SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for F2RTT1 from Uniprot 2013_05

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F2RTT1
Domain Number 1 Region: 136-247
Classification Level Classification E-value
Superfamily DNA-binding domain of Mlu1-box binding protein MBP1 1.96e-32
Family DNA-binding domain of Mlu1-box binding protein MBP1 0.0017
Further Details:      
 

Protein sequence

External link(s) F2RTT1
Sequence length 619
Comment (tr|F2RTT1|F2RTT1_TRIT1) Cell pattern formation-associated protein KW=Complete proteome OX=647933 OS=Trichophyton tonsurans (strain CBS 112818) (Scalp ringworm fungus). GN=TESG_02237 OC=mitosporic Arthrodermataceae; Trichophyton.
Sequence
MNQTQPYMDVQSSHLASSQPYTSQGTPTENSISHYPQYQQPSLLQPGPTAYAPSHSYPPQ
YGYSNGITSPPSNQPVPNPLNGQGPTQILPLPPLNSTAPNSHGYVPNSASQVQPYSSQTP
YDTTGQIAPPGVKPRVTATLWEDEGSLCFQVEAKGVCVARREDNHMINGTKLLNVAGMTR
GRRDGILKSEKIRHVVKIGPMHLKGVWIPFERALDFANKEKITDQLYPLFVHAIGSLLYH
PVNENRANAIVTASDRRRIESSQPLGRPGPGGHPPPLHHHHSMQNPTTTHMSQPSSLATM
PHPMPGRPPLDRAHTFPTPPTSASSLVGMPNQPGSYEWNGQNMSNGVQSSQPLPLESGMN
GTRSMPATPATTPPGANMSAMQAYQGQSAYSDSKAYYSSAPAPQSHYASHQPVSQQSISS
QGNGQVNGSNGATTAEPESTEQHQGTDGEYINDSNGTYSSNRASYPAYPSTQAVGSMPSE
HTPLPSEMAAPPPHQNGADKRSSGPWPSTYTPRSGAPSSVYSVMSDTRNSPANNSGTATY
PDAYSASASTPSYSSSMNGSSKRSRDEDDVEEIPRSDSRGEGSVYEHKRRKTLIDSAGPI
VPASISLQSVQSGNFPRRI
Download sequence
Identical sequences F2RTT1
TESG_02237T0

Jump to [ Top of page · Domain architecture · Domain assignment details ]