SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I6WX95 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I6WX95
Domain Number 1 Region: 4-75
Classification Level Classification E-value
Superfamily ACP-like 0.000000000000222
Family Acyl-carrier protein (ACP) 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I6WX95
Sequence length 87
Comment (tr|I6WX95|I6WX95_MYCTU) Probable acyl carrier protein AcpA (ACP) {ECO:0000313|EMBL:CCP42755.1} KW=Complete proteome; Reference proteome OX=83332 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv). GN=Rv0033 OC=Mycobacterium; Mycobacterium tuberculosis complex.
Sequence
MKEAINATIQRILRTDRGITANQVLVDDLGFDSLKLFQLITELEDEFDIAISFRDAQNIK
TVGDVYTSVAVWFPETAKPAPLGKGTA
Download sequence
Identical sequences A0A045HRR9 A0A083WK38 A0A089QHP4 A0A0H3LB46 A0A0H3M156 A0A0K2HQN2 A0A109SJP3 A0A120IZ57 A0A197J159 A0A1R3XU46 A0A1S1B6P7 A5TYA4 G0TLR6 I6WX95 M8DCP8 P71603 R4M422
gi|197738020|ref|YP_002159336.1| gi|506924424|ref|YP_008004874.1| gi|386003122|ref|YP_005921401.1| Rv0033 rv0033 NP_214547.1.84033 WP_003400418.1.100000 WP_003400418.1.100021 WP_003400418.1.100069 WP_003400418.1.100087 WP_003400418.1.10015 WP_003400418.1.100208 WP_003400418.1.100216 WP_003400418.1.10022 WP_003400418.1.100255 WP_003400418.1.100260 WP_003400418.1.100270 WP_003400418.1.100279 WP_003400418.1.100286 WP_003400418.1.100308 WP_003400418.1.100309 WP_003400418.1.100318 WP_003400418.1.100337 WP_003400418.1.100338 WP_003400418.1.10037 WP_003400418.1.100383 WP_003400418.1.100395 WP_003400418.1.100396 WP_003400418.1.1004 WP_003400418.1.100401 WP_003400418.1.100459 WP_003400418.1.100460 WP_003400418.1.100552 WP_003400418.1.100581 WP_003400418.1.100600 WP_003400418.1.100625 WP_003400418.1.10064 WP_003400418.1.100666 WP_003400418.1.100671 WP_003400418.1.100677 WP_003400418.1.100682 WP_003400418.1.100697 WP_003400418.1.100703 WP_003400418.1.100716 WP_003400418.1.100722 WP_003400418.1.100754 WP_003400418.1.100757 WP_003400418.1.100772 WP_003400418.1.1008 WP_003400418.1.100812 WP_003400418.1.100845 WP_003400418.1.100866 WP_003400418.1.10088 WP_003400418.1.100889 WP_003400418.1.10090 WP_003400418.1.100910 WP_003400418.1.100915 WP_003400418.1.100918 WP_003400418.1.100935 WP_003400418.1.100984 WP_003400418.1.100992 WP_003400418.1.100998 WP_003400418.1.101 WP_003400418.1.101025 WP_003400418.1.101028 WP_003400418.1.10104 WP_003400418.1.101048 WP_003400418.1.101054 WP_003400418.1.101075 WP_003400418.1.101143 WP_003400418.1.101146 WP_003400418.1.10116 WP_003400418.1.10117 WP_003400418.1.101209 WP_003400418.1.101290 WP_003400418.1.101323 WP_003400418.1.101324 WP_003400418.1.101350 WP_003400418.1.101367 WP_003400418.1.101398 WP_003400418.1.101403 WP_003400418.1.101421 WP_003400418.1.10144 WP_003400418.1.101442 WP_003400418.1.10145 WP_003400418.1.101452 WP_003400418.1.101456 WP_003400418.1.101481 WP_003400418.1.101493 WP_003400418.1.101525 WP_003400418.1.101533 WP_003400418.1.101535 WP_003400418.1.101553 WP_003400418.1.101558 WP_003400418.1.10156 WP_003400418.1.101573 WP_003400418.1.101576 WP_003400418.1.10159 WP_003400418.1.101592 WP_003400418.1.101604 WP_003400418.1.101607 WP_003400418.1.101622 WP_003400418.1.101644 WP_003400418.1.101671 WP_003400418.1.101687 WP_003400418.1.101698 WP_003400418.1.10170 WP_003400418.1.101713 WP_003400418.1.101722 WP_003400418.1.101733 WP_003400418.1.101743 WP_003400418.1.101753 WP_003400418.1.101754 WP_003400418.1.101764 WP_003400418.1.101773 WP_003400418.1.101795 WP_003400418.1.101797 WP_003400418.1.101798 WP_003400418.1.101802 WP_003400418.1.101826 WP_003400418.1.101836 WP_003400418.1.101858 WP_003400418.1.101859 WP_003400418.1.101862 WP_003400418.1.101888 WP_003400418.1.101894 WP_003400418.1.101899 WP_003400418.1.1019 WP_003400418.1.101923 WP_003400418.1.101925 WP_003400418.1.10193 WP_003400418.1.101996 WP_003400418.1.102 WP_003400418.1.102008 WP_003400418.1.102017 WP_003400418.1.102053 WP_003400418.1.102055 WP_003400418.1.102063 WP_003400418.1.102099 WP_003400418.1.1021 WP_003400418.1.10211 WP_003400418.1.102119 WP_003400418.1.102121 WP_003400418.1.102143 WP_003400418.1.10216 WP_003400418.1.10224 WP_003400418.1.10253 WP_003400418.1.10262 WP_003400418.1.10277 WP_003400418.1.1033 WP_003400418.1.10350 WP_003400418.1.10362 WP_003400418.1.10366 WP_003400418.1.10376 WP_003400418.1.10396 WP_003400418.1.10410 WP_003400418.1.10414 WP_003400418.1.10421 WP_003400418.1.10430 WP_003400418.1.1044 WP_003400418.1.10440 WP_003400418.1.10445 WP_003400418.1.10471 WP_003400418.1.10472 WP_003400418.1.10489 WP_003400418.1.105 WP_003400418.1.10518 WP_003400418.1.10523 WP_003400418.1.10545 WP_003400418.1.1057 WP_003400418.1.10594 WP_003400418.1.10603 WP_003400418.1.10606 WP_003400418.1.10615 WP_003400418.1.10623 WP_003400418.1.10635 WP_003400418.1.10643 WP_003400418.1.10648 WP_003400418.1.10662 WP_003400418.1.10709 WP_003400418.1.10735 WP_003400418.1.10740 WP_003400418.1.10756 WP_003400418.1.1078 WP_003400418.1.10791 WP_003400418.1.10799 WP_003400418.1.10825 WP_003400418.1.10848 WP_003400418.1.10863 WP_003400418.1.10879 WP_003400418.1.10912 WP_003400418.1.10916 WP_003400418.1.10923 WP_003400418.1.10927 WP_003400418.1.1095 WP_003400418.1.10956 WP_003400418.1.10958 WP_003400418.1.10962 WP_003400418.1.10980 WP_003400418.1.10981 WP_003400418.1.10993 WP_003400418.1.1100 WP_003400418.1.11040 WP_003400418.1.11061 WP_003400418.1.11070 WP_003400418.1.11141 WP_003400418.1.11171 WP_003400418.1.11175 WP_003400418.1.11176 WP_003400418.1.11222 WP_003400418.1.11236 WP_003400418.1.11329 WP_003400418.1.1133 WP_003400418.1.11342 WP_003400418.1.11373 WP_003400418.1.11376 WP_003400418.1.11390 WP_003400418.1.11402 WP_003400418.1.11481 WP_003400418.1.11487 WP_003400418.1.11489 WP_003400418.1.11491 WP_003400418.1.11514 WP_003400418.1.11587 WP_003400418.1.11589 WP_003400418.1.11596 WP_003400418.1.11604 WP_003400418.1.11610 WP_003400418.1.11697 WP_003400418.1.11707 WP_003400418.1.11752 WP_003400418.1.11758 WP_003400418.1.11761 WP_003400418.1.11775 WP_003400418.1.11804 WP_003400418.1.11822 WP_003400418.1.11826 WP_003400418.1.11856 WP_003400418.1.11898 WP_003400418.1.11906 WP_003400418.1.11939 WP_003400418.1.11960 WP_003400418.1.11961 WP_003400418.1.11972 WP_003400418.1.11984 WP_003400418.1.12001 WP_003400418.1.12049 WP_003400418.1.12052 WP_003400418.1.12100 WP_003400418.1.12116 WP_003400418.1.12130 WP_003400418.1.12133 WP_003400418.1.12161 WP_003400418.1.12165 WP_003400418.1.12184 WP_003400418.1.12187 WP_003400418.1.12190 WP_003400418.1.12216 WP_003400418.1.12265 WP_003400418.1.12275 WP_003400418.1.12293 WP_003400418.1.12294 WP_003400418.1.123 WP_003400418.1.1231 WP_003400418.1.12314 WP_003400418.1.12327 WP_003400418.1.12338 WP_003400418.1.1236 WP_003400418.1.12371 WP_003400418.1.12372 WP_003400418.1.12389 WP_003400418.1.12406 WP_003400418.1.1241 WP_003400418.1.12421 WP_003400418.1.12424 WP_003400418.1.12446 WP_003400418.1.12464 WP_003400418.1.12479 WP_003400418.1.12519 WP_003400418.1.12523 WP_003400418.1.12526 WP_003400418.1.1255 WP_003400418.1.12550 WP_003400418.1.12551 WP_003400418.1.12563 WP_003400418.1.12611 WP_003400418.1.12669 WP_003400418.1.1267 WP_003400418.1.12672 WP_003400418.1.12692 WP_003400418.1.1271 WP_003400418.1.12710 WP_003400418.1.12768 WP_003400418.1.1279 WP_003400418.1.12794 WP_003400418.1.12801 WP_003400418.1.12804 WP_003400418.1.12821 WP_003400418.1.12841 WP_003400418.1.12854 WP_003400418.1.12871 WP_003400418.1.12901 WP_003400418.1.12941 WP_003400418.1.12947 WP_003400418.1.12957 WP_003400418.1.12972 WP_003400418.1.13028 WP_003400418.1.13043 WP_003400418.1.13086 WP_003400418.1.13087 WP_003400418.1.13090 WP_003400418.1.13096 WP_003400418.1.13163 WP_003400418.1.13175 WP_003400418.1.13183 WP_003400418.1.132 WP_003400418.1.13249 WP_003400418.1.13282 WP_003400418.1.13284 WP_003400418.1.13296 WP_003400418.1.13298 WP_003400418.1.13302 WP_003400418.1.13306 WP_003400418.1.13312 WP_003400418.1.13313 WP_003400418.1.13321 WP_003400418.1.13345 WP_003400418.1.13358 WP_003400418.1.13370 WP_003400418.1.13375 WP_003400418.1.1338 WP_003400418.1.13420 WP_003400418.1.13433 WP_003400418.1.13435 WP_003400418.1.13438 WP_003400418.1.13461 WP_003400418.1.13466 WP_003400418.1.13489 WP_003400418.1.13526 WP_003400418.1.13551 WP_003400418.1.13561 WP_003400418.1.13564 WP_003400418.1.13579 WP_003400418.1.13647 WP_003400418.1.13667 WP_003400418.1.13687 WP_003400418.1.13697 WP_003400418.1.13719 WP_003400418.1.13763 WP_003400418.1.1377 WP_003400418.1.13774 WP_003400418.1.13786 WP_003400418.1.13793 WP_003400418.1.13794 WP_003400418.1.13817 WP_003400418.1.13834 WP_003400418.1.13866 WP_003400418.1.13880 WP_003400418.1.13899 WP_003400418.1.13909 WP_003400418.1.13910 WP_003400418.1.13919 WP_003400418.1.13920 WP_003400418.1.13952 WP_003400418.1.13953 WP_003400418.1.13962 WP_003400418.1.1398 WP_003400418.1.13988 WP_003400418.1.14027 WP_003400418.1.14046 WP_003400418.1.14115 WP_003400418.1.1415 WP_003400418.1.14152 WP_003400418.1.14158 WP_003400418.1.14162 WP_003400418.1.14175 WP_003400418.1.14178 WP_003400418.1.14194 WP_003400418.1.14195 WP_003400418.1.14208 WP_003400418.1.14238 WP_003400418.1.14266 WP_003400418.1.14273 WP_003400418.1.14303 WP_003400418.1.14306 WP_003400418.1.14307 WP_003400418.1.14310 WP_003400418.1.14341 WP_003400418.1.14382 WP_003400418.1.14416 WP_003400418.1.14428 WP_003400418.1.14441 WP_003400418.1.14469 WP_003400418.1.14477 WP_003400418.1.14504 WP_003400418.1.14514 WP_003400418.1.1452 WP_003400418.1.14527 WP_003400418.1.1454 WP_003400418.1.14544 WP_003400418.1.14548 WP_003400418.1.14551 WP_003400418.1.14561 WP_003400418.1.14573 WP_003400418.1.1462 WP_003400418.1.14658 WP_003400418.1.14667 WP_003400418.1.14668 WP_003400418.1.14675 WP_003400418.1.14694 WP_003400418.1.14695 WP_003400418.1.14709 WP_003400418.1.14766 WP_003400418.1.14783 WP_003400418.1.14865 WP_003400418.1.14872 WP_003400418.1.14905 WP_003400418.1.14926 WP_003400418.1.14951 WP_003400418.1.14955 WP_003400418.1.15003 WP_003400418.1.15009 WP_003400418.1.15028 WP_003400418.1.15040 WP_003400418.1.15052 WP_003400418.1.15065 WP_003400418.1.15072 WP_003400418.1.15089 WP_003400418.1.1509 WP_003400418.1.15126 WP_003400418.1.15131 WP_003400418.1.15168 WP_003400418.1.15172 WP_003400418.1.15174 WP_003400418.1.15187 WP_003400418.1.15196 WP_003400418.1.15210 WP_003400418.1.15216 WP_003400418.1.15217 WP_003400418.1.1523 WP_003400418.1.15232 WP_003400418.1.15238 WP_003400418.1.15240 WP_003400418.1.15253 WP_003400418.1.15267 WP_003400418.1.1527 WP_003400418.1.15292 WP_003400418.1.15299 WP_003400418.1.15302 WP_003400418.1.15322 WP_003400418.1.1534 WP_003400418.1.15345 WP_003400418.1.15365 WP_003400418.1.15372 WP_003400418.1.15386 WP_003400418.1.15387 WP_003400418.1.15442 WP_003400418.1.15447 WP_003400418.1.15449 WP_003400418.1.15477 WP_003400418.1.15481 WP_003400418.1.15492 WP_003400418.1.15511 WP_003400418.1.15512 WP_003400418.1.15558 WP_003400418.1.15559 WP_003400418.1.15566 WP_003400418.1.15599 WP_003400418.1.1560 WP_003400418.1.15611 WP_003400418.1.1563 WP_003400418.1.15633 WP_003400418.1.15643 WP_003400418.1.15688 WP_003400418.1.15755 WP_003400418.1.15763 WP_003400418.1.15774 WP_003400418.1.1578 WP_003400418.1.15780 WP_003400418.1.15827 WP_003400418.1.15834 WP_003400418.1.15842 WP_003400418.1.15848 WP_003400418.1.15853 WP_003400418.1.15870 WP_003400418.1.15877 WP_003400418.1.15893 WP_003400418.1.15896 WP_003400418.1.15926 WP_003400418.1.15933 WP_003400418.1.15946 WP_003400418.1.15958 WP_003400418.1.15973 WP_003400418.1.15987 WP_003400418.1.15993 WP_003400418.1.16009 WP_003400418.1.16025 WP_003400418.1.16043 WP_003400418.1.16055 