_003406192.1.44033 WP_003406192.1.44037 WP_003406192.1.44070 WP_003406192.1.44071 WP_003406192.1.44076 WP_003406192.1.44104 WP_003406192.1.44111 WP_003406192.1.44124 WP_003406192.1.44169 WP_003406192.1.44219 WP_003406192.1.44237 WP_003406192.1.44277 WP_003406192.1.44279 WP_003406192.1.44336 WP_003406192.1.44355 WP_003406192.1.44358 WP_003406192.1.4438 WP_003406192.1.44392 WP_003406192.1.4441 WP_003406192.1.44415 WP_003406192.1.44466 WP_003406192.1.44489 WP_003406192.1.44492 WP_003406192.1.44494 WP_003406192.1.44500 WP_003406192.1.44532 WP_003406192.1.44534 WP_003406192.1.44562 WP_003406192.1.44597 WP_003406192.1.44600 WP_003406192.1.44602 WP_003406192.1.44615 WP_003406192.1.4464 WP_003406192.1.44651 WP_003406192.1.44659 WP_003406192.1.44665 WP_003406192.1.44694 WP_003406192.1.44700 WP_003406192.1.44713 WP_003406192.1.44735 WP_003406192.1.44740 WP_003406192.1.44757 WP_003406192.1.4476 WP_003406192.1.44761 WP_003406192.1.44776 WP_003406192.1.44779 WP_003406192.1.44786 WP_003406192.1.44808 WP_003406192.1.44864 WP_003406192.1.44901 WP_003406192.1.44908 WP_003406192.1.44913 WP_003406192.1.4492 WP_003406192.1.44939 WP_003406192.1.44979 WP_003406192.1.44981 WP_003406192.1.45011 WP_003406192.1.4504 WP_003406192.1.45081 WP_003406192.1.45113 WP_003406192.1.45129 WP_003406192.1.45135 WP_003406192.1.45147 WP_003406192.1.4517 WP_003406192.1.45181 WP_003406192.1.45185 WP_003406192.1.45192 WP_003406192.1.45200 WP_003406192.1.45205 WP_003406192.1.45211 WP_003406192.1.45249 WP_003406192.1.4526 WP_003406192.1.45286 WP_003406192.1.45326 WP_003406192.1.45347 WP_003406192.1.45374 WP_003406192.1.45390 WP_003406192.1.454 WP_003406192.1.45407 WP_003406192.1.45451 WP_003406192.1.45453 WP_003406192.1.45460 WP_003406192.1.45463 WP_003406192.1.45470 WP_003406192.1.45474 WP_003406192.1.45491 WP_003406192.1.45510 WP_003406192.1.45563 WP_003406192.1.45584 WP_003406192.1.45590 WP_003406192.1.45619 WP_003406192.1.45626 WP_003406192.1.45631 WP_003406192.1.45666 WP_003406192.1.45697 WP_003406192.1.4571 WP_003406192.1.45731 WP_003406192.1.45743 WP_003406192.1.45765 WP_003406192.1.45805 WP_003406192.1.45815 WP_003406192.1.45849 WP_003406192.1.4590 WP_003406192.1.45923 WP_003406192.1.45926 WP_003406192.1.45963 WP_003406192.1.46025 WP_003406192.1.46083 WP_003406192.1.46092 WP_003406192.1.46100 WP_003406192.1.46101 WP_003406192.1.46103 WP_003406192.1.46107 WP_003406192.1.46127 WP_003406192.1.46128 WP_003406192.1.46129 WP_003406192.1.46141 WP_003406192.1.46150 WP_003406192.1.46201 WP_003406192.1.46226 WP_003406192.1.4624 WP_003406192.1.46253 WP_003406192.1.46268 WP_003406192.1.46285 WP_003406192.1.46313 WP_003406192.1.46336 WP_003406192.1.46365 WP_003406192.1.46370 WP_003406192.1.46381 WP_003406192.1.46411 WP_003406192.1.4644 WP_003406192.1.46442 WP_003406192.1.46453 WP_003406192.1.46478 WP_003406192.1.46492 WP_003406192.1.46521 WP_003406192.1.4653 WP_003406192.1.46532 WP_003406192.1.46539 WP_003406192.1.46568 WP_003406192.1.46585 WP_003406192.1.46609 WP_003406192.1.46625 WP_003406192.1.46642 WP_003406192.1.46647 WP_003406192.1.46724 WP_003406192.1.46773 WP_003406192.1.46777 WP_003406192.1.46786 WP_003406192.1.46792 WP_003406192.1.46847 WP_003406192.1.46851 WP_003406192.1.4687 WP_003406192.1.46936 WP_003406192.1.47011 WP_003406192.1.47066 WP_003406192.1.47077 WP_003406192.1.47083 WP_003406192.1.47106 WP_003406192.1.47142 WP_003406192.1.47147 WP_003406192.1.47166 WP_003406192.1.47178 WP_003406192.1.47179 WP_003406192.1.47194 WP_003406192.1.47207 WP_003406192.1.47210 WP_003406192.1.47261 WP_003406192.1.47262 WP_003406192.1.47402 WP_003406192.1.47423 WP_003406192.1.47467 WP_003406192.1.47502 WP_003406192.1.4751 WP_003406192.1.47511 WP_003406192.1.47537 WP_003406192.1.47540 WP_003406192.1.47568 WP_003406192.1.47572 WP_003406192.1.47636 WP_003406192.1.4764 WP_003406192.1.47679 WP_003406192.1.47681 WP_003406192.1.47690 WP_003406192.1.4771 WP_003406192.1.47717 WP_003406192.1.47743 WP_003406192.1.47754 WP_003406192.1.47773 WP_003406192.1.47776 WP_003406192.1.47780 WP_003406192.1.47805 WP_003406192.1.47832 WP_003406192.1.47847 WP_003406192.1.47858 WP_003406192.1.47861 WP_003406192.1.47893 WP_003406192.1.47899 WP_003406192.1.479 WP_003406192.1.47912 WP_003406192.1.47913 WP_003406192.1.47926 WP_003406192.1.4794 WP_003406192.1.47943 WP_003406192.1.47944 WP_003406192.1.47959 WP_003406192.1.47974 WP_003406192.1.47993 WP_003406192.1.48004 WP_003406192.1.48039 WP_003406192.1.48050 WP_003406192.1.48084 WP_003406192.1.48097 WP_003406192.1.48101 WP_003406192.1.4813 WP_003406192.1.48130 WP_003406192.1.48143 WP_003406192.1.48152 WP_003406192.1.48155 WP_003406192.1.48170 WP_003406192.1.48173 WP_003406192.1.48177 WP_003406192.1.48185 WP_003406192.1.48204 WP_003406192.1.48219 WP_003406192.1.4823 WP_003406192.1.48240 WP_003406192.1.48256 WP_003406192.1.48264 WP_003406192.1.48287 WP_003406192.1.48330 WP_003406192.1.48333 WP_003406192.1.48348 WP_003406192.1.48354 WP_003406192.1.48372 WP_003406192.1.48383 WP_003406192.1.48388 WP_003406192.1.48419 WP_003406192.1.48423 WP_003406192.1.48443 WP_003406192.1.48462 WP_003406192.1.48543 WP_003406192.1.48550 WP_003406192.1.48605 WP_003406192.1.4863 WP_003406192.1.48648 WP_003406192.1.48658 WP_003406192.1.48666 WP_003406192.1.48687 WP_003406192.1.48779 WP_003406192.1.4878 WP_003406192.1.48798 WP_003406192.1.48802 WP_003406192.1.48826 WP_003406192.1.48843 WP_003406192.1.48857 WP_003406192.1.4890 WP_003406192.1.48946 WP_003406192.1.48979 WP_003406192.1.49017 WP_003406192.1.49048 WP_003406192.1.49059 WP_003406192.1.4906 WP_003406192.1.4907 WP_003406192.1.49103 WP_003406192.1.49110 WP_003406192.1.4919 WP_003406192.1.49251 WP_003406192.1.49263 WP_003406192.1.49291 WP_003406192.1.49296 WP_003406192.1.49335 WP_003406192.1.49337 WP_003406192.1.49419 WP_003406192.1.49426 WP_003406192.1.49437 WP_003406192.1.49439 WP_003406192.1.49474 WP_003406192.1.49506 WP_003406192.1.49523 WP_003406192.1.49526 WP_003406192.1.49532 WP_003406192.1.4959 WP_003406192.1.49687 WP_003406192.1.49699 WP_003406192.1.49709 WP_003406192.1.4971 WP_003406192.1.4972 WP_003406192.1.49736 WP_003406192.1.49746 WP_003406192.1.49764 WP_003406192.1.49773 WP_003406192.1.49796 WP_003406192.1.49814 WP_003406192.1.49815 WP_003406192.1.49816 WP_003406192.1.49839 WP_003406192.1.49857 WP_003406192.1.49878 WP_003406192.1.49880 WP_003406192.1.49944 WP_003406192.1.4999 WP_003406192.1.49990 WP_003406192.1.50068 WP_003406192.1.50077 WP_003406192.1.5008 WP_003406192.1.50081 WP_003406192.1.50122 WP_003406192.1.50126 WP_003406192.1.50149 WP_003406192.1.50162 WP_003406192.1.5018 WP_003406192.1.50194 WP_003406192.1.50235 WP_003406192.1.50249 WP_003406192.1.50265 WP_003406192.1.50271 WP_003406192.1.50324 WP_003406192.1.50347 WP_003406192.1.50372 WP_003406192.1.50398 WP_003406192.1.50444 WP_003406192.1.50466 WP_003406192.1.50472 WP_003406192.1.5048 WP_003406192.1.50498 WP_003406192.1.5050 WP_003406192.1.50540 WP_003406192.1.50554 WP_003406192.1.50557 WP_003406192.1.50610 WP_003406192.1.50632 WP_003406192.1.50633 WP_003406192.1.50655 WP_003406192.1.50659 WP_003406192.1.50683 WP_003406192.1.50689 WP_003406192.1.50692 WP_003406192.1.50714 WP_003406192.1.50729 WP_003406192.1.50756 WP_003406192.1.50784 WP_003406192.1.50794 WP_003406192.1.50841 WP_003406192.1.50877 WP_003406192.1.5096 WP_003406192.1.50981 WP_003406192.1.50987 WP_003406192.1.51003 WP_003406192.1.51009 WP_003406192.1.51037 WP_003406192.1.51074 