SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H2L091 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2L091
Domain Number 1 Region: 163-289
Classification Level Classification E-value
Superfamily SH2 domain 1.33e-19
Family SH2 domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2L091
Sequence length 331
Comment (tr|H2L091|H2L091_CAEEL) SHC (Src Homology domain C-terminal) adaptor homolog {ECO:0000313|EMBL:CCD72090.1} KW=Complete proteome; Reference proteome OX=6239 OS=Caenorhabditis elegans. GN=CELE_T27F7.2 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MHPTNTASTMTEKRSASTVFLNRFLGKKGSQTVDESGQCKRKRRPVSAVFSSAIHRLSSS
TSSVNPKRMSTIEPQAPTREQLLQLQNQMRCAASSPVPEEPRPTDLCAASTTTSTSSVAS
SSSSNGSSSSTDTSPVPPAPQTALVYDEKLGEWIYPIDQALMTQLDNCSYFVGQPTKDSM
VYNLNTQPEGAFVIRYSESKSKCLALSMRVPCSHNPSGISHYLIIRNEQGFRLKLSATKK
PFPTLQMMLTHHSVLESHLPCTLHFVQWQKTNFKQLAAMSTVERPLRTFNRHSTALTKVR
LYYLFVEFREVVKKRMNRAEILPKQNQNKRI
Download sequence
Identical sequences H2L091
T27F7.2c NP_740984.1.50509 T27F7.2c

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]