WP_003400418.1.16066 WP_003400418.1.16069 WP_003400418.1.16077 WP_003400418.1.16106 WP_003400418.1.16108 WP_003400418.1.16110 WP_003400418.1.16130 WP_003400418.1.16139 WP_003400418.1.16141 WP_003400418.1.16143 WP_003400418.1.1630 WP_003400418.1.16318 WP_003400418.1.1632 WP_003400418.1.16327 WP_003400418.1.16334 WP_003400418.1.16341 WP_003400418.1.16345 WP_003400418.1.16374 WP_003400418.1.16384 WP_003400418.1.16386 WP_003400418.1.164 WP_003400418.1.1642 WP_003400418.1.16421 WP_003400418.1.16424 WP_003400418.1.16426 WP_003400418.1.16431 WP_003400418.1.16438 WP_003400418.1.1644 WP_003400418.1.16442 WP_003400418.1.16448 WP_003400418.1.16451 WP_003400418.1.16476 WP_003400418.1.16480 WP_003400418.1.16494 WP_003400418.1.1652 WP_003400418.1.16549 WP_003400418.1.16560 WP_003400418.1.16598 WP_003400418.1.16609 WP_003400418.1.16619 WP_003400418.1.16620 WP_003400418.1.16622 WP_003400418.1.16637 WP_003400418.1.1669 WP_003400418.1.16707 WP_003400418.1.16724 WP_003400418.1.16731 WP_003400418.1.16743 WP_003400418.1.1683 WP_003400418.1.16837 WP_003400418.1.16852 WP_003400418.1.16937 WP_003400418.1.16940 WP_003400418.1.16950 WP_003400418.1.16959 WP_003400418.1.16968 WP_003400418.1.1697 WP_003400418.1.16973 WP_003400418.1.16977 WP_003400418.1.16987 WP_003400418.1.17005 WP_003400418.1.17006 WP_003400418.1.17010 WP_003400418.1.17015 WP_003400418.1.17019 WP_003400418.1.17039 WP_003400418.1.17041 WP_003400418.1.17052 WP_003400418.1.17057 WP_003400418.1.17062 WP_003400418.1.1707 WP_003400418.1.17094 WP_003400418.1.17130 WP_003400418.1.17138 WP_003400418.1.17147 WP_003400418.1.17167 WP_003400418.1.17224 WP_003400418.1.17251 WP_003400418.1.17288 WP_003400418.1.17304 WP_003400418.1.17314 WP_003400418.1.17345 WP_003400418.1.17381 WP_003400418.1.17391 WP_003400418.1.17412 WP_003400418.1.1743 WP_003400418.1.17440 WP_003400418.1.17466 WP_003400418.1.17477 WP_003400418.1.17483 WP_003400418.1.17505 WP_003400418.1.17527 WP_003400418.1.17535 WP_003400418.1.17540 WP_003400418.1.17553 WP_003400418.1.17558 WP_003400418.1.17599 WP_003400418.1.17635 WP_003400418.1.17655 WP_003400418.1.17679 WP_003400418.1.1768 WP_003400418.1.17687 WP_003400418.1.17700 WP_003400418.1.17710 WP_003400418.1.17713 WP_003400418.1.17722 WP_003400418.1.17746 WP_003400418.1.17788 WP_003400418.1.17798 WP_003400418.1.17803 WP_003400418.1.17816 WP_003400418.1.17821 WP_003400418.1.17830 WP_003400418.1.17868 WP_003400418.1.17878 WP_003400418.1.1792 WP_003400418.1.17923 WP_003400418.1.1795 WP_003400418.1.17955 WP_003400418.1.17973 WP_003400418.1.18009 WP_003400418.1.18013 WP_003400418.1.18033 WP_003400418.1.18057 WP_003400418.1.18065 WP_003400418.1.18070 WP_003400418.1.18116 WP_003400418.1.18120 WP_003400418.1.18126 WP_003400418.1.1817 WP_003400418.1.18170 WP_003400418.1.18206 WP_003400418.1.18216 WP_003400418.1.18240 WP_003400418.1.18257 WP_003400418.1.18297 WP_003400418.1.18306 WP_003400418.1.18364 WP_003400418.1.18399 WP_003400418.1.18411 WP_003400418.1.18444 WP_003400418.1.18448 WP_003400418.1.18467 WP_003400418.1.18476 WP_003400418.1.18522 WP_003400418.1.18580 WP_003400418.1.18582 WP_003400418.1.18587 WP_003400418.1.186 WP_003400418.1.18601 WP_003400418.1.18639 WP_003400418.1.18646 WP_003400418.1.18647 WP_003400418.1.1868 WP_003400418.1.18694 WP_003400418.1.18710 WP_003400418.1.18751 WP_003400418.1.18781 WP_003400418.1.18793 WP_003400418.1.18804 WP_003400418.1.18816 WP_003400418.1.18823 WP_003400418.1.18827 WP_003400418.1.18838 WP_003400418.1.18849 WP_003400418.1.18856 WP_003400418.1.18945 WP_003400418.1.1898 WP_003400418.1.19005 WP_003400418.1.19056 WP_003400418.1.19063 WP_003400418.1.19066 WP_003400418.1.19071 WP_003400418.1.19085 WP_003400418.1.19094 WP_003400418.1.19144 WP_003400418.1.19159 WP_003400418.1.19193 WP_003400418.1.19231 WP_003400418.1.19243 WP_003400418.1.19264 WP_003400418.1.19295 WP_003400418.1.19307 WP_003400418.1.19326 WP_003400418.1.1933 WP_003400418.1.19364 WP_003400418.1.19382 WP_003400418.1.19400 WP_003400418.1.19426 WP_003400418.1.19429 WP_003400418.1.19464 WP_003400418.1.19480 WP_003400418.1.19512 WP_003400418.1.19553 WP_003400418.1.19562 WP_003400418.1.19564 WP_003400418.1.19568 WP_003400418.1.19572 WP_003400418.1.19595 WP_003400418.1.19596 WP_003400418.1.19600 WP_003400418.1.19630 WP_003400418.1.1967 WP_003400418.1.19694 WP_003400418.1.1970 WP_003400418.1.19707 WP_003400418.1.19742 WP_003400418.1.19785 WP_003400418.1.19820 WP_003400418.1.19868 WP_003400418.1.19874 WP_003400418.1.19890 WP_003400418.1.19900 WP_003400418.1.19922 WP_003400418.1.19936 WP_003400418.1.19946 WP_003400418.1.19949 WP_003400418.1.19960 WP_003400418.1.19964 WP_003400418.1.20007 WP_003400418.1.20016 WP_003400418.1.20028 WP_003400418.1.2003 WP_003400418.1.20037 WP_003400418.1.20039 WP_003400418.1.20082 WP_003400418.1.20085 WP_003400418.1.20097 WP_003400418.1.20116 WP_003400418.1.20130 WP_003400418.1.20140 WP_003400418.1.20141 WP_003400418.1.20142 WP_003400418.1.20158 WP_003400418.1.20239 WP_003400418.1.20243 WP_003400418.1.20259 WP_003400418.1.20262 WP_003400418.1.20268 WP_003400418.1.20272 WP_003400418.1.20273 WP_003400418.1.20280 WP_003400418.1.20294 WP_003400418.1.20300 WP_003400418.1.20309 WP_003400418.1.20322 WP_003400418.1.2037 WP_003400418.1.20372 WP_003400418.1.20381 WP_003400418.1.204 WP_003400418.1.20427 WP_003400418.1.20432 WP_003400418.1.20457 WP_003400418.1.20459 WP_003400418.1.20460 WP_003400418.1.20542 WP_003400418.1.20578 WP_003400418.1.20608 WP_003400418.1.20624 WP_003400418.1.20628 WP_003400418.1.2066 WP_003400418.1.20707 WP_003400418.1.20722 WP_003400418.1.20729 WP_003400418.1.20742 WP_003400418.1.20751 WP_003400418.1.20776 WP_003400418.1.20843 WP_003400418.1.20850 WP_003400418.1.2086 WP_003400418.1.20868 WP_003400418.1.20876 WP_003400418.1.20897 WP_003400418.1.20898 WP_003400418.1.2090 WP_003400418.1.20911 WP_003400418.1.20916 WP_003400418.1.20921 WP_003400418.1.20926 WP_003400418.1.20927 WP_003400418.1.20951 WP_003400418.1.20970 WP_003400418.1.2104 WP_003400418.1.21070 WP_003400418.1.21127 WP_003400418.1.21135 WP_003400418.1.21173 WP_003400418.1.21187 WP_003400418.1.212 WP_003400418.1.2120 WP_003400418.1.21218 WP_003400418.1.21219 WP_003400418.1.2123 WP_003400418.1.21231 WP_003400418.1.21234 WP_003400418.1.2126 WP_003400418.1.21292 WP_003400418.1.21307 WP_003400418.1.2131 WP_003400418.1.21311 WP_003400418.1.21321 WP_003400418.1.21365 WP_003400418.1.2137 WP_003400418.1.21392 WP_003400418.1.21397 WP_003400418.1.21403 WP_003400418.1.21415 WP_003400418.1.21418 WP_003400418.1.21430 WP_003400418.1.21434 WP_003400418.1.21444 WP_003400418.1.21468 WP_003400418.1.21498 WP_003400418.1.21509 WP_003400418.1.21513 WP_003400418.1.21560 WP_003400418.1.21565 WP_003400418.1.21586 WP_003400418.1.21591 WP_003400418.1.21594 WP_003400418.1.21602 WP_003400418.1.21615 WP_003400418.1.21638 WP_003400418.1.21639 WP_003400418.1.21655 WP_003400418.1.21658 WP_003400418.1.2168 WP_003400418.1.2174 WP_003400418.1.21741 WP_003400418.1.21742 WP_003400418.1.21777 WP_003400418.1.21786 WP_003400418.1.21795 WP_003400418.1.218 WP_003400418.1.21826 WP_003400418.1.21829 WP_003400418.1.21840 WP_003400418.1.21843 WP_003400418.1.21872 WP_003400418.1.21873 WP_003400418.1.2188 WP_003400418.1.21882 WP_003400418.1.21906 WP_003400418.1.21912 WP_003400418.1.2194 WP_003400418.1.21941 WP_003400418.1.21956 WP_003400418.1.21958 WP_003400418.1.21960 WP_003400418.1.21971 WP_003400418.1.21973 WP_003400418.1.21983 WP_003400418.1.22003 WP_003400418.1.22013 WP_003400418.1.22025 WP_003400418.1.22036 WP_003400418.1.22075 WP_003400418.1.22092 WP_003400418.1.2212 WP_003400418.1.22127 WP_003400418.1.22140 WP_003400418.1.22233 WP_003400418.1.22255 WP_003400418.1.22277 WP_003400418.1.22305 WP_003400418.1.22348 WP_003400418.1.22356 WP_003400418.1.22366 WP_003400418.1.2238 WP_003400418.1.22380 WP_003400418.1.22437 WP_003400418.1.22438 WP_003400418.1.22445 WP_003400418.1.22490 WP_003400418.1.22511 WP_003400418.1.22524 WP_003400418.1.2253 WP_003400418.1.22585 WP_003400418.1.22589 WP_003400418.1.22606 WP_003400418.1.22608 WP_003400418.1.22609 WP_003400418.1.22618 WP_003400418.1.2262 WP_003400418.1.22624 WP_003400418.1.22629 WP_003400418.1.22664 WP_003400418.1.22665 WP_003400418.1.22670 WP_003400418.1.22674 WP_003400418.1.22680 WP_003400418.1.22725 WP_003400418.1.22728 WP_003400418.1.22733 WP_003400418.1.22737 WP_003400418.1.2275 WP_003400418.1.22754 WP_003400418.1.22797 WP_003400418.1.22800 WP_003400418.1.22804 WP_003400418.1.22829 WP_003400418.1.22840 WP_003400418.1.22844 WP_003400418.1.22963 WP_003400418.1.22970 WP_003400418.1.22996 WP_003400418.1.22997 WP_003400418.1.22999 WP_003400418.1.23015 WP_003400418.1.23032 WP_003400418.1.231 WP_003400418.1.23101 WP_003400418.1.2312 WP_003400418.1.23140 WP_003400418.1.23153 WP_003400418.1.23171 WP_003400418.1.23199 WP_003400418.1.2320 WP_003400418.1.23204 WP_003400418.1.23216 WP_003400418.1.23229 WP_003400418.1.23233 WP_003400418.1.2326 WP_003400418.1.23261 WP_003400418.1.23272 WP_003400418.1.23289 WP_003400418.1.2329 WP_003400418.1.23308 WP_003400418.1.23316 WP_003400418.1.23321 WP_003400418.1.23325 WP_003400418.1.2339 WP_003400418.1.23406 WP_003400418.1.23438 WP_003400418.1.23445 WP_003400418.1.23447 WP_003400418.1.23452 WP_003400418.1.23461 WP_003400418.1.2349 WP_003400418.1.23496 WP_003400418.1.23497 WP_003400418.1.23506 WP_003400418.1.23530 WP_003400418.1.23539 WP_003400418.1.23546 WP_003400418.1.23551 WP_003400418.1.23573 WP_003400418.1.23583 WP_003400418.1.23588 WP_003400418.1.23628 WP_003400418.1.23677 WP_003400418.1.23683 WP_003400418.1.23692 WP_003400418.1.23694 WP_003400418.1.23699 WP_003400418.1.2371 WP_003400418.1.23803 WP_003400418.1.23807 WP_003400418.1.23825 WP_003400418.1.23832 WP_003400418.1.2384 WP_003400418.1.23843 WP_003400418.1.23863 WP_003400418.1.2387 WP_003400418.1.23894 WP_003400418.1.23993 WP_003400418.1.2400 WP_003400418.1.24007 WP_003400418.1.24008 WP_003400418.1.24046 WP_003400418.1.24057 WP_003400418.1.24062 WP_003400418.1.24113 WP_003400418.1.24119 WP_003400418.1.24128 WP_003400418.1.24140 WP_003400418.1.24176 WP_003400418.1.24190 WP_003400418.1.24202 WP_003400418.1.24244 WP_003400418.1.24261 WP_003400418.1.24284 WP_003400418.1.24294 WP_003400418.1.24357 WP_003400418.1.24396 WP_003400418.1.24414 WP_003400418.1.24423 WP_003400418.1.2443 WP_003400418.1.24446 WP_003400418.1.24461 WP_003400418.1.24500 WP_003400418.1.24507 WP_003400418.1.24509 WP_003400418.1.24529 WP_003400418.1.24553 WP_003400418.1.24599 WP_003400418.1.24629 WP_003400418.1.24638 WP_003400418.1.24648 WP_003400418.1.2466 WP_003400418.1.24767 WP_003400418.1.24824 WP_003400418.1.24831 WP_003400418.1.24840 WP_003400418.1.24848 WP_003400418.1.24857 WP_003400418.1.2487 WP_003400418.1.24893 WP_003400418.1.24907 WP_003400418.1.24933 WP_003400418.1.24956 WP_003400418.1.24958 WP_003400418.1.24985 WP_003400418.1.2499 WP_003400418.1.25004 WP_003400418.1.2505 WP_003400418.1.25051 WP_003400418.1.2507 WP_003400418.1.25096 WP_003400418.1.25103 WP_003400418.1.25129 WP_003400418.1.25171 WP_003400418.1.25184 WP_003400418.1.25247 WP_003400418.1.25252 WP_003400418.1.25278 WP_003400418.1.25283 WP_003400418.1.25309 WP_003400418.1.25313 WP_003400418.1.25338 WP_003400418.1.25342 WP_003400418.1.25343 WP_003400418.1.25367 WP_003400418.1.25393 WP_003400418.1.25406 WP_003400418.1.25435 WP_003400418.1.25437 WP_003400418.1.25445 WP_003400418.1.25455 WP_003400418.1.25473 WP_003400418.1.25504 WP_003400418.1.25513 WP_003400418.1.25542 WP_003400418.1.25579 WP_003400418.1.25594 WP_003400418.1.25606 WP_003400418.1.25645 WP_003400418.1.2566 WP_003400418.1.25673 WP_003400418.1.25674 