WP_003406192.1.51082 WP_003406192.1.51101 WP_003406192.1.51116 WP_003406192.1.51149 WP_003406192.1.51157 WP_003406192.1.51213 WP_003406192.1.51232 WP_003406192.1.51239 WP_003406192.1.51247 WP_003406192.1.51266 WP_003406192.1.51279 WP_003406192.1.51291 WP_003406192.1.51294 WP_003406192.1.51301 WP_003406192.1.51329 WP_003406192.1.51391 WP_003406192.1.51422 WP_003406192.1.51445 WP_003406192.1.51455 WP_003406192.1.51466 WP_003406192.1.51468 WP_003406192.1.51478 WP_003406192.1.51497 WP_003406192.1.51520 WP_003406192.1.51593 WP_003406192.1.51628 WP_003406192.1.5164 WP_003406192.1.51647 WP_003406192.1.51660 WP_003406192.1.51696 WP_003406192.1.51721 WP_003406192.1.51788 WP_003406192.1.51795 WP_003406192.1.51801 WP_003406192.1.51817 WP_003406192.1.51819 WP_003406192.1.51854 WP_003406192.1.51923 WP_003406192.1.51942 WP_003406192.1.51948 WP_003406192.1.51963 WP_003406192.1.51969 WP_003406192.1.52000 WP_003406192.1.52001 WP_003406192.1.52003 WP_003406192.1.52006 WP_003406192.1.52036 WP_003406192.1.52046 WP_003406192.1.52059 WP_003406192.1.52069 WP_003406192.1.52082 WP_003406192.1.52102 WP_003406192.1.52166 WP_003406192.1.52168 WP_003406192.1.52173 WP_003406192.1.52178 WP_003406192.1.52206 WP_003406192.1.52216 WP_003406192.1.52238 WP_003406192.1.52241 WP_003406192.1.52280 WP_003406192.1.52314 WP_003406192.1.52385 WP_003406192.1.52390 WP_003406192.1.524 WP_003406192.1.52485 WP_003406192.1.52486 WP_003406192.1.52504 WP_003406192.1.52522 WP_003406192.1.52531 WP_003406192.1.52533 WP_003406192.1.52545 WP_003406192.1.52553 WP_003406192.1.52563 WP_003406192.1.52564 WP_003406192.1.52574 WP_003406192.1.52641 WP_003406192.1.52673 WP_003406192.1.52674 WP_003406192.1.52708 WP_003406192.1.52713 WP_003406192.1.52761 WP_003406192.1.52778 WP_003406192.1.52797 WP_003406192.1.52818 WP_003406192.1.52872 WP_003406192.1.52873 WP_003406192.1.52891 WP_003406192.1.52892 WP_003406192.1.52909 WP_003406192.1.52970 WP_003406192.1.52998 WP_003406192.1.53053 WP_003406192.1.53056 WP_003406192.1.5306 WP_003406192.1.53088 WP_003406192.1.5309 WP_003406192.1.531 WP_003406192.1.53117 WP_003406192.1.53118 WP_003406192.1.53142 WP_003406192.1.53143 WP_003406192.1.53157 WP_003406192.1.53200 WP_003406192.1.53213 WP_003406192.1.53217 WP_003406192.1.53226 WP_003406192.1.53229 WP_003406192.1.53230 WP_003406192.1.53237 WP_003406192.1.53254 WP_003406192.1.53257 WP_003406192.1.5327 WP_003406192.1.53276 WP_003406192.1.53278 WP_003406192.1.533 WP_003406192.1.53306 WP_003406192.1.5334 WP_003406192.1.5335 WP_003406192.1.53353 WP_003406192.1.53381 WP_003406192.1.53413 WP_003406192.1.53458 WP_003406192.1.53460 WP_003406192.1.53480 WP_003406192.1.53517 WP_003406192.1.53522 WP_003406192.1.53526 WP_003406192.1.53553 WP_003406192.1.53606 WP_003406192.1.53628 WP_003406192.1.53643 WP_003406192.1.53667 WP_003406192.1.53679 WP_003406192.1.53715 WP_003406192.1.53730 WP_003406192.1.53742 WP_003406192.1.53754 WP_003406192.1.53775 WP_003406192.1.53803 WP_003406192.1.53818 WP_003406192.1.53853 WP_003406192.1.53888 WP_003406192.1.53900 WP_003406192.1.53912 WP_003406192.1.53914 WP_003406192.1.53952 WP_003406192.1.5398 WP_003406192.1.5408 WP_003406192.1.54089 WP_003406192.1.54093 WP_003406192.1.54099 WP_003406192.1.54112 WP_003406192.1.54125 WP_003406192.1.54141 WP_003406192.1.54162 WP_003406192.1.54218 WP_003406192.1.54225 WP_003406192.1.54227 WP_003406192.1.54232 WP_003406192.1.54241 WP_003406192.1.54247 WP_003406192.1.54260 WP_003406192.1.54275 WP_003406192.1.54280 WP_003406192.1.5429 WP_003406192.1.54294 WP_003406192.1.54314 WP_003406192.1.54351 WP_003406192.1.54370 WP_003406192.1.54428 WP_003406192.1.54449 WP_003406192.1.54494 WP_003406192.1.5452 WP_003406192.1.54531 WP_003406192.1.54537 WP_003406192.1.54553 WP_003406192.1.54555 WP_003406192.1.54575 WP_003406192.1.54633 WP_003406192.1.54686 WP_003406192.1.54687 WP_003406192.1.54705 WP_003406192.1.54730 WP_003406192.1.54732 WP_003406192.1.5475 WP_003406192.1.54797 WP_003406192.1.54807 WP_003406192.1.54836 WP_003406192.1.54838 WP_003406192.1.54860 WP_003406192.1.54888 WP_003406192.1.54905 WP_003406192.1.54909 WP_003406192.1.54937 WP_003406192.1.54939 WP_003406192.1.54944 WP_003406192.1.54945 WP_003406192.1.54953 WP_003406192.1.54964 WP_003406192.1.55015 WP_003406192.1.55022 WP_003406192.1.55023 WP_003406192.1.55051 WP_003406192.1.55088 WP_003406192.1.55126 WP_003406192.1.55128 WP_003406192.1.55140 WP_003406192.1.55150 WP_003406192.1.55227 WP_003406192.1.55257 WP_003406192.1.55258 WP_003406192.1.55279 WP_003406192.1.55307 WP_003406192.1.55326 WP_003406192.1.55328 WP_003406192.1.5533 WP_003406192.1.55396 WP_003406192.1.55398 WP_003406192.1.55441 WP_003406192.1.55459 WP_003406192.1.55501 WP_003406192.1.55578 WP_003406192.1.55626 WP_003406192.1.55641 WP_003406192.1.5569 WP_003406192.1.55723 WP_003406192.1.55735 WP_003406192.1.5574 WP_003406192.1.55772 WP_003406192.1.55802 WP_003406192.1.55821 WP_003406192.1.5583 WP_003406192.1.55849 WP_003406192.1.55856 WP_003406192.1.55860 WP_003406192.1.55882 WP_003406192.1.55883 WP_003406192.1.55894 WP_003406192.1.55902 WP_003406192.1.55908 WP_003406192.1.55909 WP_003406192.1.5591 WP_003406192.1.55961 WP_003406192.1.55977 WP_003406192.1.55983 WP_003406192.1.56028 WP_003406192.1.56060 WP_003406192.1.56107 WP_003406192.1.56132 WP_003406192.1.56163 WP_003406192.1.56167 WP_003406192.1.56178 WP_003406192.1.56287 WP_003406192.1.56292 WP_003406192.1.56327 WP_003406192.1.56341 WP_003406192.1.56359 WP_003406192.1.56365 WP_003406192.1.56394 WP_003406192.1.56443 WP_003406192.1.56473 WP_003406192.1.56478 WP_003406192.1.56500 WP_003406192.1.56517 WP_003406192.1.5656 WP_003406192.1.56577 WP_003406192.1.56593 WP_003406192.1.56625 WP_003406192.1.56637 WP_003406192.1.56670 WP_003406192.1.56697 WP_003406192.1.567 WP_003406192.1.56701 WP_003406192.1.56743 WP_003406192.1.56755 WP_003406192.1.56764 WP_003406192.1.56769 WP_003406192.1.56795 WP_003406192.1.56827 WP_003406192.1.56839 WP_003406192.1.56863 WP_003406192.1.56868 WP_003406192.1.56869 WP_003406192.1.56915 WP_003406192.1.56926 WP_003406192.1.56961 WP_003406192.1.56971 WP_003406192.1.56972 WP_003406192.1.57023 WP_003406192.1.57035 WP_003406192.1.57077 WP_003406192.1.57087 WP_003406192.1.57094 WP_003406192.1.57134 WP_003406192.1.57169 WP_003406192.1.57208 WP_003406192.1.57212 WP_003406192.1.5724 WP_003406192.1.5725 WP_003406192.1.5727 WP_003406192.1.57273 WP_003406192.1.573 WP_003406192.1.57326 WP_003406192.1.57328 WP_003406192.1.57331 WP_003406192.1.57340 WP_003406192.1.57351 WP_003406192.1.57380 WP_003406192.1.57430 WP_003406192.1.5744 WP_003406192.1.57440 WP_003406192.1.5745 WP_003406192.1.57461 WP_003406192.1.57469 WP_003406192.1.57489 WP_003406192.1.575 WP_003406192.1.57509 WP_003406192.1.57525 WP_003406192.1.57551 WP_003406192.1.57596 WP_003406192.1.57604 WP_003406192.1.57619 WP_003406192.1.57627 WP_003406192.1.57642 WP_003406192.1.57658 WP_003406192.1.57667 WP_003406192.1.57675 WP_003406192.1.57689 WP_003406192.1.57708 WP_003406192.1.57794 WP_003406192.1.57821 WP_003406192.1.57825 WP_003406192.1.57843 WP_003406192.1.57906 WP_003406192.1.57924 WP_003406192.1.57926 WP_003406192.1.57957 WP_003406192.1.57960 WP_003406192.1.57964 WP_003406192.1.57991 WP_003406192.1.58086 WP_003406192.1.58103 WP_003406192.1.58108 WP_003406192.1.5811 WP_003406192.1.58121 WP_003406192.1.58145 WP_003406192.1.58164 WP_003406192.1.58174 WP_003406192.1.582 WP_003406192.1.58209 WP_003406192.1.58215 WP_003406192.1.5824 