SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H2ULL4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2ULL4
Domain Number 1 Region: 605-859
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.49e-68
Family Protein kinases, catalytic subunit 0.000000000347
Further Details:      
 
Domain Number 2 Region: 496-636
Classification Level Classification E-value
Superfamily SH2 domain 2.83e-37
Family SH2 domain 0.00000134
Further Details:      
 
Domain Number 3 Region: 168-290
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.72e-36
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000119
Further Details:      
 
Domain Number 4 Region: 75-166
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.92e-24
Family Cold shock DNA-binding domain-like 0.0000108
Further Details:      
 
Domain Number 5 Region: 436-521
Classification Level Classification E-value
Superfamily SH3-domain 7.35e-20
Family SH3-domain 0.000023
Further Details:      
 
Domain Number 6 Region: 24-74
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.00000000000183
Family ECR1 N-terminal domain-like 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2ULL4
Sequence length 1471
Comment (tr|H2ULL4|H2ULL4_TAKRU) Non-specific protein-tyrosine kinase {ECO:0000256|SAAS:SAAS00898236} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN=abl1 OC=Takifugu.
Sequence
MAAEMRLPTIQKQGSMSIYGKGRKDLVVPGDIITSDTGFMRGHGTYVDEDKLTASVAGEV
ERVDKLICVKPLKTRFNGEVGDVVVGRITEVQQKRWKVETNSRLDSVLLLSAVNLPGGEL
RRRSAEDELTMREYLHEGDLISAEVQSVFSDGALSLHTRSLKYGKLGQGVLVQVSPSLIK
RQKTHFHNLPCGASIILANNGFVWLYPTPEQQEEEAGGFYTSLEPVNLSDREVISRLRNC
LMALAAHKVLLYDTSVLYCFESSLQHQVKDILKPEVMEEIVMLTQQKLLEQKVPSLLGGL
LLDSERLSPAWRVPAAAWHPALMGQQPGKFAGDQRRPSLPAFIKGARRESSRHATQPCNV
FEVHDEGMRTSVFPSSESRVCIRPLAPEVLSDLCVYPSLPWSFLKLFLEALQKPDLTEAA
RWNSKENLLAGPSENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKN
GQGWVPSNYITPVNSLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISLR
YEGRVYHYRINTASDGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRNKPTIY
GVSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYNLTVAVKTLKEDTMEVEEFLKE
AAVMKEIKHPNLVQLLVGVCTREPPFYIITEFMTHGNLLDYLRECNREEVNAVVLLYMAT
QISSAMEYLEKKNFIHRDLAARNCLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIK
SDVWAFGVLLWEIATYGMSPYPGIDLSLVYELLEKDYRMDRPEGCPEKVYELMTACWRWN
PAERPSFAETHQAFETMFQESSISDEVEKELGKKGKKATFGSIQQAPELPTKTRTLRKNM
DTRDGDSPGKKIAIAIVTVSFFSSDPVEPEGAVSSPMLPRKERLLLDTNLNEDDRLLPKD
KDKTRSGLLGLIKKKKKNAPTPPKRSSSFREMDAHHDRRGLIPDPRDGDCFNNGITLPIN
DLSPGLDSTKLLVTNNNGAVGITNGAPAFPGPLFPWKKGAPAVPGPGGKAATTPPNEEES
MSNSKRFLWSSSMPVGSDGTEWKSVTLPRDLGQRHFDSGTFGGKPALPRKRNGEQKGEHT
RRMGTLTPPPRLNTSPDLSSATLAKDTDPSPGSSPQALTPKAVRRPEVPGLDSLKTSALH
AELLKANVFPALGAAAEESRARRQKHAADSASVRERGKLQKPKPAPPPPPTSTKTSKVSR
SPTQEPPSPSPTTSDIRAKLPSVSEPHHTTTASDQTRSPLSEGSKKLPLGSASKPQPLKT
SSSSTSVSASLSSQSLGGFSSSLTSPGDQSSPTAFIPLVNTRRSLRKTAPRQASERTPNS
AVTRDMVLEGTELAQPFAATQSRLVATAPCWRPVRTCPTDEEQVRLPRSHQQAGEQPPGA
ADLPHGHRANAQQDFSKLLSSVKEISDIVQR
Download sequence
Identical sequences H2ULL4
ENSTRUP00000037835 31033.ENSTRUP00000037835 ENSTRUP00000037835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]