WP_003400418.1.25693 WP_003400418.1.25699 WP_003400418.1.25727 WP_003400418.1.25736 WP_003400418.1.25738 WP_003400418.1.25756 WP_003400418.1.25759 WP_003400418.1.2580 WP_003400418.1.25813 WP_003400418.1.25853 WP_003400418.1.25854 WP_003400418.1.25874 WP_003400418.1.25885 WP_003400418.1.25892 WP_003400418.1.25906 WP_003400418.1.25914 WP_003400418.1.25916 WP_003400418.1.2594 WP_003400418.1.25954 WP_003400418.1.25965 WP_003400418.1.25972 WP_003400418.1.26017 WP_003400418.1.26032 WP_003400418.1.26038 WP_003400418.1.26072 WP_003400418.1.26089 WP_003400418.1.26097 WP_003400418.1.26098 WP_003400418.1.26108 WP_003400418.1.26109 WP_003400418.1.26118 WP_003400418.1.26126 WP_003400418.1.2614 WP_003400418.1.26168 WP_003400418.1.26182 WP_003400418.1.26190 WP_003400418.1.2620 WP_003400418.1.26234 WP_003400418.1.26243 WP_003400418.1.26265 WP_003400418.1.26267 WP_003400418.1.26292 WP_003400418.1.26310 WP_003400418.1.26328 WP_003400418.1.26349 WP_003400418.1.26366 WP_003400418.1.26374 WP_003400418.1.26407 WP_003400418.1.26412 WP_003400418.1.26454 WP_003400418.1.26464 WP_003400418.1.2653 WP_003400418.1.26560 WP_003400418.1.26571 WP_003400418.1.2659 WP_003400418.1.26597 WP_003400418.1.26603 WP_003400418.1.26629 WP_003400418.1.26651 WP_003400418.1.26702 WP_003400418.1.26707 WP_003400418.1.26710 WP_003400418.1.26719 WP_003400418.1.26737 WP_003400418.1.26738 WP_003400418.1.26745 WP_003400418.1.26756 WP_003400418.1.2676 WP_003400418.1.2677 WP_003400418.1.26779 WP_003400418.1.26780 WP_003400418.1.26798 WP_003400418.1.26854 WP_003400418.1.26868 WP_003400418.1.26876 WP_003400418.1.26888 WP_003400418.1.26914 WP_003400418.1.26945 WP_003400418.1.26959 WP_003400418.1.26969 WP_003400418.1.26984 WP_003400418.1.26992 WP_003400418.1.27004 WP_003400418.1.27017 WP_003400418.1.27045 WP_003400418.1.27074 WP_003400418.1.27075 WP_003400418.1.27128 WP_003400418.1.27130 WP_003400418.1.27139 WP_003400418.1.27152 WP_003400418.1.27162 WP_003400418.1.27164 WP_003400418.1.27193 WP_003400418.1.27235 WP_003400418.1.27254 WP_003400418.1.27278 WP_003400418.1.27343 WP_003400418.1.27352 WP_003400418.1.27369 WP_003400418.1.27391 WP_003400418.1.27398 WP_003400418.1.27402 WP_003400418.1.27410 WP_003400418.1.27411 WP_003400418.1.27449 WP_003400418.1.27460 WP_003400418.1.27463 WP_003400418.1.2749 WP_003400418.1.27492 WP_003400418.1.27528 WP_003400418.1.27541 WP_003400418.1.27576 WP_003400418.1.27582 WP_003400418.1.27596 WP_003400418.1.27607 WP_003400418.1.2766 WP_003400418.1.277 WP_003400418.1.27724 WP_003400418.1.27730 WP_003400418.1.27736 WP_003400418.1.27743 WP_003400418.1.27750 WP_003400418.1.27771 WP_003400418.1.27779 WP_003400418.1.27795 WP_003400418.1.27803 WP_003400418.1.27819 WP_003400418.1.27835 WP_003400418.1.27915 WP_003400418.1.27935 WP_003400418.1.27962 WP_003400418.1.28053 WP_003400418.1.28092 WP_003400418.1.28106 WP_003400418.1.28131 WP_003400418.1.28142 WP_003400418.1.28159 WP_003400418.1.2816 WP_003400418.1.28161 WP_003400418.1.28192 WP_003400418.1.28202 WP_003400418.1.28241 WP_003400418.1.28242 WP_003400418.1.28251 WP_003400418.1.28255 WP_003400418.1.28269 WP_003400418.1.28276 WP_003400418.1.28293 WP_003400418.1.28331 WP_003400418.1.28367 WP_003400418.1.28378 WP_003400418.1.28391 WP_003400418.1.2842 WP_003400418.1.28448 WP_003400418.1.2847 WP_003400418.1.28471 WP_003400418.1.28473 WP_003400418.1.28493 WP_003400418.1.28497 WP_003400418.1.28530 WP_003400418.1.28545 WP_003400418.1.28561 WP_003400418.1.28567 WP_003400418.1.28585 WP_003400418.1.286 WP_003400418.1.28610 WP_003400418.1.28617 WP_003400418.1.28634 WP_003400418.1.28642 WP_003400418.1.28671 WP_003400418.1.28682 WP_003400418.1.28698 WP_003400418.1.28703 WP_003400418.1.28739 WP_003400418.1.28758 WP_003400418.1.28781 WP_003400418.1.28787 WP_003400418.1.28827 WP_003400418.1.28839 WP_003400418.1.28847 WP_003400418.1.28850 WP_003400418.1.28851 WP_003400418.1.28865 WP_003400418.1.28897 WP_003400418.1.28914 WP_003400418.1.28935 WP_003400418.1.28936 WP_003400418.1.28939 WP_003400418.1.28943 WP_003400418.1.28952 WP_003400418.1.28975 WP_003400418.1.2899 WP_003400418.1.28993 WP_003400418.1.29000 WP_003400418.1.2901 WP_003400418.1.29033 WP_003400418.1.29058 WP_003400418.1.29078 WP_003400418.1.29115 WP_003400418.1.2916 WP_003400418.1.29217 WP_003400418.1.29223 WP_003400418.1.29234 WP_003400418.1.29264 WP_003400418.1.29275 WP_003400418.1.29339 WP_003400418.1.29348 WP_003400418.1.29364 WP_003400418.1.29367 WP_003400418.1.2938 WP_003400418.1.29399 WP_003400418.1.29426 WP_003400418.1.2944 WP_003400418.1.29449 WP_003400418.1.29450 WP_003400418.1.29452 WP_003400418.1.2949 WP_003400418.1.29510 WP_003400418.1.29515 WP_003400418.1.29525 WP_003400418.1.2953 WP_003400418.1.29559 WP_003400418.1.29587 WP_003400418.1.2959 WP_003400418.1.29592 WP_003400418.1.29599 WP_003400418.1.29611 WP_003400418.1.29632 WP_003400418.1.29649 WP_003400418.1.2965 WP_003400418.1.29659 WP_003400418.1.2969 WP_003400418.1.29696 WP_003400418.1.29698 WP_003400418.1.29718 WP_003400418.1.29742 WP_003400418.1.29745 WP_003400418.1.29747 WP_003400418.1.29769 WP_003400418.1.29825 WP_003400418.1.29830 WP_003400418.1.29847 WP_003400418.1.29861 WP_003400418.1.29869 WP_003400418.1.29883 WP_003400418.1.29890 WP_003400418.1.299 WP_003400418.1.29931 WP_003400418.1.29960 WP_003400418.1.30014 WP_003400418.1.3004 WP_003400418.1.30040 WP_003400418.1.30043 WP_003400418.1.30074 WP_003400418.1.30097 WP_003400418.1.30101 WP_003400418.1.30106 WP_003400418.1.30114 WP_003400418.1.30126 WP_003400418.1.30131 WP_003400418.1.30138 WP_003400418.1.30139 WP_003400418.1.30145 WP_003400418.1.30211 WP_003400418.1.30224 WP_003400418.1.30235 WP_003400418.1.30237 WP_003400418.1.3027 WP_003400418.1.30279 WP_003400418.1.30282 WP_003400418.1.30283 WP_003400418.1.30288 WP_003400418.1.30291 WP_003400418.1.30363 WP_003400418.1.30374 WP_003400418.1.30404 WP_003400418.1.3043 WP_003400418.1.30433 WP_003400418.1.30438 WP_003400418.1.30462 WP_003400418.1.30464 WP_003400418.1.30468 WP_003400418.1.30500 WP_003400418.1.3057 WP_003400418.1.30574 WP_003400418.1.30628 WP_003400418.1.30641 WP_003400418.1.30642 WP_003400418.1.30661 WP_003400418.1.30669 WP_003400418.1.30683 WP_003400418.1.30699 WP_003400418.1.30709 WP_003400418.1.30713 WP_003400418.1.30716 WP_003400418.1.30719 WP_003400418.1.30730 WP_003400418.1.30732 WP_003400418.1.30736 WP_003400418.1.30745 WP_003400418.1.30760 WP_003400418.1.30791 WP_003400418.1.308 WP_003400418.1.30807 WP_003400418.1.30818 WP_003400418.1.30824 WP_003400418.1.30848 WP_003400418.1.30877 WP_003400418.1.30888 WP_003400418.1.30901 WP_003400418.1.30903 WP_003400418.1.30912 WP_003400418.1.30913 WP_003400418.1.30914 WP_003400418.1.30919 WP_003400418.1.30977 WP_003400418.1.3100 WP_003400418.1.31002 WP_003400418.1.3101 WP_003400418.1.31034 WP_003400418.1.31047 WP_003400418.1.31070 WP_003400418.1.31074 WP_003400418.1.31102 WP_003400418.1.31127 WP_003400418.1.31184 WP_003400418.1.31199 WP_003400418.1.31226 WP_003400418.1.31230 WP_003400418.1.31233 WP_003400418.1.31263 WP_003400418.1.31264 WP_003400418.1.31270 WP_003400418.1.31287 WP_003400418.1.31290 WP_003400418.1.31304 WP_003400418.1.31346 WP_003400418.1.31348 WP_003400418.1.31354 WP_003400418.1.31390 WP_003400418.1.31414 WP_003400418.1.31417 WP_003400418.1.31428 WP_003400418.1.3143 WP_003400418.1.31458 WP_003400418.1.31483 WP_003400418.1.3149 WP_003400418.1.31498 WP_003400418.1.31507 WP_003400418.1.31537 WP_003400418.1.31548 WP_003400418.1.31569 WP_003400418.1.31573 WP_003400418.1.316 WP_003400418.1.31629 WP_003400418.1.31666 WP_003400418.1.31693 WP_003400418.1.31703 WP_003400418.1.31744 WP_003400418.1.31745 WP_003400418.1.31770 WP_003400418.1.31776 WP_003400418.1.31783 WP_003400418.1.318 WP_003400418.1.3184 WP_003400418.1.31840 WP_003400418.1.31880 WP_003400418.1.31911 WP_003400418.1.31930 WP_003400418.1.31932 WP_003400418.1.31955 WP_003400418.1.31985 WP_003400418.1.31991 WP_003400418.1.31995 WP_003400418.1.32004 WP_003400418.1.32039 WP_003400418.1.3204 WP_003400418.1.32045 WP_003400418.1.32071 WP_003400418.1.32098 WP_003400418.1.32132 WP_003400418.1.32157 WP_003400418.1.32164 WP_003400418.1.32179 WP_003400418.1.32198 WP_003400418.1.32297 WP_003400418.1.32317 WP_003400418.1.32383 WP_003400418.1.32400 WP_003400418.1.32403 WP_003400418.1.32416 WP_003400418.1.32421 WP_003400418.1.32433 WP_003400418.1.32461 WP_003400418.1.32482 WP_003400418.1.32503 WP_003400418.1.32556 WP_003400418.1.32562 WP_003400418.1.32569 WP_003400418.1.32592 WP_003400418.1.32620 WP_003400418.1.32647 WP_003400418.1.32653 WP_003400418.1.32654 WP_003400418.1.3268 WP_003400418.1.32695 WP_003400418.1.32706 WP_003400418.1.32716 WP_003400418.1.32738 WP_003400418.1.32752 WP_003400418.1.32780 WP_003400418.1.32781 WP_003400418.1.32793 WP_003400418.1.32799 WP_003400418.1.32822 WP_003400418.1.32833 WP_003400418.1.32862 WP_003400418.1.32880 WP_003400418.1.32897 WP_003400418.1.32909 WP_003400418.1.32935 WP_003400418.1.32974 WP_003400418.1.33007 WP_003400418.1.3302 WP_003400418.1.33028 WP_003400418.1.33035 WP_003400418.1.33044 WP_003400418.1.33054 WP_003400418.1.33082 WP_003400418.1.33141 WP_003400418.1.33148 WP_003400418.1.33155 WP_003400418.1.33168 WP_003400418.1.3321 WP_003400418.1.33215 WP_003400418.1.3325 WP_003400418.1.3327 WP_003400418.1.33278 WP_003400418.1.33288 WP_003400418.1.33305 WP_003400418.1.3331 WP_003400418.1.33319 WP_003400418.1.3333 WP_003400418.1.33393 WP_003400418.1.33403 WP_003400418.1.33452 WP_003400418.1.33467 WP_003400418.1.33477 WP_003400418.1.3349 WP_003400418.1.33519 WP_003400418.1.33542 WP_003400418.1.33601 WP_003400418.1.33602 WP_003400418.1.33633 WP_003400418.1.33646 WP_003400418.1.33673 WP_003400418.1.3369 WP_003400418.1.33705 WP_003400418.1.33762 WP_003400418.1.33783 WP_003400418.1.33789 WP_003400418.1.3383 WP_003400418.1.33832 WP_003400418.1.33839 WP_003400418.1.33848 WP_003400418.1.3387 WP_003400418.1.33886 WP_003400418.1.33895 WP_003400418.1.33906 WP_003400418.1.33912 WP_003400418.1.33954 WP_003400418.1.3399 WP_003400418.1.34042 WP_003400418.1.3405 WP_003400418.1.34055 WP_003400418.1.34056 WP_003400418.1.34065 WP_003400418.1.3408 WP_003400418.1.34090 WP_003400418.1.34109 WP_003400418.1.34111 WP_003400418.1.34131 WP_003400418.1.34152 WP_003400418.1.34153 WP_003400418.1.34163 WP_003400418.1.34181 WP_003400418.1.34197 WP_003400418.1.34198 WP_003400418.1.34215 WP_003400418.1.34219 WP_003400418.1.34255 WP_003400418.1.34260 WP_003400418.1.34275 WP_003400418.1.343 WP_003400418.1.34347 WP_003400418.1.34358 WP_003400418.1.34392 WP_003400418.1.344 WP_003400418.1.34428 WP_003400418.1.3443 WP_003400418.1.34435 WP_003400418.1.34446 WP_003400418.1.34499 WP_003400418.1.34505 WP_003400418.1.34516 WP_003400418.1.34529 WP_003400418.1.34551 WP_003400418.1.34563 WP_003400418.1.34576 WP_003400418.1.34581 WP_003400418.1.34588 WP_003400418.1.34596 WP_003400418.1.34599 WP_003400418.1.34639 WP_003400418.1.34724 WP_003400418.1.34740 WP_003400418.1.34755 WP_003400418.1.34777 WP_003400418.1.34783 WP_003400418.1.34841 WP_003400418.1.34908 WP_003400418.1.34919 WP_003400418.1.3492 WP_003400418.1.34933 WP_003400418.1.34945 WP_003400418.1.34946 WP_003400418.1.34954 WP_003400418.1.34960 WP_003400418.1.34961 WP_003400418.1.34963 WP_003400418.1.34965 WP_003400418.1.34968 WP_003400418.1.35023 WP_003400418.1.35069 WP_003400418.1.35072 WP_003400418.1.35078 WP_003400418.1.35100 WP_003400418.1.35146 WP_003400418.1.35156 WP_003400418.1.35160 WP_003400418.1.35162 WP_003400418.1.35173 WP_003400418.1.35176 WP_003400418.1.3520 WP_003400418.1.35213 WP_003400418.1.35221 WP_003400418.1.35246 WP_003400418.1.35278 