WP_003406192.1.58250 WP_003406192.1.58259 WP_003406192.1.58283 WP_003406192.1.58288 WP_003406192.1.5830 WP_003406192.1.58303 WP_003406192.1.58311 WP_003406192.1.58330 WP_003406192.1.58359 WP_003406192.1.58386 WP_003406192.1.58393 WP_003406192.1.58431 WP_003406192.1.5844 WP_003406192.1.58457 WP_003406192.1.58488 WP_003406192.1.58518 WP_003406192.1.58534 WP_003406192.1.58567 WP_003406192.1.58573 WP_003406192.1.58602 WP_003406192.1.58612 WP_003406192.1.58619 WP_003406192.1.58630 WP_003406192.1.5865 WP_003406192.1.58671 WP_003406192.1.58690 WP_003406192.1.58702 WP_003406192.1.58743 WP_003406192.1.58754 WP_003406192.1.5879 WP_003406192.1.5881 WP_003406192.1.58848 WP_003406192.1.58857 WP_003406192.1.58891 WP_003406192.1.58892 WP_003406192.1.5890 WP_003406192.1.58921 WP_003406192.1.58930 WP_003406192.1.58961 WP_003406192.1.5898 WP_003406192.1.59025 WP_003406192.1.59029 WP_003406192.1.59037 WP_003406192.1.59044 WP_003406192.1.59088 WP_003406192.1.59130 WP_003406192.1.5914 WP_003406192.1.59147 WP_003406192.1.59166 WP_003406192.1.59205 WP_003406192.1.59209 WP_003406192.1.59237 WP_003406192.1.59240 WP_003406192.1.59253 WP_003406192.1.59262 WP_003406192.1.59270 WP_003406192.1.5928 WP_003406192.1.59304 WP_003406192.1.59305 WP_003406192.1.59309 WP_003406192.1.59326 WP_003406192.1.59328 WP_003406192.1.59333 WP_003406192.1.59338 WP_003406192.1.59487 WP_003406192.1.59561 WP_003406192.1.59677 WP_003406192.1.59722 WP_003406192.1.59738 WP_003406192.1.59750 WP_003406192.1.59757 WP_003406192.1.59808 WP_003406192.1.59850 WP_003406192.1.59860 WP_003406192.1.59861 WP_003406192.1.5987 WP_003406192.1.59878 WP_003406192.1.59888 WP_003406192.1.59952 WP_003406192.1.5996 WP_003406192.1.59961 WP_003406192.1.59974 WP_003406192.1.6000 WP_003406192.1.6003 WP_003406192.1.60047 WP_003406192.1.6007 WP_003406192.1.60121 WP_003406192.1.60125 WP_003406192.1.60135 WP_003406192.1.60139 WP_003406192.1.60152 WP_003406192.1.60171 WP_003406192.1.60197 WP_003406192.1.6020 WP_003406192.1.60205 WP_003406192.1.60207 WP_003406192.1.60217 WP_003406192.1.60267 WP_003406192.1.60288 WP_003406192.1.60291 WP_003406192.1.60301 WP_003406192.1.60305 WP_003406192.1.60312 WP_003406192.1.60313 WP_003406192.1.60314 WP_003406192.1.60367 WP_003406192.1.60376 WP_003406192.1.60403 WP_003406192.1.60413 WP_003406192.1.60421 WP_003406192.1.60451 WP_003406192.1.60460 WP_003406192.1.60512 WP_003406192.1.60573 WP_003406192.1.60583 WP_003406192.1.60632 WP_003406192.1.60657 WP_003406192.1.60687 WP_003406192.1.60689 WP_003406192.1.60727 WP_003406192.1.60738 WP_003406192.1.60763 WP_003406192.1.6077 WP_003406192.1.60791 WP_003406192.1.60834 WP_003406192.1.60878 WP_003406192.1.60879 WP_003406192.1.60913 WP_003406192.1.60978 WP_003406192.1.61000 WP_003406192.1.61001 WP_003406192.1.61012 WP_003406192.1.61014 WP_003406192.1.61015 WP_003406192.1.61037 WP_003406192.1.61052 WP_003406192.1.61065 WP_003406192.1.61100 WP_003406192.1.61101 WP_003406192.1.61138 WP_003406192.1.61142 WP_003406192.1.61198 WP_003406192.1.61234 WP_003406192.1.61281 WP_003406192.1.61314 WP_003406192.1.61321 WP_003406192.1.61326 WP_003406192.1.61328 WP_003406192.1.61368 WP_003406192.1.61391 WP_003406192.1.61406 WP_003406192.1.61420 WP_003406192.1.61422 WP_003406192.1.61425 WP_003406192.1.61428 WP_003406192.1.61469 WP_003406192.1.61522 WP_003406192.1.61557 WP_003406192.1.61567 WP_003406192.1.61571 WP_003406192.1.61573 WP_003406192.1.61584 WP_003406192.1.61586 WP_003406192.1.61592 WP_003406192.1.6160 WP_003406192.1.61614 WP_003406192.1.6163 WP_003406192.1.61655 WP_003406192.1.61665 WP_003406192.1.61669 WP_003406192.1.61682 WP_003406192.1.61692 WP_003406192.1.61719 WP_003406192.1.61728 WP_003406192.1.61750 WP_003406192.1.61754 WP_003406192.1.61755 WP_003406192.1.61757 WP_003406192.1.61816 WP_003406192.1.61842 WP_003406192.1.61850 WP_003406192.1.61862 WP_003406192.1.61865 WP_003406192.1.61868 WP_003406192.1.61911 WP_003406192.1.61941 WP_003406192.1.61953 WP_003406192.1.61986 WP_003406192.1.61987 WP_003406192.1.61998 WP_003406192.1.62021 WP_003406192.1.62087 WP_003406192.1.62089 WP_003406192.1.62101 WP_003406192.1.62104 WP_003406192.1.6211 WP_003406192.1.62132 WP_003406192.1.62162 WP_003406192.1.62225 WP_003406192.1.62230 WP_003406192.1.62238 WP_003406192.1.62249 WP_003406192.1.62270 WP_003406192.1.62281 WP_003406192.1.62307 WP_003406192.1.6231 WP_003406192.1.62359 WP_003406192.1.62371 WP_003406192.1.62379 WP_003406192.1.62395 WP_003406192.1.62449 WP_003406192.1.62468 WP_003406192.1.6248 WP_003406192.1.62508 WP_003406192.1.62565 WP_003406192.1.62594 WP_003406192.1.62606 WP_003406192.1.62616 WP_003406192.1.62666 WP_003406192.1.62687 WP_003406192.1.62715 WP_003406192.1.62730 WP_003406192.1.62738 WP_003406192.1.62761 WP_003406192.1.62766 WP_003406192.1.62813 WP_003406192.1.62839 WP_003406192.1.62841 WP_003406192.1.62936 WP_003406192.1.6294 WP_003406192.1.6295 WP_003406192.1.62962 WP_003406192.1.63007 WP_003406192.1.63019 WP_003406192.1.63032 WP_003406192.1.63037 WP_003406192.1.63064 WP_003406192.1.63066 WP_003406192.1.63072 WP_003406192.1.6308 WP_003406192.1.63081 WP_003406192.1.63096 WP_003406192.1.63106 WP_003406192.1.63144 WP_003406192.1.63160 WP_003406192.1.63161 WP_003406192.1.63175 WP_003406192.1.63194 WP_003406192.1.63222 WP_003406192.1.63291 WP_003406192.1.63317 WP_003406192.1.63373 WP_003406192.1.63384 WP_003406192.1.63403 WP_003406192.1.63424 WP_003406192.1.63428 WP_003406192.1.6345 WP_003406192.1.63464 WP_003406192.1.63483 WP_003406192.1.63502 WP_003406192.1.63504 WP_003406192.1.63522 WP_003406192.1.63530 WP_003406192.1.63564 WP_003406192.1.63567 WP_003406192.1.63596 WP_003406192.1.63600 WP_003406192.1.63623 WP_003406192.1.63624 WP_003406192.1.63625 WP_003406192.1.63627 WP_003406192.1.63654 WP_003406192.1.63662 WP_003406192.1.63711 WP_003406192.1.63734 WP_003406192.1.63807 WP_003406192.1.63844 WP_003406192.1.63888 WP_003406192.1.63913 WP_003406192.1.63915 WP_003406192.1.63918 WP_003406192.1.64000 WP_003406192.1.64058 WP_003406192.1.64065 WP_003406192.1.6407 WP_003406192.1.64082 WP_003406192.1.64091 WP_003406192.1.64102 WP_003406192.1.64104 WP_003406192.1.6422 WP_003406192.1.64222 WP_003406192.1.64228 WP_003406192.1.64249 WP_003406192.1.6427 WP_003406192.1.64278 WP_003406192.1.64287 WP_003406192.1.64414 WP_003406192.1.64419 WP_003406192.1.6443 WP_003406192.1.64463 WP_003406192.1.64480 WP_003406192.1.64497 WP_003406192.1.64506 WP_003406192.1.64511 WP_003406192.1.64513 WP_003406192.1.64515 WP_003406192.1.64522 WP_003406192.1.64526 WP_003406192.1.64543 WP_003406192.1.6456 WP_003406192.1.64567 WP_003406192.1.64588 WP_003406192.1.64589 WP_003406192.1.64594 WP_003406192.1.64595 WP_003406192.1.64608 WP_003406192.1.64619 WP_003406192.1.64629 WP_003406192.1.6464 WP_003406192.1.64664 WP_003406192.1.64669 WP_003406192.1.64672 WP_003406192.1.64680 WP_003406192.1.64727 WP_003406192.1.64729 WP_003406192.1.64776 WP_003406192.1.64832 WP_003406192.1.6486 WP_003406192.1.64870 WP_003406192.1.64898 WP_003406192.1.64922 WP_003406192.1.64924 WP_003406192.1.6493 WP_003406192.1.64941 WP_003406192.1.64973 WP_003406192.1.65001 WP_003406192.1.65026 WP_003406192.1.65070 WP_003406192.1.65079 WP_003406192.1.65102 WP_003406192.1.65157 WP_003406192.1.65181 WP_003406192.1.65212 WP_003406192.1.65229 WP_003406192.1.6523 WP_003406192.1.65253 WP_003406192.1.65289 WP_003406192.1.65291 WP_003406192.1.65329 WP_003406192.1.65359 WP_003406192.1.6536 WP_003406192.1.65374 