SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E6N0W0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E6N0W0
Domain Number 1 Region: 621-698
Classification Level Classification E-value
Superfamily SH3-domain 5.25e-23
Family SH3-domain 0.00051
Further Details:      
 
Domain Number 2 Region: 765-823
Classification Level Classification E-value
Superfamily SH3-domain 2.89e-19
Family SH3-domain 0.00054
Further Details:      
 
Domain Number 3 Region: 402-484
Classification Level Classification E-value
Superfamily SH3-domain 3.68e-19
Family SH3-domain 0.00073
Further Details:      
 
Domain Number 4 Region: 509-585
Classification Level Classification E-value
Superfamily SH3-domain 2.49e-17
Family SH3-domain 0.001
Further Details:      
 
Domain Number 5 Region: 684-762
Classification Level Classification E-value
Superfamily SH3-domain 1.44e-16
Family SH3-domain 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E6N0W0
Sequence length 825
Comment (tr|E6N0W0|E6N0W0_CAEEL) ITSN (Intersectin) family {ECO:0000313|EMBL:CBY85349.1} KW=Complete proteome; Reference proteome OX=6239 OS=Caenorhabditis elegans. GN=CELE_Y116A8C.36 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MCGISSRSANNTPELEPGAEPPQKSPAPKTFEDKRQDNLSKGQAELERRRRVLEEEEQRR
RAEVEKKEREEEAKKNRERQEKERQAEVERQAELERQRIIEAQREEEEKKRRLEMERRRE
EDEKMRKVQMEKAKVKQMQNQKQQENERLAQRQQREKTLQFQLQALDEKVIDVEVDIGKA
KEAVAEVTGFIERMRSTRDEKVARIKELQETNQKTAIESQELGHQLLQKQSAHKETTQRK
SELEALRRKRDAIRKAIEDAALELSTEKEKSYNQTEILKTNKEKYKTDVYSKLVAKREEY
RNSFELLVHAQTHARSKIGEFEAKSAPASAAPAPAPAPAPTTTNGFPANFNDAFGEFDKT
DASQRFDADFGATSTADPFAQIAQAPAHSKGAVDQSAFNIHDTYKCRALFAFEARSEDEL
SFEPGDVIIVFQSHAAEPGWRAGQLREKVGWFPEAFVEAIAAVPTPGGDPPIQNMPPNMT
PSSSVDQIGVKAARKAEIAAAMGLTEGGAPPASSAPAAAAVISQCIAQFQWRARNEEDLS
FAKGDTIEVLEKQEMKWKGRNPAGEIGWFPKSYVKEVGATTSTTTPIVSPSKASAGAPGA
AAGAQYDVVPSDVTLQASETAPQQQLYTVIYDFEAVETTDLALHVGDTILVLEKNDEWWK
GRCNGREGIFPANYVEISVQQAGDPTPPTQAPTPAAPPTVLCEAKVVVDFVASAPNQLGI
KVGEIVKIREKSAAGWWEGELIRNGKPIAGWFPGEYVKVLEEAASPATRATAVYDYEASQ
PDELGFKTGDVIIVTDKSEAEWWSGHREQDPSKSGLFPSNYVQQQ
Download sequence
Identical sequences E6N0W0
NP_001255928.1.50509 Y116A8C.36b.1 Y116A8C.36b.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]