WP_003400418.1.35301 WP_003400418.1.35311 WP_003400418.1.35312 WP_003400418.1.35317 WP_003400418.1.35319 WP_003400418.1.35347 WP_003400418.1.35363 WP_003400418.1.35382 WP_003400418.1.35385 WP_003400418.1.35396 WP_003400418.1.35426 WP_003400418.1.35439 WP_003400418.1.35455 WP_003400418.1.3548 WP_003400418.1.35484 WP_003400418.1.35492 WP_003400418.1.3553 WP_003400418.1.35553 WP_003400418.1.35555 WP_003400418.1.35561 WP_003400418.1.35602 WP_003400418.1.35610 WP_003400418.1.35635 WP_003400418.1.35657 WP_003400418.1.35680 WP_003400418.1.35687 WP_003400418.1.35689 WP_003400418.1.35707 WP_003400418.1.35732 WP_003400418.1.35754 WP_003400418.1.35767 WP_003400418.1.35770 WP_003400418.1.35771 WP_003400418.1.35780 WP_003400418.1.35805 WP_003400418.1.35811 WP_003400418.1.35821 WP_003400418.1.3584 WP_003400418.1.35848 WP_003400418.1.35864 WP_003400418.1.35874 WP_003400418.1.35876 WP_003400418.1.35897 WP_003400418.1.35923 WP_003400418.1.35954 WP_003400418.1.36005 WP_003400418.1.36014 WP_003400418.1.36023 WP_003400418.1.36051 WP_003400418.1.36053 WP_003400418.1.36075 WP_003400418.1.36089 WP_003400418.1.36097 WP_003400418.1.36116 WP_003400418.1.36145 WP_003400418.1.36156 WP_003400418.1.36205 WP_003400418.1.36228 WP_003400418.1.36246 WP_003400418.1.36252 WP_003400418.1.36260 WP_003400418.1.36270 WP_003400418.1.36271 WP_003400418.1.36303 WP_003400418.1.36309 WP_003400418.1.36315 WP_003400418.1.36319 WP_003400418.1.36321 WP_003400418.1.36326 WP_003400418.1.3634 WP_003400418.1.36356 WP_003400418.1.36357 WP_003400418.1.3636 WP_003400418.1.36385 WP_003400418.1.36399 WP_003400418.1.36436 WP_003400418.1.36465 WP_003400418.1.36469 WP_003400418.1.36473 WP_003400418.1.36485 WP_003400418.1.36508 WP_003400418.1.36540 WP_003400418.1.36561 WP_003400418.1.36571 WP_003400418.1.36573 WP_003400418.1.36578 WP_003400418.1.36585 WP_003400418.1.36597 WP_003400418.1.36614 WP_003400418.1.36657 WP_003400418.1.36674 WP_003400418.1.36720 WP_003400418.1.36727 WP_003400418.1.36733 WP_003400418.1.36785 WP_003400418.1.36810 WP_003400418.1.36844 WP_003400418.1.36851 WP_003400418.1.36862 WP_003400418.1.36893 WP_003400418.1.36901 WP_003400418.1.36921 WP_003400418.1.36935 WP_003400418.1.36941 WP_003400418.1.3695 WP_003400418.1.36951 WP_003400418.1.36968 WP_003400418.1.3700 WP_003400418.1.37004 WP_003400418.1.37012 WP_003400418.1.37071 WP_003400418.1.37088 WP_003400418.1.37131 WP_003400418.1.37157 WP_003400418.1.37175 WP_003400418.1.37188 WP_003400418.1.37213 WP_003400418.1.37229 WP_003400418.1.3724 WP_003400418.1.37277 WP_003400418.1.37305 WP_003400418.1.37330 WP_003400418.1.37389 WP_003400418.1.37400 WP_003400418.1.37440 WP_003400418.1.37459 WP_003400418.1.37468 WP_003400418.1.37475 WP_003400418.1.37484 WP_003400418.1.37601 WP_003400418.1.37612 WP_003400418.1.37632 WP_003400418.1.37643 WP_003400418.1.37655 WP_003400418.1.37660 WP_003400418.1.37674 WP_003400418.1.37700 WP_003400418.1.37701 WP_003400418.1.37709 WP_003400418.1.37711 WP_003400418.1.37721 WP_003400418.1.37722 WP_003400418.1.37747 WP_003400418.1.37765 WP_003400418.1.37772 WP_003400418.1.37804 WP_003400418.1.37809 WP_003400418.1.37859 WP_003400418.1.37877 WP_003400418.1.37912 WP_003400418.1.37913 WP_003400418.1.37943 WP_003400418.1.37950 WP_003400418.1.37973 WP_003400418.1.37975 WP_003400418.1.37983 WP_003400418.1.38 WP_003400418.1.38002 WP_003400418.1.3802 WP_003400418.1.38039 WP_003400418.1.38040 WP_003400418.1.38067 WP_003400418.1.38068 WP_003400418.1.38135 WP_003400418.1.38138 WP_003400418.1.38144 WP_003400418.1.38158 WP_003400418.1.38159 WP_003400418.1.38210 WP_003400418.1.38233 WP_003400418.1.38240 WP_003400418.1.38299 WP_003400418.1.38332 WP_003400418.1.38347 WP_003400418.1.38354 WP_003400418.1.38380 WP_003400418.1.38384 WP_003400418.1.38389 WP_003400418.1.38398 WP_003400418.1.38402 WP_003400418.1.38418 WP_003400418.1.38421 WP_003400418.1.38466 WP_003400418.1.38477 WP_003400418.1.38483 WP_003400418.1.3849 WP_003400418.1.385 WP_003400418.1.38530 WP_003400418.1.38535 WP_003400418.1.38594 WP_003400418.1.38601 WP_003400418.1.38611 WP_003400418.1.38638 WP_003400418.1.38639 WP_003400418.1.38646 WP_003400418.1.38648 WP_003400418.1.38654 WP_003400418.1.38659 WP_003400418.1.38660 WP_003400418.1.38666 WP_003400418.1.38671 WP_003400418.1.38672 WP_003400418.1.38677 WP_003400418.1.38750 WP_003400418.1.38772 WP_003400418.1.38812 WP_003400418.1.38821 WP_003400418.1.38844 WP_003400418.1.38863 WP_003400418.1.38865 WP_003400418.1.38873 WP_003400418.1.3889 WP_003400418.1.38894 WP_003400418.1.38909 WP_003400418.1.38939 WP_003400418.1.38974 WP_003400418.1.38975 WP_003400418.1.38991 WP_003400418.1.39025 WP_003400418.1.39070 WP_003400418.1.39095 WP_003400418.1.39106 WP_003400418.1.39165 WP_003400418.1.39174 WP_003400418.1.39176 WP_003400418.1.39178 WP_003400418.1.39190 WP_003400418.1.39201 WP_003400418.1.39207 WP_003400418.1.39211 WP_003400418.1.39236 WP_003400418.1.39239 WP_003400418.1.39252 WP_003400418.1.39288 WP_003400418.1.39295 WP_003400418.1.39306 WP_003400418.1.39359 WP_003400418.1.39364 WP_003400418.1.39400 WP_003400418.1.39447 WP_003400418.1.3945 WP_003400418.1.39450 WP_003400418.1.39455 WP_003400418.1.3949 WP_003400418.1.39521 WP_003400418.1.39560 WP_003400418.1.39592 WP_003400418.1.39593 WP_003400418.1.396 WP_003400418.1.3960 WP_003400418.1.39616 WP_003400418.1.39654 WP_003400418.1.39657 WP_003400418.1.39661 WP_003400418.1.39674 WP_003400418.1.39678 WP_003400418.1.3968 WP_003400418.1.39694 WP_003400418.1.3971 WP_003400418.1.39718 WP_003400418.1.39728 WP_003400418.1.39739 WP_003400418.1.39748 WP_003400418.1.39751 WP_003400418.1.39759 WP_003400418.1.39801 WP_003400418.1.39804 WP_003400418.1.39848 WP_003400418.1.39877 WP_003400418.1.39925 WP_003400418.1.3994 WP_003400418.1.39959 WP_003400418.1.3996 WP_003400418.1.39960 WP_003400418.1.3997 WP_003400418.1.39980 WP_003400418.1.40000 WP_003400418.1.40028 WP_003400418.1.40029 WP_003400418.1.4003 WP_003400418.1.40094 WP_003400418.1.40096 WP_003400418.1.40150 WP_003400418.1.40156 WP_003400418.1.40174 WP_003400418.1.40186 WP_003400418.1.40276 WP_003400418.1.40277 WP_003400418.1.40323 WP_003400418.1.40336 WP_003400418.1.40353 WP_003400418.1.4036 WP_003400418.1.40372 WP_003400418.1.40402 WP_003400418.1.40413 WP_003400418.1.40440 WP_003400418.1.40446 WP_003400418.1.40451 WP_003400418.1.40455 WP_003400418.1.40523 WP_003400418.1.40543 WP_003400418.1.40641 WP_003400418.1.40646 WP_003400418.1.40651 WP_003400418.1.40653 WP_003400418.1.4067 WP_003400418.1.40705 WP_003400418.1.40723 WP_003400418.1.40731 WP_003400418.1.40735 WP_003400418.1.40795 WP_003400418.1.40799 WP_003400418.1.40852 WP_003400418.1.40876 WP_003400418.1.40881 WP_003400418.1.40922 WP_003400418.1.40948 WP_003400418.1.4095 WP_003400418.1.40956 WP_003400418.1.40957 WP_003400418.1.40964 WP_003400418.1.4097 WP_003400418.1.410 WP_003400418.1.41000 WP_003400418.1.41055 WP_003400418.1.41108 WP_003400418.1.41123 WP_003400418.1.41177 WP_003400418.1.41202 WP_003400418.1.41219 WP_003400418.1.41231 WP_003400418.1.41249 WP_003400418.1.4127 WP_003400418.1.41296 WP_003400418.1.41355 WP_003400418.1.41376 WP_003400418.1.41430 WP_003400418.1.41447 WP_003400418.1.41469 WP_003400418.1.41504 WP_003400418.1.41553 WP_003400418.1.41564 WP_003400418.1.41583 WP_003400418.1.41616 WP_003400418.1.41632 WP_003400418.1.41635 WP_003400418.1.41636 WP_003400418.1.41648 WP_003400418.1.41660 WP_003400418.1.41685 WP_003400418.1.41695 WP_003400418.1.41704 WP_003400418.1.4171 WP_003400418.1.41719 WP_003400418.1.41733 WP_003400418.1.41744 WP_003400418.1.41774 WP_003400418.1.41791 WP_003400418.1.41803 WP_003400418.1.41820 WP_003400418.1.41828 WP_003400418.1.41829 WP_003400418.1.41860 WP_003400418.1.41912 WP_003400418.1.41921 WP_003400418.1.41933 WP_003400418.1.41944 WP_003400418.1.42043 WP_003400418.1.42075 WP_003400418.1.42078 WP_003400418.1.42094 WP_003400418.1.42112 WP_003400418.1.4212 WP_003400418.1.42122 WP_003400418.1.42134 WP_003400418.1.42183 WP_003400418.1.42188 WP_003400418.1.42201 WP_003400418.1.42202 WP_003400418.1.42208 WP_003400418.1.42247 WP_003400418.1.42255 WP_003400418.1.42273 WP_003400418.1.42278 WP_003400418.1.42304 WP_003400418.1.42309 WP_003400418.1.42370 WP_003400418.1.42385 WP_003400418.1.42400 WP_003400418.1.42409 WP_003400418.1.42414 WP_003400418.1.42417 WP_003400418.1.42430 WP_003400418.1.42461 WP_003400418.1.42465 WP_003400418.1.42467 WP_003400418.1.42473 WP_003400418.1.4248 WP_003400418.1.42494 WP_003400418.1.42519 WP_003400418.1.42524 WP_003400418.1.42534 WP_003400418.1.4255 WP_003400418.1.42562 WP_003400418.1.42568 WP_003400418.1.42570 WP_003400418.1.42618 WP_003400418.1.42660 WP_003400418.1.42695 WP_003400418.1.42704 WP_003400418.1.42705 WP_003400418.1.42722 WP_003400418.1.42777 WP_003400418.1.42782 WP_003400418.1.42835 WP_003400418.1.42839 WP_003400418.1.42842 WP_003400418.1.42905 WP_003400418.1.42916 WP_003400418.1.42930 WP_003400418.1.42971 WP_003400418.1.43005 WP_003400418.1.43009 WP_003400418.1.43053 WP_003400418.1.43082 WP_003400418.1.43087 WP_003400418.1.43098 WP_003400418.1.43208 WP_003400418.1.43236 WP_003400418.1.43246 WP_003400418.1.43255 WP_003400418.1.43266 WP_003400418.1.43269 WP_003400418.1.43273 WP_003400418.1.43296 WP_003400418.1.43306 WP_003400418.1.4335 WP_003400418.1.43368 WP_003400418.1.43395 WP_003400418.1.43457 WP_003400418.1.43462 WP_003400418.1.43475 WP_003400418.1.43478 WP_003400418.1.43484 WP_003400418.1.43557 WP_003400418.1.43578 WP_003400418.1.43588 WP_003400418.1.43643 WP_003400418.1.43664 WP_003400418.1.43684 WP_003400418.1.43686 WP_003400418.1.43706 WP_003400418.1.43716 WP_003400418.1.4377 WP_003400418.1.43781 WP_003400418.1.43794 WP_003400418.1.43815 WP_003400418.1.43846 WP_003400418.1.43861 WP_003400418.1.43863 WP_003400418.1.43866 WP_003400418.1.43872 WP_003400418.1.43885 WP_003400418.1.43897 WP_003400418.1.4390 WP_003400418.1.43902 WP_003400418.1.43921 WP_003400418.1.43936 WP_003400418.1.43937 WP_003400418.1.43960 WP_003400418.1.43965 WP_003400418.1.4399 WP_003400418.1.43993 WP_003400418.1.43996 WP_003400418.1.44 WP_003400418.1.44001 WP_003400418.1.44008 WP_003400418.1.44033 WP_003400418.1.44037 WP_003400418.1.44041 WP_003400418.1.44070 WP_003400418.1.44071 WP_003400418.1.44076 WP_003400418.1.44104 WP_003400418.1.44111 WP_003400418.1.44124 WP_003400418.1.44169 WP_003400418.1.44219 WP_003400418.1.44237 WP_003400418.1.44279 WP_003400418.1.44336 WP_003400418.1.44355 WP_003400418.1.44358 WP_003400418.1.4438 WP_003400418.1.44390 WP_003400418.1.44392 WP_003400418.1.4441 WP_003400418.1.44415 WP_003400418.1.44464 WP_003400418.1.44466 WP_003400418.1.44489 WP_003400418.1.44492 WP_003400418.1.44494 WP_003400418.1.44500 WP_003400418.1.44519 WP_003400418.1.44526 WP_003400418.1.44532 WP_003400418.1.44534 WP_003400418.1.44562 WP_003400418.1.44589 WP_003400418.1.44597 WP_003400418.1.44600 WP_003400418.1.44602 WP_003400418.1.44615 WP_003400418.1.4464 WP_003400418.1.44651 WP_003400418.1.44659 WP_003400418.1.44665 WP_003400418.1.44694 WP_003400418.1.44700 WP_003400418.1.44713 WP_003400418.1.44735 WP_003400418.1.44740 WP_003400418.1.44757 WP_003400418.1.4476 WP_003400418.1.44761 WP_003400418.1.44767 WP_003400418.1.44776 WP_003400418.1.44779 WP_003400418.1.44786 WP_003400418.1.44808 WP_003400418.1.44864 WP_003400418.1.44901 WP_003400418.1.44908 WP_003400418.1.44913 WP_003400418.1.4492 WP_003400418.1.44939 WP_003400418.1.44979 WP_003400418.1.44981 WP_003400418.1.45002 WP_003400418.1.45011 WP_003400418.1.4504 WP_003400418.1.45062 WP_003400418.1.45066 WP_003400418.1.45081 WP_003400418.1.45113 WP_003400418.1.45129 WP_003400418.1.45135 WP_003400418.1.45147 