WP_003406192.1.65414 WP_003406192.1.65416 WP_003406192.1.65433 WP_003406192.1.65455 WP_003406192.1.65488 WP_003406192.1.65529 WP_003406192.1.65539 WP_003406192.1.65583 WP_003406192.1.65612 WP_003406192.1.65623 WP_003406192.1.65637 WP_003406192.1.65648 WP_003406192.1.65683 WP_003406192.1.65686 WP_003406192.1.65688 WP_003406192.1.65707 WP_003406192.1.65733 WP_003406192.1.65747 WP_003406192.1.65759 WP_003406192.1.65816 WP_003406192.1.65830 WP_003406192.1.65858 WP_003406192.1.65862 WP_003406192.1.65869 WP_003406192.1.65893 WP_003406192.1.65929 WP_003406192.1.65958 WP_003406192.1.65974 WP_003406192.1.66004 WP_003406192.1.6606 WP_003406192.1.66089 WP_003406192.1.66149 WP_003406192.1.66276 WP_003406192.1.66293 WP_003406192.1.66297 WP_003406192.1.66323 WP_003406192.1.66325 WP_003406192.1.6633 WP_003406192.1.66334 WP_003406192.1.66355 WP_003406192.1.66367 WP_003406192.1.66394 WP_003406192.1.66396 WP_003406192.1.66451 WP_003406192.1.66455 WP_003406192.1.66457 WP_003406192.1.66464 WP_003406192.1.66466 WP_003406192.1.66487 WP_003406192.1.66504 WP_003406192.1.66544 WP_003406192.1.66580 WP_003406192.1.66582 WP_003406192.1.66612 WP_003406192.1.66617 WP_003406192.1.66635 WP_003406192.1.66656 WP_003406192.1.66663 WP_003406192.1.66675 WP_003406192.1.66718 WP_003406192.1.66762 WP_003406192.1.66776 WP_003406192.1.66808 WP_003406192.1.66817 WP_003406192.1.66819 WP_003406192.1.66826 WP_003406192.1.66830 WP_003406192.1.66842 WP_003406192.1.66868 WP_003406192.1.66878 WP_003406192.1.66880 WP_003406192.1.66893 WP_003406192.1.66961 WP_003406192.1.67005 WP_003406192.1.6704 WP_003406192.1.67044 WP_003406192.1.67061 WP_003406192.1.67098 WP_003406192.1.67146 WP_003406192.1.67197 WP_003406192.1.67198 WP_003406192.1.6720 WP_003406192.1.67207 WP_003406192.1.67218 WP_003406192.1.67220 WP_003406192.1.67225 WP_003406192.1.67231 WP_003406192.1.6724 WP_003406192.1.67257 WP_003406192.1.67307 WP_003406192.1.67324 WP_003406192.1.67332 WP_003406192.1.67346 WP_003406192.1.67360 WP_003406192.1.67381 WP_003406192.1.67396 WP_003406192.1.67417 WP_003406192.1.67422 WP_003406192.1.67453 WP_003406192.1.67459 WP_003406192.1.6746 WP_003406192.1.67473 WP_003406192.1.67482 WP_003406192.1.67496 WP_003406192.1.67499 WP_003406192.1.67523 WP_003406192.1.67536 WP_003406192.1.67575 WP_003406192.1.67587 WP_003406192.1.67598 WP_003406192.1.67600 WP_003406192.1.67602 WP_003406192.1.67630 WP_003406192.1.67692 WP_003406192.1.67744 WP_003406192.1.6775 WP_003406192.1.6777 WP_003406192.1.67809 WP_003406192.1.67816 WP_003406192.1.67844 WP_003406192.1.67848 WP_003406192.1.67870 WP_003406192.1.67888 WP_003406192.1.67915 WP_003406192.1.67945 WP_003406192.1.67949 WP_003406192.1.67980 WP_003406192.1.67982 WP_003406192.1.68022 WP_003406192.1.68029 WP_003406192.1.68037 WP_003406192.1.68038 WP_003406192.1.68045 WP_003406192.1.68057 WP_003406192.1.68083 WP_003406192.1.68088 WP_003406192.1.68106 WP_003406192.1.68110 WP_003406192.1.68169 WP_003406192.1.68193 WP_003406192.1.68212 WP_003406192.1.68227 WP_003406192.1.68243 WP_003406192.1.6825 WP_003406192.1.68297 WP_003406192.1.68309 WP_003406192.1.68325 WP_003406192.1.68329 WP_003406192.1.68340 WP_003406192.1.68384 WP_003406192.1.68388 WP_003406192.1.68429 WP_003406192.1.6843 WP_003406192.1.68433 WP_003406192.1.68444 WP_003406192.1.68465 WP_003406192.1.68518 WP_003406192.1.68569 WP_003406192.1.68576 WP_003406192.1.68580 WP_003406192.1.68586 WP_003406192.1.68623 WP_003406192.1.68637 WP_003406192.1.68646 WP_003406192.1.68667 WP_003406192.1.68669 WP_003406192.1.68672 WP_003406192.1.68684 WP_003406192.1.68704 WP_003406192.1.68708 WP_003406192.1.6872 WP_003406192.1.68730 WP_003406192.1.68734 WP_003406192.1.68748 WP_003406192.1.68754 WP_003406192.1.6876 WP_003406192.1.68761 WP_003406192.1.68763 WP_003406192.1.68766 WP_003406192.1.68774 WP_003406192.1.68796 WP_003406192.1.68824 WP_003406192.1.68832 WP_003406192.1.68833 WP_003406192.1.68841 WP_003406192.1.68859 WP_003406192.1.68876 WP_003406192.1.68906 WP_003406192.1.68916 WP_003406192.1.68923 WP_003406192.1.68945 WP_003406192.1.6896 WP_003406192.1.68981 WP_003406192.1.68984 WP_003406192.1.68997 WP_003406192.1.69076 WP_003406192.1.69079 WP_003406192.1.6908 WP_003406192.1.69082 WP_003406192.1.69178 WP_003406192.1.69208 WP_003406192.1.69231 WP_003406192.1.69256 WP_003406192.1.69311 WP_003406192.1.69315 WP_003406192.1.69322 WP_003406192.1.69342 WP_003406192.1.6936 WP_003406192.1.69369 WP_003406192.1.69374 WP_003406192.1.69398 WP_003406192.1.69401 WP_003406192.1.69426 WP_003406192.1.69427 WP_003406192.1.69429 WP_003406192.1.6949 WP_003406192.1.6951 WP_003406192.1.69511 WP_003406192.1.69526 WP_003406192.1.69528 WP_003406192.1.69547 WP_003406192.1.69573 WP_003406192.1.69581 WP_003406192.1.6960 WP_003406192.1.69617 WP_003406192.1.69634 WP_003406192.1.69647 WP_003406192.1.69659 WP_003406192.1.69673 WP_003406192.1.69682 WP_003406192.1.69684 WP_003406192.1.69686 WP_003406192.1.69707 WP_003406192.1.69709 WP_003406192.1.69723 WP_003406192.1.69736 WP_003406192.1.69778 WP_003406192.1.69800 WP_003406192.1.69802 WP_003406192.1.69845 WP_003406192.1.69870 WP_003406192.1.69873 WP_003406192.1.69898 WP_003406192.1.69913 WP_003406192.1.69931 WP_003406192.1.69938 WP_003406192.1.69955 WP_003406192.1.69981 WP_003406192.1.69990 WP_003406192.1.70 WP_003406192.1.70000 WP_003406192.1.70017 WP_003406192.1.70055 WP_003406192.1.70062 WP_003406192.1.70072 WP_003406192.1.70131 WP_003406192.1.70132 WP_003406192.1.7022 WP_003406192.1.70227 WP_003406192.1.70255 WP_003406192.1.70271 WP_003406192.1.7029 WP_003406192.1.70325 WP_003406192.1.70356 WP_003406192.1.70364 WP_003406192.1.70368 WP_003406192.1.70369 WP_003406192.1.70422 WP_003406192.1.70435 WP_003406192.1.70444 WP_003406192.1.70463 WP_003406192.1.70471 WP_003406192.1.70480 WP_003406192.1.70494 WP_003406192.1.70498 WP_003406192.1.70525 WP_003406192.1.70573 WP_003406192.1.70577 WP_003406192.1.70610 WP_003406192.1.70618 WP_003406192.1.70622 WP_003406192.1.70626 WP_003406192.1.70668 WP_003406192.1.70699 WP_003406192.1.70704 WP_003406192.1.70729 WP_003406192.1.70757 WP_003406192.1.70782 WP_003406192.1.70796 WP_003406192.1.70830 WP_003406192.1.70834 WP_003406192.1.7084 WP_003406192.1.70840 WP_003406192.1.70864 WP_003406192.1.70871 WP_003406192.1.70915 WP_003406192.1.70958 WP_003406192.1.70964 WP_003406192.1.70976 WP_003406192.1.71015 WP_003406192.1.71063 WP_003406192.1.71076 WP_003406192.1.71083 WP_003406192.1.7111 WP_003406192.1.71118 WP_003406192.1.7113 WP_003406192.1.71187 WP_003406192.1.71191 WP_003406192.1.71255 WP_003406192.1.71258 WP_003406192.1.71259 WP_003406192.1.71289 WP_003406192.1.71326 WP_003406192.1.71329 WP_003406192.1.71331 WP_003406192.1.71344 WP_003406192.1.71390 WP_003406192.1.71414 WP_003406192.1.71440 WP_003406192.1.71457 WP_003406192.1.71464 WP_003406192.1.71490 WP_003406192.1.71492 WP_003406192.1.71509 WP_003406192.1.71516 WP_003406192.1.71517 WP_003406192.1.71527 WP_003406192.1.71532 WP_003406192.1.71545 WP_003406192.1.71546 WP_003406192.1.71604 WP_003406192.1.71630 WP_003406192.1.71638 WP_003406192.1.71654 WP_003406192.1.71664 WP_003406192.1.71665 WP_003406192.1.71683 WP_003406192.1.71701 WP_003406192.1.71718 WP_003406192.1.71731 WP_003406192.1.71778 WP_003406192.1.71781 WP_003406192.1.71803 WP_003406192.1.71847 WP_003406192.1.7185 WP_003406192.1.71851 WP_003406192.1.71871 WP_003406192.1.71909 WP_003406192.1.71957 WP_003406192.1.71970 WP_003406192.1.72047 