SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for F8WDV1 from Uniprot 2014_06

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F8WDV1
Domain Number 1 Region: 1-78
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 5.62e-24
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
nucleotidyltransferase activity 1.652 33.18
Cellular Component IC (bits) H-Score
DNA-directed RNA polymerase complex 2.004 66.89
nucleoplasm part 1.419 5.5
Biological Process IC (bits) H-Score
RNA biosynthetic process 1.536 25.62
DNA-dependent transcription, initiation 2.021 4.03

Protein sequence

External link(s) F8WDV1
Sequence length 123
Comment (tr|F8WDV1|F8WDV1_HUMAN) DNA-directed RNA polymerase III subunit RPC8 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=POLR3H OC=Catarrhini; Hominidae; Homo.
Sequence
MFVLVEMVDTVRIPPWQFERKLNDSIAEELNKKLANKVVYNVGLCICLFDITKLEDAYVF
PGDGASHTKVHFRCVVFHPFLDEILIGKIKGCSPEGVHGNSGPDASDKTWEHCGGRSLSR
LLR
Download sequence
Identical sequences F8WDV1
ENSP00000395674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]