WP_003400418.1.45168 WP_003400418.1.4517 WP_003400418.1.45181 WP_003400418.1.45185 WP_003400418.1.45192 WP_003400418.1.45200 WP_003400418.1.45205 WP_003400418.1.45211 WP_003400418.1.45249 WP_003400418.1.4526 WP_003400418.1.45286 WP_003400418.1.45326 WP_003400418.1.45347 WP_003400418.1.45374 WP_003400418.1.45390 WP_003400418.1.454 WP_003400418.1.45407 WP_003400418.1.45451 WP_003400418.1.45453 WP_003400418.1.45460 WP_003400418.1.45463 WP_003400418.1.45470 WP_003400418.1.45474 WP_003400418.1.45491 WP_003400418.1.45510 WP_003400418.1.45563 WP_003400418.1.45584 WP_003400418.1.45590 WP_003400418.1.45619 WP_003400418.1.45626 WP_003400418.1.45631 WP_003400418.1.45666 WP_003400418.1.45697 WP_003400418.1.4571 WP_003400418.1.45731 WP_003400418.1.45743 WP_003400418.1.45765 WP_003400418.1.45776 WP_003400418.1.45783 WP_003400418.1.45805 WP_003400418.1.45815 WP_003400418.1.45849 WP_003400418.1.45867 WP_003400418.1.45884 WP_003400418.1.4590 WP_003400418.1.45923 WP_003400418.1.45926 WP_003400418.1.45963 WP_003400418.1.45989 WP_003400418.1.45992 WP_003400418.1.46025 WP_003400418.1.46083 WP_003400418.1.46090 WP_003400418.1.46092 WP_003400418.1.46100 WP_003400418.1.46101 WP_003400418.1.46103 WP_003400418.1.46107 WP_003400418.1.46127 WP_003400418.1.46128 WP_003400418.1.46129 WP_003400418.1.46141 WP_003400418.1.46150 WP_003400418.1.46201 WP_003400418.1.46226 WP_003400418.1.4624 WP_003400418.1.46253 WP_003400418.1.46268 WP_003400418.1.46285 WP_003400418.1.46300 WP_003400418.1.46313 WP_003400418.1.46336 WP_003400418.1.46365 WP_003400418.1.46370 WP_003400418.1.46381 WP_003400418.1.46402 WP_003400418.1.46411 WP_003400418.1.4644 WP_003400418.1.46442 WP_003400418.1.46453 WP_003400418.1.46463 WP_003400418.1.46478 WP_003400418.1.46492 WP_003400418.1.46521 WP_003400418.1.4653 WP_003400418.1.46532 WP_003400418.1.46539 WP_003400418.1.46568 WP_003400418.1.46585 WP_003400418.1.46609 WP_003400418.1.46613 WP_003400418.1.46625 WP_003400418.1.46642 WP_003400418.1.46647 WP_003400418.1.46674 WP_003400418.1.46724 WP_003400418.1.46758 WP_003400418.1.46773 WP_003400418.1.46777 WP_003400418.1.46786 WP_003400418.1.46792 WP_003400418.1.46847 WP_003400418.1.46851 WP_003400418.1.4687 WP_003400418.1.46897 WP_003400418.1.46936 WP_003400418.1.46980 WP_003400418.1.47011 WP_003400418.1.47012 WP_003400418.1.47066 WP_003400418.1.47077 WP_003400418.1.47083 WP_003400418.1.47106 WP_003400418.1.47142 WP_003400418.1.47147 WP_003400418.1.47166 WP_003400418.1.47178 WP_003400418.1.47179 WP_003400418.1.47194 WP_003400418.1.47207 WP_003400418.1.47210 WP_003400418.1.47261 WP_003400418.1.47262 WP_003400418.1.47402 WP_003400418.1.47423 WP_003400418.1.47467 WP_003400418.1.47502 WP_003400418.1.4751 WP_003400418.1.47511 WP_003400418.1.47537 WP_003400418.1.47540 WP_003400418.1.47568 WP_003400418.1.47572 WP_003400418.1.47588 WP_003400418.1.47636 WP_003400418.1.4764 WP_003400418.1.47653 WP_003400418.1.47679 WP_003400418.1.47681 WP_003400418.1.47690 WP_003400418.1.4771 WP_003400418.1.47717 WP_003400418.1.47743 WP_003400418.1.47754 WP_003400418.1.47773 WP_003400418.1.47776 WP_003400418.1.47780 WP_003400418.1.47805 WP_003400418.1.47832 WP_003400418.1.47847 WP_003400418.1.47858 WP_003400418.1.47861 WP_003400418.1.47868 WP_003400418.1.47893 WP_003400418.1.47899 WP_003400418.1.479 WP_003400418.1.47912 WP_003400418.1.47913 WP_003400418.1.47926 WP_003400418.1.4794 WP_003400418.1.47943 WP_003400418.1.47944 WP_003400418.1.47959 WP_003400418.1.47974 WP_003400418.1.47993 WP_003400418.1.48004 WP_003400418.1.48039 WP_003400418.1.48050 WP_003400418.1.48084 WP_003400418.1.48097 WP_003400418.1.48101 WP_003400418.1.48109 WP_003400418.1.4813 WP_003400418.1.48130 WP_003400418.1.48135 WP_003400418.1.48143 WP_003400418.1.48152 WP_003400418.1.48155 WP_003400418.1.48170 WP_003400418.1.48173 WP_003400418.1.48177 WP_003400418.1.48185 WP_003400418.1.48204 WP_003400418.1.48219 WP_003400418.1.4823 WP_003400418.1.48240 WP_003400418.1.48256 WP_003400418.1.48264 WP_003400418.1.48287 WP_003400418.1.48330 WP_003400418.1.48333 WP_003400418.1.48348 WP_003400418.1.48354 WP_003400418.1.48372 WP_003400418.1.48383 WP_003400418.1.48388 WP_003400418.1.48419 WP_003400418.1.48423 WP_003400418.1.48443 WP_003400418.1.48450 WP_003400418.1.48462 WP_003400418.1.48543 WP_003400418.1.48550 WP_003400418.1.48605 WP_003400418.1.48618 WP_003400418.1.4863 WP_003400418.1.48648 WP_003400418.1.48658 WP_003400418.1.48666 WP_003400418.1.48687 WP_003400418.1.48779 WP_003400418.1.4878 WP_003400418.1.48798 WP_003400418.1.48802 WP_003400418.1.48826 WP_003400418.1.48831 WP_003400418.1.48843 WP_003400418.1.48857 WP_003400418.1.4890 WP_003400418.1.48946 WP_003400418.1.48979 WP_003400418.1.49017 WP_003400418.1.49048 WP_003400418.1.49059 WP_003400418.1.4906 WP_003400418.1.4907 WP_003400418.1.49103 WP_003400418.1.49110 WP_003400418.1.49111 WP_003400418.1.4919 WP_003400418.1.49251 WP_003400418.1.49254 WP_003400418.1.49263 WP_003400418.1.49291 WP_003400418.1.49296 WP_003400418.1.49335 WP_003400418.1.49337 WP_003400418.1.49419 WP_003400418.1.49426 WP_003400418.1.49437 WP_003400418.1.49439 WP_003400418.1.49474 WP_003400418.1.49506 WP_003400418.1.49516 WP_003400418.1.49523 WP_003400418.1.49526 WP_003400418.1.49532 WP_003400418.1.49588 WP_003400418.1.4959 WP_003400418.1.49678 WP_003400418.1.49687 WP_003400418.1.49699 WP_003400418.1.49709 WP_003400418.1.4971 WP_003400418.1.4972 WP_003400418.1.49736 WP_003400418.1.49746 WP_003400418.1.49764 WP_003400418.1.49773 WP_003400418.1.49796 WP_003400418.1.49814 WP_003400418.1.49815 WP_003400418.1.49816 WP_003400418.1.49839 WP_003400418.1.49857 WP_003400418.1.49878 WP_003400418.1.49880 WP_003400418.1.49944 WP_003400418.1.4999 WP_003400418.1.49990 WP_003400418.1.50068 WP_003400418.1.50077 WP_003400418.1.5008 WP_003400418.1.50081 WP_003400418.1.50122 WP_003400418.1.50126 WP_003400418.1.50149 WP_003400418.1.50162 WP_003400418.1.5018 WP_003400418.1.50194 WP_003400418.1.50218 WP_003400418.1.50235 WP_003400418.1.50249 WP_003400418.1.50265 WP_003400418.1.50271 WP_003400418.1.50324 WP_003400418.1.50347 WP_003400418.1.50372 WP_003400418.1.50398 WP_003400418.1.50407 WP_003400418.1.50466 WP_003400418.1.50472 WP_003400418.1.5048 WP_003400418.1.50498 WP_003400418.1.5050 WP_003400418.1.50540 WP_003400418.1.50554 WP_003400418.1.50557 WP_003400418.1.50601 WP_003400418.1.50610 WP_003400418.1.50632 WP_003400418.1.50633 WP_003400418.1.50642 WP_003400418.1.50655 WP_003400418.1.50659 WP_003400418.1.50683 WP_003400418.1.50689 WP_003400418.1.50692 WP_003400418.1.50714 WP_003400418.1.50729 WP_003400418.1.50756 WP_003400418.1.50784 WP_003400418.1.50794 WP_003400418.1.50841 WP_003400418.1.50860 WP_003400418.1.50868 WP_003400418.1.50877 WP_003400418.1.5096 WP_003400418.1.50981 WP_003400418.1.50987 WP_003400418.1.51003 WP_003400418.1.51009 WP_003400418.1.51037 WP_003400418.1.51074 WP_003400418.1.51082 WP_003400418.1.51101 WP_003400418.1.51116 WP_003400418.1.51149 WP_003400418.1.51156 WP_003400418.1.51157 WP_003400418.1.51213 WP_003400418.1.51232 WP_003400418.1.51239 WP_003400418.1.51247 WP_003400418.1.51266 WP_003400418.1.51279 WP_003400418.1.51291 WP_003400418.1.51294 WP_003400418.1.51301 WP_003400418.1.51329 WP_003400418.1.51391 WP_003400418.1.51422 WP_003400418.1.51445 WP_003400418.1.51455 WP_003400418.1.51466 WP_003400418.1.51468 WP_003400418.1.51478 WP_003400418.1.51497 WP_003400418.1.51520 WP_003400418.1.51593 WP_003400418.1.51628 WP_003400418.1.5164 WP_003400418.1.51647 WP_003400418.1.51660 WP_003400418.1.51696 WP_003400418.1.51721 WP_003400418.1.51788 WP_003400418.1.51795 WP_003400418.1.51801 WP_003400418.1.51817 WP_003400418.1.51819 WP_003400418.1.51854 WP_003400418.1.51923 WP_003400418.1.51942 WP_003400418.1.51948 WP_003400418.1.51963 WP_003400418.1.51969 WP_003400418.1.52000 WP_003400418.1.52001 WP_003400418.1.52003 WP_003400418.1.52006 WP_003400418.1.52036 WP_003400418.1.52038 WP_003400418.1.52046 WP_003400418.1.52059 WP_003400418.1.52069 WP_003400418.1.52082 WP_003400418.1.52102 WP_003400418.1.52106 WP_003400418.1.52166 WP_003400418.1.52168 WP_003400418.1.52173 WP_003400418.1.52178 WP_003400418.1.52206 WP_003400418.1.52216 WP_003400418.1.52238 WP_003400418.1.52241 WP_003400418.1.52280 WP_003400418.1.52314 WP_003400418.1.52385 WP_003400418.1.52390 WP_003400418.1.524 WP_003400418.1.52460 WP_003400418.1.52485 WP_003400418.1.52486 WP_003400418.1.52495 WP_003400418.1.52504 WP_003400418.1.52522 WP_003400418.1.52531 WP_003400418.1.52533 WP_003400418.1.52545 WP_003400418.1.52553 WP_003400418.1.52563 WP_003400418.1.52564 WP_003400418.1.52574 WP_003400418.1.52641 WP_003400418.1.52673 WP_003400418.1.52674 WP_003400418.1.52708 WP_003400418.1.52713 WP_003400418.1.52761 WP_003400418.1.52778 WP_003400418.1.52791 WP_003400418.1.52797 WP_003400418.1.52818 WP_003400418.1.52872 WP_003400418.1.52873 WP_003400418.1.52891 WP_003400418.1.52892 WP_003400418.1.52909 WP_003400418.1.52970 WP_003400418.1.52998 WP_003400418.1.53053 WP_003400418.1.53056 WP_003400418.1.5306 WP_003400418.1.53088 WP_003400418.1.5309 WP_003400418.1.531 WP_003400418.1.53117 WP_003400418.1.53118 WP_003400418.1.53142 WP_003400418.1.53143 WP_003400418.1.53157 WP_003400418.1.53167 WP_003400418.1.53200 WP_003400418.1.53204 WP_003400418.1.53213 WP_003400418.1.53217 WP_003400418.1.53229 WP_003400418.1.53230 WP_003400418.1.53237 WP_003400418.1.53254 WP_003400418.1.53257 WP_003400418.1.5327 WP_003400418.1.53276 WP_003400418.1.53278 WP_003400418.1.533 WP_003400418.1.53302 WP_003400418.1.53306 WP_003400418.1.5334 WP_003400418.1.5335 WP_003400418.1.53353 WP_003400418.1.53381 WP_003400418.1.53413 WP_003400418.1.53458 WP_003400418.1.53460 WP_003400418.1.53480 WP_003400418.1.53517 WP_003400418.1.53522 WP_003400418.1.53525 WP_003400418.1.53526 WP_003400418.1.53553 WP_003400418.1.53606 WP_003400418.1.53609 WP_003400418.1.53628 WP_003400418.1.53643 WP_003400418.1.53667 WP_003400418.1.53679 WP_003400418.1.53715 WP_003400418.1.53730 WP_003400418.1.53742 WP_003400418.1.53743 WP_003400418.1.53754 WP_003400418.1.53775 WP_003400418.1.53787 WP_003400418.1.53803 WP_003400418.1.53818 WP_003400418.1.53822 WP_003400418.1.53853 WP_003400418.1.53865 WP_003400418.1.53888 WP_003400418.1.53900 WP_003400418.1.53912 WP_003400418.1.53914 WP_003400418.1.53952 WP_003400418.1.5398 WP_003400418.1.5408 WP_003400418.1.54089 WP_003400418.1.54093 WP_003400418.1.54099 WP_003400418.1.54112 WP_003400418.1.54125 WP_003400418.1.54141 WP_003400418.1.54162 WP_003400418.1.54179 WP_003400418.1.54218 WP_003400418.1.54225 WP_003400418.1.54227 WP_003400418.1.54232 WP_003400418.1.54241 WP_003400418.1.54245 WP_003400418.1.54247 WP_003400418.1.54260 WP_003400418.1.54275 WP_003400418.1.54280 WP_003400418.1.5429 WP_003400418.1.54294 WP_003400418.1.54314 WP_003400418.1.54347 WP_003400418.1.54351 WP_003400418.1.54370 WP_003400418.1.54428 WP_003400418.1.54449 WP_003400418.1.54494 WP_003400418.1.54502 WP_003400418.1.54514 WP_003400418.1.54519 WP_003400418.1.5452 WP_003400418.1.54531 WP_003400418.1.54537 WP_003400418.1.54553 WP_003400418.1.54555 WP_003400418.1.54575 WP_003400418.1.54633 WP_003400418.1.54686 WP_003400418.1.54687 WP_003400418.1.54705 WP_003400418.1.54730 WP_003400418.1.54732 WP_003400418.1.5475 WP_003400418.1.54797 WP_003400418.1.54807 WP_003400418.1.54836 WP_003400418.1.54838 WP_003400418.1.54860 WP_003400418.1.54888 WP_003400418.1.54897 WP_003400418.1.54905 WP_003400418.1.54909 WP_003400418.1.54937 WP_003400418.1.54939 WP_003400418.1.54944 WP_003400418.1.54945 WP_003400418.1.54953 WP_003400418.1.54964 WP_003400418.1.55015 WP_003400418.1.55022 WP_003400418.1.55023 WP_003400418.1.55051 