WP_003406192.1.72061 WP_003406192.1.72062 WP_003406192.1.72072 WP_003406192.1.72111 WP_003406192.1.72122 WP_003406192.1.72143 WP_003406192.1.72168 WP_003406192.1.72179 WP_003406192.1.72209 WP_003406192.1.72227 WP_003406192.1.7224 WP_003406192.1.72268 WP_003406192.1.72332 WP_003406192.1.72380 WP_003406192.1.72401 WP_003406192.1.72405 WP_003406192.1.72420 WP_003406192.1.72441 WP_003406192.1.72452 WP_003406192.1.72457 WP_003406192.1.72459 WP_003406192.1.72460 WP_003406192.1.72466 WP_003406192.1.72487 WP_003406192.1.72488 WP_003406192.1.72492 WP_003406192.1.72506 WP_003406192.1.72543 WP_003406192.1.7256 WP_003406192.1.72576 WP_003406192.1.72578 WP_003406192.1.72585 WP_003406192.1.72591 WP_003406192.1.72592 WP_003406192.1.72661 WP_003406192.1.72739 WP_003406192.1.72744 WP_003406192.1.72755 WP_003406192.1.72759 WP_003406192.1.72784 WP_003406192.1.72792 WP_003406192.1.72826 WP_003406192.1.72831 WP_003406192.1.72852 WP_003406192.1.72853 WP_003406192.1.72879 WP_003406192.1.72938 WP_003406192.1.72954 WP_003406192.1.72957 WP_003406192.1.72959 WP_003406192.1.72982 WP_003406192.1.72988 WP_003406192.1.72993 WP_003406192.1.73006 WP_003406192.1.73013 WP_003406192.1.73028 WP_003406192.1.73042 WP_003406192.1.73045 WP_003406192.1.73092 WP_003406192.1.73118 WP_003406192.1.7312 WP_003406192.1.73127 WP_003406192.1.73134 WP_003406192.1.73154 WP_003406192.1.73163 WP_003406192.1.73182 WP_003406192.1.73205 WP_003406192.1.7321 WP_003406192.1.73310 WP_003406192.1.73365 WP_003406192.1.73391 WP_003406192.1.73404 WP_003406192.1.73424 WP_003406192.1.73445 WP_003406192.1.73453 WP_003406192.1.73465 WP_003406192.1.73466 WP_003406192.1.73470 WP_003406192.1.73471 WP_003406192.1.73507 WP_003406192.1.73550 WP_003406192.1.73564 WP_003406192.1.73623 WP_003406192.1.73629 WP_003406192.1.73661 WP_003406192.1.7368 WP_003406192.1.73688 WP_003406192.1.73723 WP_003406192.1.73744 WP_003406192.1.73750 WP_003406192.1.73760 WP_003406192.1.73774 WP_003406192.1.7379 WP_003406192.1.73813 WP_003406192.1.73840 WP_003406192.1.73876 WP_003406192.1.7389 WP_003406192.1.74016 WP_003406192.1.74039 WP_003406192.1.74083 WP_003406192.1.74101 WP_003406192.1.74107 WP_003406192.1.74129 WP_003406192.1.74144 WP_003406192.1.7417 WP_003406192.1.74190 WP_003406192.1.74210 WP_003406192.1.7423 WP_003406192.1.74262 WP_003406192.1.74269 WP_003406192.1.74282 WP_003406192.1.74291 WP_003406192.1.74296 WP_003406192.1.74304 WP_003406192.1.7432 WP_003406192.1.74347 WP_003406192.1.7436 WP_003406192.1.74378 WP_003406192.1.74382 WP_003406192.1.74400 WP_003406192.1.74442 WP_003406192.1.74487 WP_003406192.1.74499 WP_003406192.1.74504 WP_003406192.1.74511 WP_003406192.1.74523 WP_003406192.1.74525 WP_003406192.1.74551 WP_003406192.1.74555 WP_003406192.1.74628 WP_003406192.1.74641 WP_003406192.1.74660 WP_003406192.1.74683 WP_003406192.1.7469 WP_003406192.1.74725 WP_003406192.1.74760 WP_003406192.1.74809 WP_003406192.1.74820 WP_003406192.1.74870 WP_003406192.1.74881 WP_003406192.1.74888 WP_003406192.1.74952 WP_003406192.1.7496 WP_003406192.1.74988 WP_003406192.1.75043 WP_003406192.1.75055 WP_003406192.1.75078 WP_003406192.1.75081 WP_003406192.1.75120 WP_003406192.1.75163 WP_003406192.1.75200 WP_003406192.1.75202 WP_003406192.1.75234 WP_003406192.1.75239 WP_003406192.1.75263 WP_003406192.1.75342 WP_003406192.1.7535 WP_003406192.1.75376 WP_003406192.1.75391 WP_003406192.1.75395 WP_003406192.1.75441 WP_003406192.1.75510 WP_003406192.1.75581 WP_003406192.1.75598 WP_003406192.1.75635 WP_003406192.1.75665 WP_003406192.1.75671 WP_003406192.1.75741 WP_003406192.1.75749 WP_003406192.1.75772 WP_003406192.1.75774 WP_003406192.1.75833 WP_003406192.1.7585 WP_003406192.1.75868 WP_003406192.1.75878 WP_003406192.1.75927 WP_003406192.1.75968 WP_003406192.1.75974 WP_003406192.1.76016 WP_003406192.1.76032 WP_003406192.1.76037 WP_003406192.1.7604 WP_003406192.1.76045 WP_003406192.1.76052 WP_003406192.1.76058 WP_003406192.1.76064 WP_003406192.1.76110 WP_003406192.1.76126 WP_003406192.1.76138 WP_003406192.1.76157 WP_003406192.1.76172 WP_003406192.1.76177 WP_003406192.1.76209 WP_003406192.1.76272 WP_003406192.1.76277 WP_003406192.1.76281 WP_003406192.1.76291 WP_003406192.1.76297 WP_003406192.1.76379 WP_003406192.1.76403 WP_003406192.1.76414 WP_003406192.1.76427 WP_003406192.1.76436 WP_003406192.1.76442 WP_003406192.1.76443 WP_003406192.1.76456 WP_003406192.1.76533 WP_003406192.1.76616 WP_003406192.1.76625 WP_003406192.1.76629 WP_003406192.1.76635 WP_003406192.1.76638 WP_003406192.1.76640 WP_003406192.1.76644 WP_003406192.1.76677 WP_003406192.1.76678 WP_003406192.1.76734 WP_003406192.1.76744 WP_003406192.1.76750 WP_003406192.1.76754 WP_003406192.1.76757 WP_003406192.1.76781 WP_003406192.1.76818 WP_003406192.1.76824 WP_003406192.1.76835 WP_003406192.1.76873 WP_003406192.1.76888 WP_003406192.1.76900 WP_003406192.1.76947 WP_003406192.1.76954 WP_003406192.1.76955 WP_003406192.1.76963 WP_003406192.1.770 WP_003406192.1.77000 WP_003406192.1.77008 WP_003406192.1.77021 WP_003406192.1.77056 WP_003406192.1.77065 WP_003406192.1.77075 WP_003406192.1.77107 WP_003406192.1.77115 WP_003406192.1.77118 WP_003406192.1.77125 WP_003406192.1.77142 WP_003406192.1.77250 WP_003406192.1.77260 WP_003406192.1.77266 WP_003406192.1.77285 WP_003406192.1.77312 WP_003406192.1.77348 WP_003406192.1.77352 WP_003406192.1.77361 WP_003406192.1.774 WP_003406192.1.77404 WP_003406192.1.77425 WP_003406192.1.77463 WP_003406192.1.77474 WP_003406192.1.7748 WP_003406192.1.77484 WP_003406192.1.77491 WP_003406192.1.77499 WP_003406192.1.77510 WP_003406192.1.77530 WP_003406192.1.77554 WP_003406192.1.77599 WP_003406192.1.7762 WP_003406192.1.77649 WP_003406192.1.77654 WP_003406192.1.7766 WP_003406192.1.77667 WP_003406192.1.77704 WP_003406192.1.77706 WP_003406192.1.77774 WP_003406192.1.7778 WP_003406192.1.77790 WP_003406192.1.77809 WP_003406192.1.77820 WP_003406192.1.77843 WP_003406192.1.77855 WP_003406192.1.77865 WP_003406192.1.77868 WP_003406192.1.77890 WP_003406192.1.77909 WP_003406192.1.77911 WP_003406192.1.77931 WP_003406192.1.77984 WP_003406192.1.78020 WP_003406192.1.78024 WP_003406192.1.78075 WP_003406192.1.78086 WP_003406192.1.78098 WP_003406192.1.78105 WP_003406192.1.78113 WP_003406192.1.78136 WP_003406192.1.78162 WP_003406192.1.7817 WP_003406192.1.78200 WP_003406192.1.78216 WP_003406192.1.78236 WP_003406192.1.78238 WP_003406192.1.78322 WP_003406192.1.78338 WP_003406192.1.7836 WP_003406192.1.78360 WP_003406192.1.78386 WP_003406192.1.78435 WP_003406192.1.7844 WP_003406192.1.78459 WP_003406192.1.78488 WP_003406192.1.7849 WP_003406192.1.78499 WP_003406192.1.785 WP_003406192.1.78516 WP_003406192.1.78524 WP_003406192.1.78526 WP_003406192.1.78538 WP_003406192.1.78545 WP_003406192.1.78547 WP_003406192.1.78574 WP_003406192.1.78580 WP_003406192.1.7860 WP_003406192.1.78620 WP_003406192.1.78646 WP_003406192.1.78648 WP_003406192.1.78649 WP_003406192.1.78655 WP_003406192.1.78657 WP_003406192.1.78659 WP_003406192.1.7869 WP_003406192.1.78692 WP_003406192.1.78760 WP_003406192.1.78766 WP_003406192.1.78776 WP_003406192.1.78778 WP_003406192.1.78784 WP_003406192.1.78788 WP_003406192.1.78790 WP_003406192.1.78860 WP_003406192.1.7887 WP_003406192.1.78932 WP_003406192.1.78969 WP_003406192.1.78977 WP_003406192.1.78980 WP_003406192.1.79005 WP_003406192.1.79016 WP_003406192.1.79064 WP_003406192.1.79066 WP_003406192.1.79068 WP_003406192.1.79095 WP_003406192.1.79112 WP_003406192.1.79145 WP_003406192.1.79152 