SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for F8WDV1 from Uniprot 2013_05

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F8WDV1
Domain Number 1 Region: 1-78
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 5.62e-24
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.0014
Further Details:      
 

Protein sequence

External link(s) F8WDV1
Sequence length 123
Comment (tr|F8WDV1|F8WDV1_HUMAN) DNA-directed RNA polymerase III subunit RPC8 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=POLR3H OC=Catarrhini; Hominidae; Homo.
Sequence
MFVLVEMVDTVRIPPWQFERKLNDSIAEELNKKLANKVVYNVGLCICLFDITKLEDAYVF
PGDGASHTKVHFRCVVFHPFLDEILIGKIKGCSPEGVHGNSGPDASDKTWEHCGGRSLSR
LLR
Download sequence
Identical sequences F8WDV1
ENSP00000395674

Jump to [ Top of page · Domain architecture · Domain assignment details ]