WP_003400418.1.55072 WP_003400418.1.55088 WP_003400418.1.55106 WP_003400418.1.55126 WP_003400418.1.55128 WP_003400418.1.55140 WP_003400418.1.55150 WP_003400418.1.55210 WP_003400418.1.55227 WP_003400418.1.55248 WP_003400418.1.55257 WP_003400418.1.55258 WP_003400418.1.55267 WP_003400418.1.55279 WP_003400418.1.55307 WP_003400418.1.55326 WP_003400418.1.55328 WP_003400418.1.5533 WP_003400418.1.55345 WP_003400418.1.55396 WP_003400418.1.55398 WP_003400418.1.55441 WP_003400418.1.55459 WP_003400418.1.55501 WP_003400418.1.55504 WP_003400418.1.55578 WP_003400418.1.55626 WP_003400418.1.55641 WP_003400418.1.5569 WP_003400418.1.55723 WP_003400418.1.55735 WP_003400418.1.5574 WP_003400418.1.55772 WP_003400418.1.55802 WP_003400418.1.55807 WP_003400418.1.55819 WP_003400418.1.55821 WP_003400418.1.5583 WP_003400418.1.55849 WP_003400418.1.55856 WP_003400418.1.55860 WP_003400418.1.55882 WP_003400418.1.55883 WP_003400418.1.55894 WP_003400418.1.55902 WP_003400418.1.55908 WP_003400418.1.55909 WP_003400418.1.5591 WP_003400418.1.55961 WP_003400418.1.55977 WP_003400418.1.55983 WP_003400418.1.56028 WP_003400418.1.56057 WP_003400418.1.56060 WP_003400418.1.56107 WP_003400418.1.56132 WP_003400418.1.56163 WP_003400418.1.56167 WP_003400418.1.56178 WP_003400418.1.56287 WP_003400418.1.56292 WP_003400418.1.56327 WP_003400418.1.56341 WP_003400418.1.56359 WP_003400418.1.56365 WP_003400418.1.56394 WP_003400418.1.56443 WP_003400418.1.56473 WP_003400418.1.56478 WP_003400418.1.56500 WP_003400418.1.56517 WP_003400418.1.56534 WP_003400418.1.5656 WP_003400418.1.56577 WP_003400418.1.56593 WP_003400418.1.56625 WP_003400418.1.56637 WP_003400418.1.56670 WP_003400418.1.56697 WP_003400418.1.567 WP_003400418.1.56701 WP_003400418.1.56709 WP_003400418.1.56729 WP_003400418.1.56743 WP_003400418.1.56755 WP_003400418.1.56764 WP_003400418.1.56769 WP_003400418.1.56770 WP_003400418.1.56795 WP_003400418.1.5681 WP_003400418.1.56827 WP_003400418.1.56839 WP_003400418.1.56863 WP_003400418.1.56868 WP_003400418.1.56869 WP_003400418.1.56915 WP_003400418.1.56926 WP_003400418.1.56961 WP_003400418.1.56971 WP_003400418.1.56972 WP_003400418.1.57023 WP_003400418.1.57035 WP_003400418.1.57077 WP_003400418.1.57087 WP_003400418.1.57094 WP_003400418.1.57134 WP_003400418.1.57151 WP_003400418.1.57169 WP_003400418.1.57208 WP_003400418.1.57212 WP_003400418.1.57230 WP_003400418.1.5724 WP_003400418.1.5725 WP_003400418.1.5727 WP_003400418.1.57273 WP_003400418.1.573 WP_003400418.1.57314 WP_003400418.1.57326 WP_003400418.1.57328 WP_003400418.1.57331 WP_003400418.1.57340 WP_003400418.1.57351 WP_003400418.1.57352 WP_003400418.1.57380 WP_003400418.1.57430 WP_003400418.1.5744 WP_003400418.1.57440 WP_003400418.1.5745 WP_003400418.1.57461 WP_003400418.1.57469 WP_003400418.1.57489 WP_003400418.1.575 WP_003400418.1.57509 WP_003400418.1.57519 WP_003400418.1.57525 WP_003400418.1.57551 WP_003400418.1.5758 WP_003400418.1.57596 WP_003400418.1.57604 WP_003400418.1.57616 WP_003400418.1.57617 WP_003400418.1.57619 WP_003400418.1.57627 WP_003400418.1.57642 WP_003400418.1.57658 WP_003400418.1.57667 WP_003400418.1.57675 WP_003400418.1.57689 WP_003400418.1.57708 WP_003400418.1.57794 WP_003400418.1.57821 WP_003400418.1.57825 WP_003400418.1.57843 WP_003400418.1.57906 WP_003400418.1.57924 WP_003400418.1.57926 WP_003400418.1.57930 WP_003400418.1.57957 WP_003400418.1.57960 WP_003400418.1.57964 WP_003400418.1.57991 WP_003400418.1.58000 WP_003400418.1.58086 WP_003400418.1.58101 WP_003400418.1.58103 WP_003400418.1.58108 WP_003400418.1.5811 WP_003400418.1.58121 WP_003400418.1.58145 WP_003400418.1.58164 WP_003400418.1.58174 WP_003400418.1.582 WP_003400418.1.58202 WP_003400418.1.58209 WP_003400418.1.58215 WP_003400418.1.5824 WP_003400418.1.58250 WP_003400418.1.58259 WP_003400418.1.58283 WP_003400418.1.58288 WP_003400418.1.5830 WP_003400418.1.58303 WP_003400418.1.58311 WP_003400418.1.58330 WP_003400418.1.58359 WP_003400418.1.58386 WP_003400418.1.58393 WP_003400418.1.58431 WP_003400418.1.5844 WP_003400418.1.58457 WP_003400418.1.58488 WP_003400418.1.58518 WP_003400418.1.58559 WP_003400418.1.58567 WP_003400418.1.58573 WP_003400418.1.58602 WP_003400418.1.58612 WP_003400418.1.58619 WP_003400418.1.58630 WP_003400418.1.5865 WP_003400418.1.58671 WP_003400418.1.58690 WP_003400418.1.58702 WP_003400418.1.58743 WP_003400418.1.58754 WP_003400418.1.5879 WP_003400418.1.5881 WP_003400418.1.58824 WP_003400418.1.58848 WP_003400418.1.58857 WP_003400418.1.58891 WP_003400418.1.58892 WP_003400418.1.5890 WP_003400418.1.58921 WP_003400418.1.58930 WP_003400418.1.58939 WP_003400418.1.58941 WP_003400418.1.58953 WP_003400418.1.58961 WP_003400418.1.5898 WP_003400418.1.59025 WP_003400418.1.59029 WP_003400418.1.59037 WP_003400418.1.59044 WP_003400418.1.59085 WP_003400418.1.59088 WP_003400418.1.59112 WP_003400418.1.59130 WP_003400418.1.5914 WP_003400418.1.59147 WP_003400418.1.59166 WP_003400418.1.59205 WP_003400418.1.59209 WP_003400418.1.59237 WP_003400418.1.59240 WP_003400418.1.59253 WP_003400418.1.59254 WP_003400418.1.59262 WP_003400418.1.59270 WP_003400418.1.5928 WP_003400418.1.59304 WP_003400418.1.59305 WP_003400418.1.59309 WP_003400418.1.59316 WP_003400418.1.59326 WP_003400418.1.59328 WP_003400418.1.59333 WP_003400418.1.59338 WP_003400418.1.59388 WP_003400418.1.59428 WP_003400418.1.59487 WP_003400418.1.59537 WP_003400418.1.59561 WP_003400418.1.59677 WP_003400418.1.59722 WP_003400418.1.59727 WP_003400418.1.59732 WP_003400418.1.59738 WP_003400418.1.59750 WP_003400418.1.59761 WP_003400418.1.59808 WP_003400418.1.59850 WP_003400418.1.59856 WP_003400418.1.59860 WP_003400418.1.59861 WP_003400418.1.5987 WP_003400418.1.59878 WP_003400418.1.59888 WP_003400418.1.59952 WP_003400418.1.5996 WP_003400418.1.59961 WP_003400418.1.59974 WP_003400418.1.6000 WP_003400418.1.60007 WP_003400418.1.60016 WP_003400418.1.6003 WP_003400418.1.60047 WP_003400418.1.6007 WP_003400418.1.60091 WP_003400418.1.60121 WP_003400418.1.60125 WP_003400418.1.60135 WP_003400418.1.60139 WP_003400418.1.60152 WP_003400418.1.60171 WP_003400418.1.60197 WP_003400418.1.6020 WP_003400418.1.60205 WP_003400418.1.60207 WP_003400418.1.60215 WP_003400418.1.60217 WP_003400418.1.60267 WP_003400418.1.60288 WP_003400418.1.60291 WP_003400418.1.60301 WP_003400418.1.60305 WP_003400418.1.60312 WP_003400418.1.60313 WP_003400418.1.60314 WP_003400418.1.60367 WP_003400418.1.60376 WP_003400418.1.60403 WP_003400418.1.60413 WP_003400418.1.60421 WP_003400418.1.60451 WP_003400418.1.60460 WP_003400418.1.60479 WP_003400418.1.60487 WP_003400418.1.60512 WP_003400418.1.60573 WP_003400418.1.60583 WP_003400418.1.60632 WP_003400418.1.60657 WP_003400418.1.60687 WP_003400418.1.60689 WP_003400418.1.60727 WP_003400418.1.60738 WP_003400418.1.60763 WP_003400418.1.6077 WP_003400418.1.60791 WP_003400418.1.60834 WP_003400418.1.60870 WP_003400418.1.60878 WP_003400418.1.60879 WP_003400418.1.60913 WP_003400418.1.60978 WP_003400418.1.61000 WP_003400418.1.61001 WP_003400418.1.61012 WP_003400418.1.61014 WP_003400418.1.61015 WP_003400418.1.61037 WP_003400418.1.61052 WP_003400418.1.61065 WP_003400418.1.61100 WP_003400418.1.61101 WP_003400418.1.61138 WP_003400418.1.61142 WP_003400418.1.61198 WP_003400418.1.612 WP_003400418.1.61234 WP_003400418.1.61256 WP_003400418.1.61281 WP_003400418.1.61314 WP_003400418.1.61321 WP_003400418.1.61326 WP_003400418.1.61328 WP_003400418.1.61368 WP_003400418.1.61391 WP_003400418.1.61406 WP_003400418.1.61409 WP_003400418.1.61420 WP_003400418.1.61422 WP_003400418.1.61425 WP_003400418.1.61428 WP_003400418.1.61469 WP_003400418.1.61494 WP_003400418.1.61522 WP_003400418.1.61552 WP_003400418.1.61557 WP_003400418.1.61567 WP_003400418.1.61571 WP_003400418.1.61573 WP_003400418.1.61584 WP_003400418.1.61586 WP_003400418.1.6159 WP_003400418.1.61592 WP_003400418.1.6160 WP_003400418.1.61614 WP_003400418.1.6163 WP_003400418.1.61655 WP_003400418.1.61665 WP_003400418.1.61669 WP_003400418.1.61682 WP_003400418.1.61692 WP_003400418.1.61719 WP_003400418.1.61728 WP_003400418.1.61750 WP_003400418.1.61754 WP_003400418.1.61755 WP_003400418.1.61757 WP_003400418.1.61778 WP_003400418.1.6179 WP_003400418.1.61793 WP_003400418.1.61816 WP_003400418.1.61842 WP_003400418.1.61850 WP_003400418.1.61862 WP_003400418.1.61865 WP_003400418.1.61868 WP_003400418.1.61911 WP_003400418.1.61925 WP_003400418.1.61941 WP_003400418.1.61953 WP_003400418.1.61979 WP_003400418.1.61986 WP_003400418.1.61987 WP_003400418.1.61998 WP_003400418.1.62021 WP_003400418.1.62087 WP_003400418.1.62089 WP_003400418.1.62101 WP_003400418.1.62104 WP_003400418.1.6211 WP_003400418.1.62132 WP_003400418.1.62162 WP_003400418.1.62225 WP_003400418.1.62230 WP_003400418.1.62238 WP_003400418.1.62249 WP_003400418.1.62270 WP_003400418.1.62281 WP_003400418.1.62307 WP_003400418.1.6231 WP_003400418.1.62359 WP_003400418.1.62360 WP_003400418.1.62371 WP_003400418.1.62379 WP_003400418.1.62395 WP_003400418.1.62408 WP_003400418.1.62449 WP_003400418.1.62468 WP_003400418.1.6248 WP_003400418.1.62508 WP_003400418.1.62565 WP_003400418.1.62594 WP_003400418.1.62606 WP_003400418.1.62616 WP_003400418.1.62666 WP_003400418.1.62687 WP_003400418.1.62715 WP_003400418.1.62730 WP_003400418.1.62738 WP_003400418.1.62761 WP_003400418.1.62766 WP_003400418.1.62786 WP_003400418.1.62813 WP_003400418.1.62839 WP_003400418.1.62841 WP_003400418.1.62909 WP_003400418.1.62936 WP_003400418.1.6294 WP_003400418.1.6295 WP_003400418.1.62962 WP_003400418.1.63007 WP_003400418.1.63019 WP_003400418.1.63032 WP_003400418.1.63037 WP_003400418.1.63064 WP_003400418.1.63066 WP_003400418.1.63072 WP_003400418.1.6308 WP_003400418.1.63081 WP_003400418.1.63096 WP_003400418.1.63106 WP_003400418.1.6314 WP_003400418.1.63144 WP_003400418.1.63154 WP_003400418.1.63160 WP_003400418.1.63161 WP_003400418.1.63166 WP_003400418.1.63175 WP_003400418.1.63194 WP_003400418.1.6322 WP_003400418.1.63222 WP_003400418.1.63247 WP_003400418.1.6328 WP_003400418.1.63291 WP_003400418.1.63312 WP_003400418.1.63317 WP_003400418.1.63331 WP_003400418.1.63373 WP_003400418.1.63384 WP_003400418.1.63403 WP_003400418.1.63424 WP_003400418.1.63428 WP_003400418.1.6345 WP_003400418.1.63464 WP_003400418.1.63483 WP_003400418.1.63502 WP_003400418.1.63504 WP_003400418.1.63522 WP_003400418.1.63530 WP_003400418.1.63538 WP_003400418.1.63564 WP_003400418.1.63567 WP_003400418.1.63596 WP_003400418.1.63600 WP_003400418.1.63623 WP_003400418.1.63624 WP_003400418.1.63625 WP_003400418.1.63627 WP_003400418.1.63654 WP_003400418.1.63662 WP_003400418.1.63711 WP_003400418.1.63734 WP_003400418.1.63807 WP_003400418.1.63819 WP_003400418.1.63844 WP_003400418.1.63888 WP_003400418.1.63913 WP_003400418.1.63915 WP_003400418.1.63918 WP_003400418.1.63961 WP_003400418.1.63970 WP_003400418.1.64000 WP_003400418.1.64027 WP_003400418.1.64058 WP_003400418.1.64065 WP_003400418.1.6407 WP_003400418.1.64082 WP_003400418.1.64091 WP_003400418.1.64102 WP_003400418.1.64104 WP_003400418.1.64119 WP_003400418.1.64169 WP_003400418.1.64219 WP_003400418.1.6422 WP_003400418.1.64222 WP_003400418.1.64223 WP_003400418.1.64228 WP_003400418.1.64235 WP_003400418.1.64249 WP_003400418.1.6427 WP_003400418.1.64278 WP_003400418.1.64287 WP_003400418.1.64414 WP_003400418.1.64419 WP_003400418.1.6443 WP_003400418.1.64463 WP_003400418.1.64480 WP_003400418.1.64497 WP_003400418.1.64506 WP_003400418.1.64511 WP_003400418.1.64513 WP_003400418.1.64514 WP_003400418.1.64515 WP_003400418.1.64522 WP_003400418.1.64543 WP_003400418.1.6456 WP_003400418.1.64567 WP_003400418.1.64588 WP_003400418.1.64589 WP_003400418.1.64594 WP_003400418.1.64595 WP_003400418.1.64608 WP_003400418.1.64619 WP_003400418.1.64629 WP_003400418.1.6464 