WP_003406192.1.79163 WP_003406192.1.79182 WP_003406192.1.79213 WP_003406192.1.79218 WP_003406192.1.79268 WP_003406192.1.79278 WP_003406192.1.79290 WP_003406192.1.79319 WP_003406192.1.79326 WP_003406192.1.7933 WP_003406192.1.79330 WP_003406192.1.79339 WP_003406192.1.79394 WP_003406192.1.79399 WP_003406192.1.79413 WP_003406192.1.79422 WP_003406192.1.79445 WP_003406192.1.79447 WP_003406192.1.79455 WP_003406192.1.79471 WP_003406192.1.79480 WP_003406192.1.79482 WP_003406192.1.79488 WP_003406192.1.79500 WP_003406192.1.79502 WP_003406192.1.79508 WP_003406192.1.79514 WP_003406192.1.79561 WP_003406192.1.79565 WP_003406192.1.79578 WP_003406192.1.79588 WP_003406192.1.79598 WP_003406192.1.79615 WP_003406192.1.79684 WP_003406192.1.79698 WP_003406192.1.797 WP_003406192.1.79744 WP_003406192.1.79784 WP_003406192.1.79819 WP_003406192.1.79826 WP_003406192.1.79828 WP_003406192.1.79851 WP_003406192.1.79853 WP_003406192.1.79863 WP_003406192.1.79881 WP_003406192.1.79885 WP_003406192.1.79898 WP_003406192.1.7990 WP_003406192.1.79900 WP_003406192.1.79913 WP_003406192.1.79918 WP_003406192.1.79947 WP_003406192.1.79948 WP_003406192.1.7995 WP_003406192.1.7997 WP_003406192.1.80004 WP_003406192.1.80022 WP_003406192.1.80030 WP_003406192.1.80054 WP_003406192.1.80084 WP_003406192.1.80129 WP_003406192.1.80177 WP_003406192.1.8026 WP_003406192.1.80275 WP_003406192.1.8029 WP_003406192.1.80304 WP_003406192.1.80326 WP_003406192.1.8037 WP_003406192.1.80370 WP_003406192.1.8044 WP_003406192.1.80451 WP_003406192.1.80458 WP_003406192.1.80461 WP_003406192.1.80490 WP_003406192.1.80503 WP_003406192.1.80507 WP_003406192.1.80576 WP_003406192.1.80599 WP_003406192.1.8060 WP_003406192.1.80624 WP_003406192.1.80636 WP_003406192.1.80673 WP_003406192.1.80711 WP_003406192.1.80714 WP_003406192.1.80743 WP_003406192.1.80784 WP_003406192.1.80815 WP_003406192.1.80853 WP_003406192.1.80918 WP_003406192.1.8093 WP_003406192.1.80967 WP_003406192.1.8097 WP_003406192.1.80988 WP_003406192.1.81007 WP_003406192.1.81013 WP_003406192.1.8105 WP_003406192.1.81059 WP_003406192.1.81063 WP_003406192.1.81075 WP_003406192.1.81091 WP_003406192.1.81119 WP_003406192.1.81125 WP_003406192.1.81136 WP_003406192.1.8114 WP_003406192.1.81189 WP_003406192.1.81192 WP_003406192.1.812 WP_003406192.1.81230 WP_003406192.1.81249 WP_003406192.1.81250 WP_003406192.1.8128 WP_003406192.1.81297 WP_003406192.1.8138 WP_003406192.1.81407 WP_003406192.1.8143 WP_003406192.1.81465 WP_003406192.1.81529 WP_003406192.1.81538 WP_003406192.1.81541 WP_003406192.1.81560 WP_003406192.1.81561 WP_003406192.1.81583 WP_003406192.1.81686 WP_003406192.1.81712 WP_003406192.1.81720 WP_003406192.1.81731 WP_003406192.1.81774 WP_003406192.1.81788 WP_003406192.1.81820 WP_003406192.1.81850 WP_003406192.1.81883 WP_003406192.1.81891 WP_003406192.1.81911 WP_003406192.1.81918 WP_003406192.1.82011 WP_003406192.1.82048 WP_003406192.1.82069 WP_003406192.1.82071 WP_003406192.1.82108 WP_003406192.1.82136 WP_003406192.1.82142 WP_003406192.1.8215 WP_003406192.1.82158 WP_003406192.1.82209 WP_003406192.1.82210 WP_003406192.1.82228 WP_003406192.1.82236 WP_003406192.1.82251 WP_003406192.1.82271 WP_003406192.1.82305 WP_003406192.1.82307 WP_003406192.1.82317 WP_003406192.1.8232 WP_003406192.1.82346 WP_003406192.1.82374 WP_003406192.1.82429 WP_003406192.1.82460 WP_003406192.1.82483 WP_003406192.1.82494 WP_003406192.1.82531 WP_003406192.1.82546 WP_003406192.1.82549 WP_003406192.1.82577 WP_003406192.1.82592 WP_003406192.1.82597 WP_003406192.1.82598 WP_003406192.1.82625 WP_003406192.1.82642 WP_003406192.1.82651 WP_003406192.1.82653 WP_003406192.1.82685 WP_003406192.1.8271 WP_003406192.1.82712 WP_003406192.1.8273 WP_003406192.1.82757 WP_003406192.1.82774 WP_003406192.1.82803 WP_003406192.1.82860 WP_003406192.1.82871 WP_003406192.1.82892 WP_003406192.1.82935 WP_003406192.1.82957 WP_003406192.1.82981 WP_003406192.1.82983 WP_003406192.1.83004 WP_003406192.1.83009 WP_003406192.1.83044 WP_003406192.1.83074 WP_003406192.1.83146 WP_003406192.1.83149 WP_003406192.1.83159 WP_003406192.1.8317 WP_003406192.1.83173 WP_003406192.1.83181 WP_003406192.1.83182 WP_003406192.1.83191 WP_003406192.1.83197 WP_003406192.1.83212 WP_003406192.1.8326 WP_003406192.1.83262 WP_003406192.1.83273 WP_003406192.1.83309 WP_003406192.1.83332 WP_003406192.1.83334 WP_003406192.1.83341 WP_003406192.1.83349 WP_003406192.1.8335 WP_003406192.1.83353 WP_003406192.1.83367 WP_003406192.1.83380 WP_003406192.1.83381 WP_003406192.1.83389 WP_003406192.1.83408 WP_003406192.1.83409 WP_003406192.1.83435 WP_003406192.1.83470 WP_003406192.1.83524 WP_003406192.1.83526 WP_003406192.1.8358 WP_003406192.1.83601 WP_003406192.1.83611 WP_003406192.1.83638 WP_003406192.1.83656 WP_003406192.1.83667 WP_003406192.1.83689 WP_003406192.1.83692 WP_003406192.1.83705 WP_003406192.1.83766 WP_003406192.1.83793 WP_003406192.1.83794 WP_003406192.1.83802 WP_003406192.1.83805 WP_003406192.1.83839 WP_003406192.1.83842 WP_003406192.1.83850 WP_003406192.1.83861 WP_003406192.1.83884 WP_003406192.1.83920 WP_003406192.1.83929 WP_003406192.1.83975 WP_003406192.1.83991 WP_003406192.1.8400 WP_003406192.1.84027 WP_003406192.1.8404 WP_003406192.1.84057 WP_003406192.1.84070 WP_003406192.1.8409 WP_003406192.1.84112 WP_003406192.1.84146 WP_003406192.1.8415 WP_003406192.1.84176 WP_003406192.1.84192 WP_003406192.1.8424 WP_003406192.1.84244 WP_003406192.1.84259 WP_003406192.1.8426 WP_003406192.1.84277 WP_003406192.1.84287 WP_003406192.1.8434 WP_003406192.1.84388 WP_003406192.1.84409 WP_003406192.1.84438 WP_003406192.1.84460 WP_003406192.1.84488 WP_003406192.1.84504 WP_003406192.1.84620 WP_003406192.1.84623 WP_003406192.1.84641 WP_003406192.1.84655 WP_003406192.1.84666 WP_003406192.1.84739 WP_003406192.1.84748 WP_003406192.1.84766 WP_003406192.1.84774 WP_003406192.1.848 WP_003406192.1.84812 WP_003406192.1.84836 WP_003406192.1.84839 WP_003406192.1.84846 WP_003406192.1.84873 WP_003406192.1.84938 WP_003406192.1.84968 WP_003406192.1.84973 WP_003406192.1.84981 WP_003406192.1.84985 WP_003406192.1.8503 WP_003406192.1.85038 WP_003406192.1.8505 WP_003406192.1.85074 WP_003406192.1.85148 WP_003406192.1.8518 WP_003406192.1.8522 WP_003406192.1.85242 WP_003406192.1.85276 WP_003406192.1.85281 WP_003406192.1.85284 WP_003406192.1.85314 WP_003406192.1.85319 WP_003406192.1.85330 WP_003406192.1.85341 WP_003406192.1.8535 WP_003406192.1.85363 WP_003406192.1.85371 WP_003406192.1.85377 WP_003406192.1.85387 WP_003406192.1.85458 WP_003406192.1.8546 WP_003406192.1.85478 WP_003406192.1.85480 WP_003406192.1.85488 WP_003406192.1.85495 WP_003406192.1.85551 WP_003406192.1.85557 WP_003406192.1.85577 WP_003406192.1.85599 WP_003406192.1.85610 WP_003406192.1.8563 WP_003406192.1.85648 WP_003406192.1.85679 WP_003406192.1.85704 WP_003406192.1.85737 WP_003406192.1.85763 WP_003406192.1.85808 WP_003406192.1.85820 WP_003406192.1.85823 WP_003406192.1.85832 WP_003406192.1.8586 WP_003406192.1.85872 WP_003406192.1.85894 WP_003406192.1.85913 WP_003406192.1.85953 WP_003406192.1.85986 WP_003406192.1.86000 WP_003406192.1.86025 WP_003406192.1.86032 WP_003406192.1.86048 WP_003406192.1.86052 WP_003406192.1.86067 WP_003406192.1.86103 WP_003406192.1.86122 WP_003406192.1.86124 WP_003406192.1.86160 WP_003406192.1.86164 WP_003406192.1.86168 WP_003406192.1.86190 WP_003406192.1.86204 WP_003406192.1.86208 WP_003406192.1.86235 WP_003406192.1.86249 WP_003406192.1.86260 WP_003406192.1.86290 WP_003406192.1.863 WP_003406192.1.86327 