SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F2RTT1 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F2RTT1
Domain Number 1 Region: 136-247
Classification Level Classification E-value
Superfamily DNA-binding domain of Mlu1-box binding protein MBP1 1.96e-32
Family DNA-binding domain of Mlu1-box binding protein MBP1 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
mitotic cell cycle 1.581 79.85
cell cycle process 1.35 9.32
cell cycle phase transition 2.227 6.09
cell growth 1.652 4.62
Cellular Component IC (bits) H-Score
chromatin 1.876 9.56
nuclear transcription factor complex 2.016 9.39
chromosomal part 1.512 5.12
nuclear chromosome part 1.842 4.72

Protein sequence

External link(s) F2RTT1
Sequence length 619
Comment (tr|F2RTT1|F2RTT1_TRIT1) Cell pattern formation-associated protein {ECO:0000313|EMBL:EGD94730.1} KW=Complete proteome OX=647933 OS=Trichophyton tonsurans (strain CBS 112818) (Scalp ringworm fungus). GN=TESG_02237 OC=Eurotiomycetidae; Onygenales; Arthrodermataceae; Trichophyton.
Sequence
MNQTQPYMDVQSSHLASSQPYTSQGTPTENSISHYPQYQQPSLLQPGPTAYAPSHSYPPQ
YGYSNGITSPPSNQPVPNPLNGQGPTQILPLPPLNSTAPNSHGYVPNSASQVQPYSSQTP
YDTTGQIAPPGVKPRVTATLWEDEGSLCFQVEAKGVCVARREDNHMINGTKLLNVAGMTR
GRRDGILKSEKIRHVVKIGPMHLKGVWIPFERALDFANKEKITDQLYPLFVHAIGSLLYH
PVNENRANAIVTASDRRRIESSQPLGRPGPGGHPPPLHHHHSMQNPTTTHMSQPSSLATM
PHPMPGRPPLDRAHTFPTPPTSASSLVGMPNQPGSYEWNGQNMSNGVQSSQPLPLESGMN
GTRSMPATPATTPPGANMSAMQAYQGQSAYSDSKAYYSSAPAPQSHYASHQPVSQQSISS
QGNGQVNGSNGATTAEPESTEQHQGTDGEYINDSNGTYSSNRASYPAYPSTQAVGSMPSE
HTPLPSEMAAPPPHQNGADKRSSGPWPSTYTPRSGAPSSVYSVMSDTRNSPANNSGTATY
PDAYSASASTPSYSSSMNGSSKRSRDEDDVEEIPRSDSRGEGSVYEHKRRKTLIDSAGPI
VPASISLQSVQSGNFPRRI
Download sequence
Identical sequences F2RTT1
TESG_02237T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]