WP_003400418.1.64664 WP_003400418.1.64669 WP_003400418.1.64672 WP_003400418.1.64680 WP_003400418.1.64682 WP_003400418.1.64727 WP_003400418.1.64729 WP_003400418.1.64774 WP_003400418.1.64776 WP_003400418.1.64802 WP_003400418.1.64832 WP_003400418.1.6486 WP_003400418.1.64870 WP_003400418.1.64922 WP_003400418.1.64924 WP_003400418.1.6493 WP_003400418.1.64937 WP_003400418.1.64941 WP_003400418.1.64966 WP_003400418.1.64973 WP_003400418.1.65001 WP_003400418.1.65026 WP_003400418.1.65053 WP_003400418.1.65070 WP_003400418.1.65079 WP_003400418.1.65102 WP_003400418.1.65157 WP_003400418.1.65181 WP_003400418.1.65212 WP_003400418.1.65229 WP_003400418.1.6523 WP_003400418.1.65253 WP_003400418.1.65289 WP_003400418.1.65291 WP_003400418.1.65315 WP_003400418.1.65329 WP_003400418.1.65359 WP_003400418.1.6536 WP_003400418.1.65374 WP_003400418.1.65386 WP_003400418.1.65414 WP_003400418.1.65416 WP_003400418.1.65433 WP_003400418.1.65455 WP_003400418.1.65467 WP_003400418.1.65488 WP_003400418.1.65529 WP_003400418.1.65539 WP_003400418.1.65583 WP_003400418.1.65612 WP_003400418.1.65623 WP_003400418.1.65635 WP_003400418.1.65637 WP_003400418.1.65648 WP_003400418.1.65683 WP_003400418.1.65686 WP_003400418.1.65688 WP_003400418.1.65707 WP_003400418.1.65733 WP_003400418.1.65746 WP_003400418.1.65747 WP_003400418.1.65759 WP_003400418.1.65816 WP_003400418.1.65830 WP_003400418.1.65858 WP_003400418.1.65862 WP_003400418.1.65869 WP_003400418.1.65893 WP_003400418.1.65929 WP_003400418.1.65932 WP_003400418.1.65958 WP_003400418.1.65974 WP_003400418.1.66004 WP_003400418.1.66013 WP_003400418.1.6606 WP_003400418.1.66089 WP_003400418.1.66149 WP_003400418.1.66151 WP_003400418.1.66229 WP_003400418.1.66276 WP_003400418.1.66293 WP_003400418.1.66297 WP_003400418.1.66323 WP_003400418.1.66325 WP_003400418.1.6633 WP_003400418.1.66334 WP_003400418.1.66355 WP_003400418.1.66367 WP_003400418.1.66394 WP_003400418.1.66396 WP_003400418.1.66451 WP_003400418.1.66455 WP_003400418.1.66457 WP_003400418.1.66460 WP_003400418.1.66464 WP_003400418.1.66466 WP_003400418.1.66487 WP_003400418.1.66504 WP_003400418.1.66544 WP_003400418.1.66558 WP_003400418.1.66580 WP_003400418.1.66582 WP_003400418.1.66612 WP_003400418.1.66615 WP_003400418.1.66617 WP_003400418.1.66635 WP_003400418.1.66656 WP_003400418.1.66663 WP_003400418.1.66675 WP_003400418.1.66715 WP_003400418.1.66718 WP_003400418.1.66762 WP_003400418.1.66776 WP_003400418.1.66808 WP_003400418.1.66817 WP_003400418.1.66819 WP_003400418.1.66826 WP_003400418.1.66830 WP_003400418.1.66842 WP_003400418.1.66868 WP_003400418.1.66878 WP_003400418.1.66880 WP_003400418.1.66893 WP_003400418.1.66961 WP_003400418.1.67005 WP_003400418.1.6704 WP_003400418.1.67044 WP_003400418.1.67061 WP_003400418.1.67089 WP_003400418.1.67098 WP_003400418.1.67146 WP_003400418.1.67170 WP_003400418.1.67197 WP_003400418.1.67198 WP_003400418.1.6720 WP_003400418.1.67207 WP_003400418.1.67218 WP_003400418.1.67220 WP_003400418.1.67225 WP_003400418.1.67231 WP_003400418.1.6724 WP_003400418.1.67257 WP_003400418.1.67298 WP_003400418.1.67307 WP_003400418.1.67324 WP_003400418.1.67332 WP_003400418.1.67346 WP_003400418.1.67354 WP_003400418.1.67360 WP_003400418.1.67381 WP_003400418.1.67396 WP_003400418.1.67417 WP_003400418.1.67422 WP_003400418.1.67453 WP_003400418.1.67459 WP_003400418.1.6746 WP_003400418.1.67473 WP_003400418.1.67481 WP_003400418.1.67482 WP_003400418.1.67496 WP_003400418.1.67499 WP_003400418.1.67516 WP_003400418.1.67523 WP_003400418.1.67536 WP_003400418.1.67575 WP_003400418.1.67587 WP_003400418.1.67598 WP_003400418.1.67600 WP_003400418.1.67602 WP_003400418.1.67630 WP_003400418.1.67679 WP_003400418.1.67692 WP_003400418.1.67744 WP_003400418.1.6775 WP_003400418.1.67750 WP_003400418.1.6777 WP_003400418.1.67809 WP_003400418.1.67816 WP_003400418.1.67844 WP_003400418.1.67848 WP_003400418.1.67870 WP_003400418.1.67888 WP_003400418.1.67915 WP_003400418.1.67945 WP_003400418.1.67949 WP_003400418.1.67980 WP_003400418.1.67982 WP_003400418.1.68022 WP_003400418.1.68029 WP_003400418.1.68037 WP_003400418.1.68038 WP_003400418.1.68045 WP_003400418.1.68057 WP_003400418.1.68083 WP_003400418.1.68088 WP_003400418.1.68106 WP_003400418.1.68110 WP_003400418.1.68153 WP_003400418.1.68164 WP_003400418.1.68169 WP_003400418.1.68193 WP_003400418.1.68212 WP_003400418.1.68227 WP_003400418.1.68243 WP_003400418.1.6825 WP_003400418.1.68297 WP_003400418.1.68309 WP_003400418.1.68325 WP_003400418.1.68329 WP_003400418.1.68340 WP_003400418.1.68384 WP_003400418.1.68388 WP_003400418.1.68429 WP_003400418.1.6843 WP_003400418.1.68433 WP_003400418.1.68444 WP_003400418.1.68465 WP_003400418.1.68484 WP_003400418.1.68518 WP_003400418.1.68569 WP_003400418.1.68576 WP_003400418.1.68580 WP_003400418.1.68586 WP_003400418.1.68623 WP_003400418.1.68624 WP_003400418.1.68637 WP_003400418.1.68646 WP_003400418.1.68667 WP_003400418.1.68669 WP_003400418.1.68672 WP_003400418.1.68684 WP_003400418.1.68704 WP_003400418.1.68708 WP_003400418.1.6872 WP_003400418.1.68730 WP_003400418.1.68734 WP_003400418.1.68748 WP_003400418.1.68754 WP_003400418.1.6876 WP_003400418.1.68761 WP_003400418.1.68763 WP_003400418.1.68766 WP_003400418.1.68774 WP_003400418.1.68796 WP_003400418.1.68824 WP_003400418.1.68832 WP_003400418.1.68833 WP_003400418.1.68841 WP_003400418.1.68859 WP_003400418.1.68876 WP_003400418.1.68906 WP_003400418.1.68916 WP_003400418.1.68923 WP_003400418.1.68945 WP_003400418.1.6896 WP_003400418.1.68981 WP_003400418.1.68984 WP_003400418.1.68997 WP_003400418.1.69008 WP_003400418.1.69079 WP_003400418.1.6908 WP_003400418.1.69082 WP_003400418.1.69178 WP_003400418.1.69181 WP_003400418.1.69208 WP_003400418.1.69231 WP_003400418.1.69256 WP_003400418.1.69311 WP_003400418.1.69315 WP_003400418.1.69322 WP_003400418.1.69342 WP_003400418.1.6935 WP_003400418.1.6936 WP_003400418.1.69374 WP_003400418.1.69398 WP_003400418.1.69401 WP_003400418.1.69426 WP_003400418.1.69427 WP_003400418.1.69429 WP_003400418.1.6949 WP_003400418.1.6951 WP_003400418.1.69511 WP_003400418.1.69526 WP_003400418.1.69528 WP_003400418.1.69547 WP_003400418.1.69573 WP_003400418.1.69581 WP_003400418.1.6960 WP_003400418.1.69617 WP_003400418.1.69634 WP_003400418.1.69647 WP_003400418.1.69659 WP_003400418.1.69673 WP_003400418.1.69682 WP_003400418.1.69684 WP_003400418.1.69686 WP_003400418.1.69707 WP_003400418.1.69709 WP_003400418.1.69723 WP_003400418.1.69736 WP_003400418.1.69778 WP_003400418.1.69800 WP_003400418.1.69802 WP_003400418.1.69845 WP_003400418.1.69870 WP_003400418.1.69873 WP_003400418.1.69898 WP_003400418.1.69913 WP_003400418.1.69925 WP_003400418.1.69931 WP_003400418.1.69938 WP_003400418.1.69955 WP_003400418.1.69957 WP_003400418.1.69981 WP_003400418.1.69990 WP_003400418.1.70 WP_003400418.1.70000 WP_003400418.1.70017 WP_003400418.1.70032 WP_003400418.1.70055 WP_003400418.1.70062 WP_003400418.1.70072 WP_003400418.1.70131 WP_003400418.1.70132 WP_003400418.1.7022 WP_003400418.1.70227 WP_003400418.1.70255 WP_003400418.1.70271 WP_003400418.1.70274 WP_003400418.1.7029 WP_003400418.1.70325 WP_003400418.1.70328 WP_003400418.1.70356 WP_003400418.1.70364 WP_003400418.1.70368 WP_003400418.1.70369 WP_003400418.1.70418 WP_003400418.1.70422 WP_003400418.1.70435 WP_003400418.1.70444 WP_003400418.1.70463 WP_003400418.1.70471 WP_003400418.1.70480 WP_003400418.1.70494 WP_003400418.1.70498 WP_003400418.1.70505 WP_003400418.1.70525 WP_003400418.1.70573 WP_003400418.1.70577 WP_003400418.1.70610 WP_003400418.1.70615 WP_003400418.1.70618 WP_003400418.1.70622 WP_003400418.1.70626 WP_003400418.1.70668 WP_003400418.1.70699 WP_003400418.1.70704 WP_003400418.1.70729 WP_003400418.1.70757 WP_003400418.1.70782 WP_003400418.1.70796 WP_003400418.1.70830 WP_003400418.1.70834 WP_003400418.1.7084 WP_003400418.1.70840 WP_003400418.1.70864 WP_003400418.1.70871 WP_003400418.1.70915 WP_003400418.1.70955 WP_003400418.1.70958 WP_003400418.1.70964 WP_003400418.1.70976 WP_003400418.1.71015 WP_003400418.1.71026 WP_003400418.1.71063 WP_003400418.1.71076 WP_003400418.1.71083 WP_003400418.1.7111 WP_003400418.1.71118 WP_003400418.1.71128 WP_003400418.1.7113 WP_003400418.1.71187 WP_003400418.1.71191 WP_003400418.1.71255 WP_003400418.1.71258 WP_003400418.1.71259 WP_003400418.1.71289 WP_003400418.1.71326 WP_003400418.1.71329 WP_003400418.1.71331 WP_003400418.1.71344 WP_003400418.1.71390 WP_003400418.1.71399 WP_003400418.1.71440 WP_003400418.1.71457 WP_003400418.1.7146 WP_003400418.1.71464 WP_003400418.1.71490 WP_003400418.1.71492 WP_003400418.1.71509 WP_003400418.1.71516 WP_003400418.1.71517 WP_003400418.1.71527 WP_003400418.1.71532 WP_003400418.1.71545 WP_003400418.1.71546 WP_003400418.1.71604 WP_003400418.1.71621 WP_003400418.1.71638 WP_003400418.1.71654 WP_003400418.1.71664 WP_003400418.1.71665 WP_003400418.1.71683 WP_003400418.1.71701 WP_003400418.1.71718 WP_003400418.1.71731 WP_003400418.1.71778 WP_003400418.1.71781 WP_003400418.1.71803 WP_003400418.1.71820 WP_003400418.1.71847 WP_003400418.1.7185 WP_003400418.1.71851 WP_003400418.1.71871 WP_003400418.1.71909 WP_003400418.1.71957 WP_003400418.1.71970 WP_003400418.1.72047 WP_003400418.1.72061 WP_003400418.1.72062 WP_003400418.1.72072 WP_003400418.1.72111 WP_003400418.1.72122 WP_003400418.1.72128 WP_003400418.1.72143 WP_003400418.1.7216 WP_003400418.1.72168 WP_003400418.1.72179 WP_003400418.1.72209 WP_003400418.1.72218 WP_003400418.1.72219 WP_003400418.1.72227 WP_003400418.1.7224 WP_003400418.1.72268 WP_003400418.1.72332 WP_003400418.1.72380 WP_003400418.1.72401 WP_003400418.1.72405 WP_003400418.1.72420 WP_003400418.1.72441 WP_003400418.1.72451 WP_003400418.1.72452 WP_003400418.1.72457 WP_003400418.1.72459 WP_003400418.1.72460 WP_003400418.1.72466 WP_003400418.1.72487 WP_003400418.1.72488 WP_003400418.1.72492 WP_003400418.1.72506 WP_003400418.1.72543 WP_003400418.1.7256 WP_003400418.1.72576 WP_003400418.1.72578 WP_003400418.1.72585 WP_003400418.1.72591 WP_003400418.1.72592 WP_003400418.1.72640 WP_003400418.1.7266 WP_003400418.1.72661 WP_003400418.1.72684 WP_003400418.1.72739 WP_003400418.1.72744 WP_003400418.1.72755 WP_003400418.1.72759 WP_003400418.1.72784 WP_003400418.1.72792 WP_003400418.1.72826 WP_003400418.1.72831 WP_003400418.1.72852 WP_003400418.1.72853 WP_003400418.1.72879 WP_003400418.1.72880 WP_003400418.1.72938 WP_003400418.1.72954 WP_003400418.1.72957 WP_003400418.1.72959 WP_003400418.1.72973 WP_003400418.1.7298 WP_003400418.1.72982 WP_003400418.1.72988 WP_003400418.1.72993 WP_003400418.1.73006 WP_003400418.1.73013 WP_003400418.1.73025 WP_003400418.1.73028 WP_003400418.1.73042 WP_003400418.1.73045 WP_003400418.1.73092 WP_003400418.1.73118 WP_003400418.1.7312 WP_003400418.1.73127 WP_003400418.1.73134 WP_003400418.1.73150 WP_003400418.1.73154 WP_003400418.1.73163 WP_003400418.1.73182 WP_003400418.1.73205 WP_003400418.1.7321 WP_003400418.1.73310 WP_003400418.1.73365 WP_003400418.1.73391 WP_003400418.1.73404 WP_003400418.1.73424 WP_003400418.1.73436 WP_003400418.1.73445 WP_003400418.1.73453 WP_003400418.1.73465 WP_003400418.1.73466 WP_003400418.1.73470 WP_003400418.1.73471 WP_003400418.1.73478 WP_003400418.1.73507 WP_003400418.1.73532 WP_003400418.1.73550 WP_003400418.1.73564 WP_003400418.1.73623 WP_003400418.1.73629 WP_003400418.1.73644 WP_003400418.1.73661 WP_003400418.1.7368 WP_003400418.1.73688 WP_003400418.1.73723 WP_003400418.1.73744 WP_003400418.1.73750 WP_003400418.1.73760 WP_003400418.1.73774 WP_003400418.1.7379 WP_003400418.1.73813 WP_003400418.1.73840 WP_003400418.1.73876 WP_003400418.1.7389 WP_003400418.1.73986 WP_003400418.1.74016 WP_003400418.1.74039 WP_003400418.1.74083 WP_003400418.1.74101 WP_003400418.1.74107 WP_003400418.1.74120 