WP_003406192.1.86334 WP_003406192.1.86337 WP_003406192.1.86368 WP_003406192.1.86377 WP_003406192.1.86425 WP_003406192.1.86459 WP_003406192.1.8649 WP_003406192.1.86499 WP_003406192.1.86520 WP_003406192.1.86561 WP_003406192.1.86568 WP_003406192.1.86575 WP_003406192.1.86584 WP_003406192.1.86605 WP_003406192.1.86626 WP_003406192.1.86648 WP_003406192.1.86684 WP_003406192.1.86696 WP_003406192.1.86705 WP_003406192.1.86718 WP_003406192.1.86757 WP_003406192.1.86766 WP_003406192.1.86801 WP_003406192.1.86814 WP_003406192.1.86820 WP_003406192.1.86825 WP_003406192.1.86834 WP_003406192.1.8685 WP_003406192.1.86851 WP_003406192.1.86855 WP_003406192.1.86867 WP_003406192.1.86877 WP_003406192.1.86883 WP_003406192.1.8689 WP_003406192.1.86892 WP_003406192.1.86933 WP_003406192.1.86941 WP_003406192.1.86950 WP_003406192.1.86962 WP_003406192.1.86979 WP_003406192.1.8700 WP_003406192.1.87002 WP_003406192.1.87031 WP_003406192.1.87116 WP_003406192.1.87117 WP_003406192.1.8714 WP_003406192.1.87191 WP_003406192.1.87201 WP_003406192.1.87209 WP_003406192.1.87240 WP_003406192.1.87266 WP_003406192.1.87273 WP_003406192.1.87275 WP_003406192.1.8733 WP_003406192.1.87345 WP_003406192.1.8737 WP_003406192.1.87401 WP_003406192.1.87444 WP_003406192.1.87446 WP_003406192.1.87459 WP_003406192.1.87472 WP_003406192.1.87489 WP_003406192.1.87494 WP_003406192.1.87496 WP_003406192.1.87582 WP_003406192.1.87588 WP_003406192.1.87619 WP_003406192.1.87620 WP_003406192.1.87634 WP_003406192.1.87643 WP_003406192.1.8765 WP_003406192.1.87650 WP_003406192.1.87654 WP_003406192.1.87658 WP_003406192.1.87665 WP_003406192.1.87676 WP_003406192.1.87677 WP_003406192.1.87684 WP_003406192.1.87692 WP_003406192.1.87707 WP_003406192.1.87732 WP_003406192.1.87784 WP_003406192.1.87796 WP_003406192.1.87809 WP_003406192.1.87817 WP_003406192.1.87827 WP_003406192.1.87831 WP_003406192.1.87835 WP_003406192.1.87837 WP_003406192.1.87866 WP_003406192.1.8789 WP_003406192.1.87911 WP_003406192.1.87924 WP_003406192.1.87951 WP_003406192.1.87956 WP_003406192.1.87991 WP_003406192.1.88 WP_003406192.1.88002 WP_003406192.1.88037 WP_003406192.1.88039 WP_003406192.1.88072 WP_003406192.1.88077 WP_003406192.1.88121 WP_003406192.1.88191 WP_003406192.1.88205 WP_003406192.1.88217 WP_003406192.1.88219 WP_003406192.1.88245 WP_003406192.1.88253 WP_003406192.1.88294 WP_003406192.1.88315 WP_003406192.1.88316 WP_003406192.1.88320 WP_003406192.1.88338 WP_003406192.1.8840 WP_003406192.1.88437 WP_003406192.1.88453 WP_003406192.1.88469 WP_003406192.1.88489 WP_003406192.1.88530 WP_003406192.1.88541 WP_003406192.1.88592 WP_003406192.1.88616 WP_003406192.1.8862 WP_003406192.1.88625 WP_003406192.1.88632 WP_003406192.1.88634 WP_003406192.1.88649 WP_003406192.1.8870 WP_003406192.1.88737 WP_003406192.1.888 WP_003406192.1.88824 WP_003406192.1.88886 WP_003406192.1.88965 WP_003406192.1.88985 WP_003406192.1.8902 WP_003406192.1.89025 WP_003406192.1.89041 WP_003406192.1.89046 WP_003406192.1.89082 WP_003406192.1.89162 WP_003406192.1.89168 WP_003406192.1.8917 WP_003406192.1.89205 WP_003406192.1.89225 WP_003406192.1.8925 WP_003406192.1.89277 WP_003406192.1.89286 WP_003406192.1.89293 WP_003406192.1.89320 WP_003406192.1.8935 WP_003406192.1.89371 WP_003406192.1.89378 WP_003406192.1.89392 WP_003406192.1.89406 WP_003406192.1.89451 WP_003406192.1.89453 WP_003406192.1.89475 WP_003406192.1.89483 WP_003406192.1.895 WP_003406192.1.89513 WP_003406192.1.89517 WP_003406192.1.89522 WP_003406192.1.8954 WP_003406192.1.89543 WP_003406192.1.8957 WP_003406192.1.89572 WP_003406192.1.89589 WP_003406192.1.89607 WP_003406192.1.89613 WP_003406192.1.89625 WP_003406192.1.89648 WP_003406192.1.8967 WP_003406192.1.89670 WP_003406192.1.89676 WP_003406192.1.89729 WP_003406192.1.89739 WP_003406192.1.89762 WP_003406192.1.8977 WP_003406192.1.89808 WP_003406192.1.8982 WP_003406192.1.89829 WP_003406192.1.89831 WP_003406192.1.89844 WP_003406192.1.89849 WP_003406192.1.8989 WP_003406192.1.89903 WP_003406192.1.89909 WP_003406192.1.89922 WP_003406192.1.89926 WP_003406192.1.89971 WP_003406192.1.8998 WP_003406192.1.89987 WP_003406192.1.900 WP_003406192.1.90048 WP_003406192.1.9007 WP_003406192.1.90080 WP_003406192.1.90130 WP_003406192.1.90134 WP_003406192.1.90137 WP_003406192.1.90157 WP_003406192.1.90184 WP_003406192.1.90199 WP_003406192.1.90231 WP_003406192.1.90245 WP_003406192.1.90308 WP_003406192.1.90322 WP_003406192.1.90372 WP_003406192.1.90481 WP_003406192.1.90499 WP_003406192.1.9050 WP_003406192.1.90527 WP_003406192.1.90550 WP_003406192.1.90560 WP_003406192.1.90612 WP_003406192.1.90640 WP_003406192.1.90672 WP_003406192.1.90691 WP_003406192.1.90711 WP_003406192.1.90722 WP_003406192.1.9075 WP_003406192.1.90756 WP_003406192.1.90767 WP_003406192.1.90771 WP_003406192.1.90785 WP_003406192.1.90788 WP_003406192.1.90800 WP_003406192.1.90810 WP_003406192.1.90816 WP_003406192.1.90819 WP_003406192.1.9082 WP_003406192.1.90884 WP_003406192.1.90899 WP_003406192.1.90906 WP_003406192.1.90958 WP_003406192.1.90976 WP_003406192.1.90977 WP_003406192.1.9102 WP_003406192.1.91026 WP_003406192.1.91032 WP_003406192.1.91053 WP_003406192.1.91082 WP_003406192.1.91106 WP_003406192.1.91112 WP_003406192.1.91151 WP_003406192.1.91157 WP_003406192.1.91167 WP_003406192.1.91169 WP_003406192.1.91192 WP_003406192.1.91201 WP_003406192.1.91207 WP_003406192.1.91208 WP_003406192.1.91211 WP_003406192.1.91214 WP_003406192.1.91230 WP_003406192.1.91244 WP_003406192.1.91251 WP_003406192.1.91260 WP_003406192.1.91284 WP_003406192.1.91294 WP_003406192.1.91303 WP_003406192.1.91322 WP_003406192.1.91386 WP_003406192.1.9139 WP_003406192.1.91398 WP_003406192.1.91430 WP_003406192.1.91483 WP_003406192.1.91496 WP_003406192.1.91507 WP_003406192.1.91576 WP_003406192.1.91589 WP_003406192.1.91694 WP_003406192.1.91716 WP_003406192.1.91717 WP_003406192.1.91728 WP_003406192.1.91743 WP_003406192.1.91784 WP_003406192.1.91785 WP_003406192.1.91786 WP_003406192.1.91802 WP_003406192.1.91828 WP_003406192.1.9189 WP_003406192.1.91896 WP_003406192.1.9190 WP_003406192.1.91915 WP_003406192.1.91937 WP_003406192.1.91944 WP_003406192.1.91957 WP_003406192.1.92127 WP_003406192.1.92144 WP_003406192.1.92150 WP_003406192.1.92153 WP_003406192.1.92190 WP_003406192.1.92192 WP_003406192.1.92200 WP_003406192.1.92220 WP_003406192.1.92222 WP_003406192.1.92289 WP_003406192.1.9229 WP_003406192.1.92294 WP_003406192.1.92317 WP_003406192.1.92334 WP_003406192.1.92338 WP_003406192.1.92345 WP_003406192.1.92356 WP_003406192.1.92364 WP_003406192.1.92380 WP_003406192.1.92447 WP_003406192.1.92456 WP_003406192.1.92467 WP_003406192.1.92490 WP_003406192.1.92508 WP_003406192.1.9251 WP_003406192.1.92511 WP_003406192.1.92523 WP_003406192.1.92527 WP_003406192.1.92536 WP_003406192.1.92592 WP_003406192.1.92603 WP_003406192.1.92606 WP_003406192.1.92610 WP_003406192.1.92613 WP_003406192.1.9263 WP_003406192.1.9265 WP_003406192.1.92650 WP_003406192.1.92677 WP_003406192.1.92685 WP_003406192.1.92689 WP_003406192.1.92690 WP_003406192.1.92714 WP_003406192.1.92736 WP_003406192.1.9274 WP_003406192.1.92752 WP_003406192.1.92760 WP_003406192.1.92777 WP_003406192.1.92803 WP_003406192.1.92833 WP_003406192.1.92856 WP_003406192.1.92881 WP_003406192.1.92892 WP_003406192.1.92907 WP_003406192.1.92908 WP_003406192.1.9291 WP_003406192.1.92917 WP_003406192.1.92996 WP_003406192.1.93009 WP_003406192.1.93015 WP_003406192.1.93043 WP_003406192.1.9307 WP_003406192.1.93083 WP_003406192.1.93097 WP_003406192.1.93137 WP_003406192.1.93203 