SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5EE56 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5EE56
Domain Number 1 Region: 249-522
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.78e-78
Family Protein kinases, catalytic subunit 0.0000000368
Further Details:      
 
Domain Number 2 Region: 133-282
Classification Level Classification E-value
Superfamily SH2 domain 2.02e-34
Family SH2 domain 0.0000551
Further Details:      
 
Domain Number 3 Region: 73-142
Classification Level Classification E-value
Superfamily SH3-domain 9.19e-22
Family SH3-domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G5EE56
Sequence length 533
Comment (sp|G5EE56|SRC1_CAEEL) SRC oncogene related protein 1 {ECO:0000312|WormBase:Y92H12A.1a} KW=Complete proteome; Reference proteome OX=6239 OS=Caenorhabditis elegans. GN=Y92H12A.1 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MGCLFSKERRSGGSDMGVSERIDVSRFQTPQQQTVFHVNNGGNEGTISQLNGTSDGMMGN
GRGGGGGGGAQERETLVALYPYDSRADGDLSFQKGDAMYLLDHSNCDWWYVRHQRTGQTG
YVPRNFVAKQQTIESEEWYAGKIPRNRAERLVLSSHLPKGTFLIREREADTREFALTIRD
TDDQRNGGTVKHYKIKRLDHDQGYFITTRRTFRSLQELVRYYSDVPDGLCCQLTFPAPRL
APTRPDLSHDTQQNWEIPRNQLHLKRKLGDGNFGEVWYGKWRGIVEVAIKTMKPGTMSPE
AFLQEAQIMKQCDHPNLVKLYAVCTREEPFYIITEYMINGSLLQYLRTDGSTLGIQALVD
MAAQIANGMMYLEERKLVHRDLAARNVLVGDKISGVPVVKVADFGLARKLMEEDIYEART
GAKFPIKWTAPEAATCGNFTVKSDVWSYGILLYEIMTKGQVPYPGMHNREVVEQVELGYR
MPMPRGCPEQIYEEVLLKCWDKTPDRRPTFDTLYHFFDDYFVSTQPNYAPPSA
Download sequence
Identical sequences G5EE56
NP_490866.4.50509 Y92H12A.1 Y92H12A.1 Y92H12A.1 6239.Y92H12A.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]