WP_003406192.1.93212 WP_003406192.1.93234 WP_003406192.1.93245 WP_003406192.1.93257 WP_003406192.1.93265 WP_003406192.1.93297 WP_003406192.1.93320 WP_003406192.1.93328 WP_003406192.1.93343 WP_003406192.1.93349 WP_003406192.1.93363 WP_003406192.1.9338 WP_003406192.1.93407 WP_003406192.1.93417 WP_003406192.1.93419 WP_003406192.1.93426 WP_003406192.1.9344 WP_003406192.1.93443 WP_003406192.1.93447 WP_003406192.1.93470 WP_003406192.1.93483 WP_003406192.1.93487 WP_003406192.1.93495 WP_003406192.1.93499 WP_003406192.1.93516 WP_003406192.1.93536 WP_003406192.1.93544 WP_003406192.1.93555 WP_003406192.1.93560 WP_003406192.1.93564 WP_003406192.1.9357 WP_003406192.1.93573 WP_003406192.1.93576 WP_003406192.1.93588 WP_003406192.1.9363 WP_003406192.1.93645 WP_003406192.1.93649 WP_003406192.1.93659 WP_003406192.1.93677 WP_003406192.1.9368 WP_003406192.1.93689 WP_003406192.1.93693 WP_003406192.1.93698 WP_003406192.1.93706 WP_003406192.1.9371 WP_003406192.1.93792 WP_003406192.1.93823 WP_003406192.1.93871 WP_003406192.1.9388 WP_003406192.1.93894 WP_003406192.1.93903 WP_003406192.1.93907 WP_003406192.1.93913 WP_003406192.1.93946 WP_003406192.1.93950 WP_003406192.1.93953 WP_003406192.1.93954 WP_003406192.1.94143 WP_003406192.1.94154 WP_003406192.1.94204 WP_003406192.1.94205 WP_003406192.1.94226 WP_003406192.1.94231 WP_003406192.1.94256 WP_003406192.1.94261 WP_003406192.1.94292 WP_003406192.1.94297 WP_003406192.1.9431 WP_003406192.1.94326 WP_003406192.1.94339 WP_003406192.1.94392 WP_003406192.1.94416 WP_003406192.1.94421 WP_003406192.1.94480 WP_003406192.1.94495 WP_003406192.1.94511 WP_003406192.1.94512 WP_003406192.1.94528 WP_003406192.1.946 WP_003406192.1.94623 WP_003406192.1.94629 WP_003406192.1.9465 WP_003406192.1.94673 WP_003406192.1.94714 WP_003406192.1.94730 WP_003406192.1.94736 WP_003406192.1.94776 WP_003406192.1.9478 WP_003406192.1.94834 WP_003406192.1.94852 WP_003406192.1.94872 WP_003406192.1.94902 WP_003406192.1.94916 WP_003406192.1.94979 WP_003406192.1.94994 WP_003406192.1.94996 WP_003406192.1.94998 WP_003406192.1.95007 WP_003406192.1.95015 WP_003406192.1.95034 WP_003406192.1.95081 WP_003406192.1.95082 WP_003406192.1.9509 WP_003406192.1.95096 WP_003406192.1.95112 WP_003406192.1.95138 WP_003406192.1.95179 WP_003406192.1.95188 WP_003406192.1.95190 WP_003406192.1.95234 WP_003406192.1.95241 WP_003406192.1.95245 WP_003406192.1.95257 WP_003406192.1.95279 WP_003406192.1.9531 WP_003406192.1.95335 WP_003406192.1.9535 WP_003406192.1.95370 WP_003406192.1.95392 WP_003406192.1.95416 WP_003406192.1.95417 WP_003406192.1.95454 WP_003406192.1.95455 WP_003406192.1.95491 WP_003406192.1.95497 WP_003406192.1.95508 WP_003406192.1.95509 WP_003406192.1.95529 WP_003406192.1.95556 WP_003406192.1.95557 WP_003406192.1.95565 WP_003406192.1.95578 WP_003406192.1.95580 WP_003406192.1.95585 WP_003406192.1.95643 WP_003406192.1.95679 WP_003406192.1.95685 WP_003406192.1.957 WP_003406192.1.95724 WP_003406192.1.95727 WP_003406192.1.95735 WP_003406192.1.95758 WP_003406192.1.95772 WP_003406192.1.95839 WP_003406192.1.9590 WP_003406192.1.95902 WP_003406192.1.95924 WP_003406192.1.95953 WP_003406192.1.95958 WP_003406192.1.95964 WP_003406192.1.95973 WP_003406192.1.96006 WP_003406192.1.9602 WP_003406192.1.96036 WP_003406192.1.96062 WP_003406192.1.96065 WP_003406192.1.96146 WP_003406192.1.96171 WP_003406192.1.96182 WP_003406192.1.96230 WP_003406192.1.96242 WP_003406192.1.96245 WP_003406192.1.96254 WP_003406192.1.96259 WP_003406192.1.96286 WP_003406192.1.96313 WP_003406192.1.96318 WP_003406192.1.96345 WP_003406192.1.96360 WP_003406192.1.96373 WP_003406192.1.96456 WP_003406192.1.96486 WP_003406192.1.96569 WP_003406192.1.96573 WP_003406192.1.96576 WP_003406192.1.96611 WP_003406192.1.96621 WP_003406192.1.9667 WP_003406192.1.96681 WP_003406192.1.96726 WP_003406192.1.96733 WP_003406192.1.96742 WP_003406192.1.96754 WP_003406192.1.9678 WP_003406192.1.97008 WP_003406192.1.97009 WP_003406192.1.97056 WP_003406192.1.97084 WP_003406192.1.97087 WP_003406192.1.97094 WP_003406192.1.97096 WP_003406192.1.97099 WP_003406192.1.97108 WP_003406192.1.97113 WP_003406192.1.97122 WP_003406192.1.97129 WP_003406192.1.97136 WP_003406192.1.9716 WP_003406192.1.97176 WP_003406192.1.97222 WP_003406192.1.97237 WP_003406192.1.97242 WP_003406192.1.97270 WP_003406192.1.97283 WP_003406192.1.97296 WP_003406192.1.97321 WP_003406192.1.97325 WP_003406192.1.97366 WP_003406192.1.97376 WP_003406192.1.97380 WP_003406192.1.97462 WP_003406192.1.97517 WP_003406192.1.97519 WP_003406192.1.97535 WP_003406192.1.97540 WP_003406192.1.97546 WP_003406192.1.97550 WP_003406192.1.97577 WP_003406192.1.97584 WP_003406192.1.9759 WP_003406192.1.97591 WP_003406192.1.97609 WP_003406192.1.97618 WP_003406192.1.9763 WP_003406192.1.97669 WP_003406192.1.97673 WP_003406192.1.97700 WP_003406192.1.97701 WP_003406192.1.9773 WP_003406192.1.97730 WP_003406192.1.97740 WP_003406192.1.97751 WP_003406192.1.97754 WP_003406192.1.97797 WP_003406192.1.9782 WP_003406192.1.9784 WP_003406192.1.97888 WP_003406192.1.9795 WP_003406192.1.97951 WP_003406192.1.97958 WP_003406192.1.97966 WP_003406192.1.97977 WP_003406192.1.97979 WP_003406192.1.97995 WP_003406192.1.98018 WP_003406192.1.98034 WP_003406192.1.98052 WP_003406192.1.98071 WP_003406192.1.98072 WP_003406192.1.98113 WP_003406192.1.98114 WP_003406192.1.98128 WP_003406192.1.98188 WP_003406192.1.98189 WP_003406192.1.98213 WP_003406192.1.98225 WP_003406192.1.98291 WP_003406192.1.98335 WP_003406192.1.98350 WP_003406192.1.98395 WP_003406192.1.98412 WP_003406192.1.98441 WP_003406192.1.98443 WP_003406192.1.98462 WP_003406192.1.98482 WP_003406192.1.98486 WP_003406192.1.98488 WP_003406192.1.98503 WP_003406192.1.98516 WP_003406192.1.98536 WP_003406192.1.98541 WP_003406192.1.98566 WP_003406192.1.98576 WP_003406192.1.98590 WP_003406192.1.98594 WP_003406192.1.98599 WP_003406192.1.98645 WP_003406192.1.98646 WP_003406192.1.98649 WP_003406192.1.98656 WP_003406192.1.9867 WP_003406192.1.98674 WP_003406192.1.98697 WP_003406192.1.98701 WP_003406192.1.98739 WP_003406192.1.98749 WP_003406192.1.98765 WP_003406192.1.98770 WP_003406192.1.98777 WP_003406192.1.98778 WP_003406192.1.98906 WP_003406192.1.98935 WP_003406192.1.98948 WP_003406192.1.98953 WP_003406192.1.98984 WP_003406192.1.99000 WP_003406192.1.99055 WP_003406192.1.99062 WP_003406192.1.99086 WP_003406192.1.99161 WP_003406192.1.99211 WP_003406192.1.99216 WP_003406192.1.99251 WP_003406192.1.99294 WP_003406192.1.99312 WP_003406192.1.99315 WP_003406192.1.99316 WP_003406192.1.99322 WP_003406192.1.99328 WP_003406192.1.99365 WP_003406192.1.99368 WP_003406192.1.99396 WP_003406192.1.99402 WP_003406192.1.99419 WP_003406192.1.99438 WP_003406192.1.99468 WP_003406192.1.99473 WP_003406192.1.99513 WP_003406192.1.99529 WP_003406192.1.99548 WP_003406192.1.99572 WP_003406192.1.99575 WP_003406192.1.99578 WP_003406192.1.99605 WP_003406192.1.99609 WP_003406192.1.99617 WP_003406192.1.99635 WP_003406192.1.99672 WP_003406192.1.99701 WP_003406192.1.99711 WP_003406192.1.99740 WP_003406192.1.99745 WP_003406192.1.99749 WP_003406192.1.9976 WP_003406192.1.99798 WP_003406192.1.99817 WP_003406192.1.99847 WP_003406192.1.99886 WP_003406192.1.99897 WP_003406192.1.99899 WP_003406192.1.99915 WP_003406192.1.99991 gi|392385876|ref|YP_005307505.1| gi|479314083|ref|YP_007854135.1| gi|471337090|ref|YP_007609803.1| gi|506925645|ref|YP_008006095.1| 419947.MRA_1191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]