WP_003400418.1.74129 WP_003400418.1.74144 WP_003400418.1.7417 WP_003400418.1.74190 WP_003400418.1.74210 WP_003400418.1.7423 WP_003400418.1.74259 WP_003400418.1.74262 WP_003400418.1.74269 WP_003400418.1.74282 WP_003400418.1.74291 WP_003400418.1.74296 WP_003400418.1.74304 WP_003400418.1.7432 WP_003400418.1.74347 WP_003400418.1.7436 WP_003400418.1.74378 WP_003400418.1.74382 WP_003400418.1.74395 WP_003400418.1.74400 WP_003400418.1.74401 WP_003400418.1.74432 WP_003400418.1.74442 WP_003400418.1.74477 WP_003400418.1.74487 WP_003400418.1.74499 WP_003400418.1.74504 WP_003400418.1.74511 WP_003400418.1.74523 WP_003400418.1.74525 WP_003400418.1.74551 WP_003400418.1.74555 WP_003400418.1.74628 WP_003400418.1.74641 WP_003400418.1.74653 WP_003400418.1.74660 WP_003400418.1.74683 WP_003400418.1.7469 WP_003400418.1.74725 WP_003400418.1.74760 WP_003400418.1.74786 WP_003400418.1.74809 WP_003400418.1.74820 WP_003400418.1.74870 WP_003400418.1.74881 WP_003400418.1.74888 WP_003400418.1.74952 WP_003400418.1.7496 WP_003400418.1.74988 WP_003400418.1.75043 WP_003400418.1.75045 WP_003400418.1.75055 WP_003400418.1.75078 WP_003400418.1.75081 WP_003400418.1.75120 WP_003400418.1.75163 WP_003400418.1.75188 WP_003400418.1.75200 WP_003400418.1.75202 WP_003400418.1.75234 WP_003400418.1.75239 WP_003400418.1.75250 WP_003400418.1.75263 WP_003400418.1.75281 WP_003400418.1.75342 WP_003400418.1.7535 WP_003400418.1.75376 WP_003400418.1.75391 WP_003400418.1.75395 WP_003400418.1.75441 WP_003400418.1.75510 WP_003400418.1.75581 WP_003400418.1.75598 WP_003400418.1.75635 WP_003400418.1.75645 WP_003400418.1.75665 WP_003400418.1.75671 WP_003400418.1.75741 WP_003400418.1.75749 WP_003400418.1.75772 WP_003400418.1.75774 WP_003400418.1.75811 WP_003400418.1.75833 WP_003400418.1.7585 WP_003400418.1.75864 WP_003400418.1.75868 WP_003400418.1.75878 WP_003400418.1.75927 WP_003400418.1.75946 WP_003400418.1.75968 WP_003400418.1.75974 WP_003400418.1.76007 WP_003400418.1.76016 WP_003400418.1.76032 WP_003400418.1.76037 WP_003400418.1.7604 WP_003400418.1.76045 WP_003400418.1.76052 WP_003400418.1.76058 WP_003400418.1.76064 WP_003400418.1.76110 WP_003400418.1.76126 WP_003400418.1.76133 WP_003400418.1.76138 WP_003400418.1.76157 WP_003400418.1.76172 WP_003400418.1.76177 WP_003400418.1.76183 WP_003400418.1.76209 WP_003400418.1.76239 WP_003400418.1.76272 WP_003400418.1.76277 WP_003400418.1.76280 WP_003400418.1.76281 WP_003400418.1.76291 WP_003400418.1.76297 WP_003400418.1.76360 WP_003400418.1.76379 WP_003400418.1.76403 WP_003400418.1.76413 WP_003400418.1.76414 WP_003400418.1.76427 WP_003400418.1.76436 WP_003400418.1.76442 WP_003400418.1.76443 WP_003400418.1.76456 WP_003400418.1.76521 WP_003400418.1.76533 WP_003400418.1.76616 WP_003400418.1.76625 WP_003400418.1.76629 WP_003400418.1.76635 WP_003400418.1.76638 WP_003400418.1.76639 WP_003400418.1.76640 WP_003400418.1.76644 WP_003400418.1.76677 WP_003400418.1.76678 WP_003400418.1.76679 WP_003400418.1.76734 WP_003400418.1.76744 WP_003400418.1.76750 WP_003400418.1.76754 WP_003400418.1.76757 WP_003400418.1.76781 WP_003400418.1.76818 WP_003400418.1.76824 WP_003400418.1.76835 WP_003400418.1.76873 WP_003400418.1.76881 WP_003400418.1.76888 WP_003400418.1.76900 WP_003400418.1.7691 WP_003400418.1.76947 WP_003400418.1.76954 WP_003400418.1.76955 WP_003400418.1.76963 WP_003400418.1.76976 WP_003400418.1.770 WP_003400418.1.77000 WP_003400418.1.77008 WP_003400418.1.77021 WP_003400418.1.77056 WP_003400418.1.77065 WP_003400418.1.77075 WP_003400418.1.77093 WP_003400418.1.77107 WP_003400418.1.77115 WP_003400418.1.77118 WP_003400418.1.77125 WP_003400418.1.77141 WP_003400418.1.77142 WP_003400418.1.77166 WP_003400418.1.77250 WP_003400418.1.77252 WP_003400418.1.77260 WP_003400418.1.77266 WP_003400418.1.77280 WP_003400418.1.77285 WP_003400418.1.77312 WP_003400418.1.77348 WP_003400418.1.77351 WP_003400418.1.77352 WP_003400418.1.77361 WP_003400418.1.774 WP_003400418.1.7740 WP_003400418.1.77404 WP_003400418.1.77425 WP_003400418.1.77463 WP_003400418.1.77474 WP_003400418.1.7748 WP_003400418.1.77491 WP_003400418.1.77499 WP_003400418.1.77510 WP_003400418.1.77530 WP_003400418.1.77554 WP_003400418.1.77559 WP_003400418.1.77599 WP_003400418.1.77605 WP_003400418.1.7762 WP_003400418.1.77627 WP_003400418.1.77649 WP_003400418.1.77654 WP_003400418.1.7766 WP_003400418.1.77667 WP_003400418.1.77704 WP_003400418.1.77706 WP_003400418.1.77726 WP_003400418.1.77774 WP_003400418.1.7778 WP_003400418.1.77790 WP_003400418.1.77809 WP_003400418.1.77820 WP_003400418.1.77843 WP_003400418.1.77855 WP_003400418.1.77865 WP_003400418.1.77868 WP_003400418.1.77879 WP_003400418.1.77890 WP_003400418.1.77909 WP_003400418.1.77911 WP_003400418.1.77931 WP_003400418.1.77984 WP_003400418.1.78020 WP_003400418.1.78024 WP_003400418.1.78075 WP_003400418.1.78084 WP_003400418.1.78086 WP_003400418.1.7809 WP_003400418.1.78098 WP_003400418.1.78105 WP_003400418.1.78113 WP_003400418.1.78136 WP_003400418.1.78162 WP_003400418.1.7817 WP_003400418.1.78200 WP_003400418.1.78216 WP_003400418.1.78236 WP_003400418.1.78238 WP_003400418.1.78322 WP_003400418.1.78338 WP_003400418.1.7836 WP_003400418.1.78360 WP_003400418.1.78386 WP_003400418.1.78429 WP_003400418.1.78435 WP_003400418.1.7844 WP_003400418.1.78459 WP_003400418.1.78488 WP_003400418.1.7849 WP_003400418.1.78499 WP_003400418.1.785 WP_003400418.1.78516 WP_003400418.1.78524 WP_003400418.1.78526 WP_003400418.1.78538 WP_003400418.1.78544 WP_003400418.1.78545 WP_003400418.1.78547 WP_003400418.1.78574 WP_003400418.1.78580 WP_003400418.1.7860 WP_003400418.1.78620 WP_003400418.1.78646 WP_003400418.1.78648 WP_003400418.1.78649 WP_003400418.1.78655 WP_003400418.1.78657 WP_003400418.1.78659 WP_003400418.1.7869 WP_003400418.1.78692 WP_003400418.1.78760 WP_003400418.1.78766 WP_003400418.1.78776 WP_003400418.1.78778 WP_003400418.1.78784 WP_003400418.1.78788 WP_003400418.1.78790 WP_003400418.1.78793 WP_003400418.1.78848 WP_003400418.1.78860 WP_003400418.1.7887 WP_003400418.1.78884 WP_003400418.1.78932 WP_003400418.1.78969 WP_003400418.1.78977 WP_003400418.1.78980 WP_003400418.1.79005 WP_003400418.1.79016 WP_003400418.1.79033 WP_003400418.1.79064 WP_003400418.1.79066 WP_003400418.1.79068 WP_003400418.1.79077 WP_003400418.1.79095 WP_003400418.1.79112 WP_003400418.1.79122 WP_003400418.1.79145 WP_003400418.1.79152 WP_003400418.1.79163 WP_003400418.1.79182 WP_003400418.1.79198 WP_003400418.1.79213 WP_003400418.1.79218 WP_003400418.1.79268 WP_003400418.1.79273 WP_003400418.1.79278 WP_003400418.1.79290 WP_003400418.1.79319 WP_003400418.1.79326 WP_003400418.1.7933 WP_003400418.1.79330 WP_003400418.1.79339 WP_003400418.1.79394 WP_003400418.1.79399 WP_003400418.1.79413 WP_003400418.1.79422 WP_003400418.1.79445 WP_003400418.1.79447 WP_003400418.1.79455 WP_003400418.1.79471 WP_003400418.1.79480 WP_003400418.1.79482 WP_003400418.1.79488 WP_003400418.1.79500 WP_003400418.1.79502 WP_003400418.1.79508 WP_003400418.1.79514 WP_003400418.1.79561 WP_003400418.1.79565 WP_003400418.1.79578 WP_003400418.1.79588 WP_003400418.1.79598 WP_003400418.1.79615 WP_003400418.1.79684 WP_003400418.1.79698 WP_003400418.1.797 WP_003400418.1.79744 WP_003400418.1.79784 WP_003400418.1.79802 WP_003400418.1.79806 WP_003400418.1.79819 WP_003400418.1.79826 WP_003400418.1.79828 WP_003400418.1.79851 WP_003400418.1.79853 WP_003400418.1.79863 WP_003400418.1.79881 WP_003400418.1.79885 WP_003400418.1.79898 WP_003400418.1.7990 WP_003400418.1.79900 WP_003400418.1.79913 WP_003400418.1.79918 WP_003400418.1.79947 WP_003400418.1.79948 WP_003400418.1.7995 WP_003400418.1.7997 WP_003400418.1.80004 WP_003400418.1.80015 WP_003400418.1.80022 WP_003400418.1.80030 WP_003400418.1.80054 WP_003400418.1.80084 WP_003400418.1.80099 WP_003400418.1.80129 WP_003400418.1.80177 WP_003400418.1.80234 WP_003400418.1.8026 WP_003400418.1.80275 WP_003400418.1.8029 WP_003400418.1.80299 WP_003400418.1.80300 WP_003400418.1.80304 WP_003400418.1.80326 WP_003400418.1.80351 WP_003400418.1.8037 WP_003400418.1.80370 WP_003400418.1.80399 WP_003400418.1.8044 WP_003400418.1.80451 WP_003400418.1.80458 WP_003400418.1.80461 WP_003400418.1.80490 WP_003400418.1.80503 WP_003400418.1.80507 WP_003400418.1.80552 WP_003400418.1.80576 WP_003400418.1.80599 WP_003400418.1.8060 WP_003400418.1.80624 WP_003400418.1.80636 WP_003400418.1.80669 WP_003400418.1.80673 WP_003400418.1.80711 WP_003400418.1.80714 WP_003400418.1.80743 WP_003400418.1.80784 WP_003400418.1.80815 WP_003400418.1.80853 WP_003400418.1.80918 WP_003400418.1.8093 WP_003400418.1.80967 WP_003400418.1.8097 WP_003400418.1.80988 WP_003400418.1.81007 WP_003400418.1.81013 WP_003400418.1.8105 WP_003400418.1.81059 WP_003400418.1.81063 WP_003400418.1.81066 WP_003400418.1.81075 WP_003400418.1.81091 WP_003400418.1.81119 WP_003400418.1.81125 WP_003400418.1.81136 WP_003400418.1.8114 WP_003400418.1.81189 WP_003400418.1.81192 WP_003400418.1.812 WP_003400418.1.81230 WP_003400418.1.81249 WP_003400418.1.81250 WP_003400418.1.81264 WP_003400418.1.8128 WP_003400418.1.81297 WP_003400418.1.8138 WP_003400418.1.81407 WP_003400418.1.81439 WP_003400418.1.81465 WP_003400418.1.81505 WP_003400418.1.81529 WP_003400418.1.81538 WP_003400418.1.81541 WP_003400418.1.81560 WP_003400418.1.81561 WP_003400418.1.81567 WP_003400418.1.81583 WP_003400418.1.81686 WP_003400418.1.81712 WP_003400418.1.81720 WP_003400418.1.81731 WP_003400418.1.81774 WP_003400418.1.81788 WP_003400418.1.81809 WP_003400418.1.81820 WP_003400418.1.81850 WP_003400418.1.81883 WP_003400418.1.81891 WP_003400418.1.81911 WP_003400418.1.81918 WP_003400418.1.82011 WP_003400418.1.82048 WP_003400418.1.82069 WP_003400418.1.82071 WP_003400418.1.82108 WP_003400418.1.82136 WP_003400418.1.82142 WP_003400418.1.8215 WP_003400418.1.82158 WP_003400418.1.8217 WP_003400418.1.82209 WP_003400418.1.82210 WP_003400418.1.82228 WP_003400418.1.82236 WP_003400418.1.82251 WP_003400418.1.82271 WP_003400418.1.82305 WP_003400418.1.82307 WP_003400418.1.82309 WP_003400418.1.82317 WP_003400418.1.8232 WP_003400418.1.82346 WP_003400418.1.82374 WP_003400418.1.82385 WP_003400418.1.82429 WP_003400418.1.82460 WP_003400418.1.82462 WP_003400418.1.82483 WP_003400418.1.82494 WP_003400418.1.82531 WP_003400418.1.82546 WP_003400418.1.82547 WP_003400418.1.82549 WP_003400418.1.82577 WP_003400418.1.82592 WP_003400418.1.82597 WP_003400418.1.82598 WP_003400418.1.82625 WP_003400418.1.82642 WP_003400418.1.82651 WP_003400418.1.82653 WP_003400418.1.82681 WP_003400418.1.82685 WP_003400418.1.8271 WP_003400418.1.82712 WP_003400418.1.8273 WP_003400418.1.82743 WP_003400418.1.82757 WP_003400418.1.82774 WP_003400418.1.82803 WP_003400418.1.82836 WP_003400418.1.82860 WP_003400418.1.82871 WP_003400418.1.82892 WP_003400418.1.82935 WP_003400418.1.82957 WP_003400418.1.82973 WP_003400418.1.82981 WP_003400418.1.82983 WP_003400418.1.83004 WP_003400418.1.83009 WP_003400418.1.83044 WP_003400418.1.83065 WP_003400418.1.83074 WP_003400418.1.83110 WP_003400418.1.83146 WP_003400418.1.83149 WP_003400418.1.83159 WP_003400418.1.8317 WP_003400418.1.83173 WP_003400418.1.83181 WP_003400418.1.83182 WP_003400418.1.83191 WP_003400418.1.83197 WP_003400418.1.83212 WP_003400418.1.8326 WP_003400418.1.83262 WP_003400418.1.83268 WP_003400418.1.83273 WP_003400418.1.83309 WP_003400418.1.83332 WP_003400418.1.83334 WP_003400418.1.83341 WP_003400418.1.83349 WP_003400418.1.8335 WP_003400418.1.83353 WP_003400418.1.83367 WP_003400418.1.83380 WP_003400418.1.83381 WP_003400418.1.83389 WP_003400418.1.83408 WP_003400418.1.83409 WP_003400418.1.83435 WP_003400418.1.83470 WP_003400418.1.83524 WP_003400418.1.83526 WP_003400418.1.8358 WP_003400418.1.83589 WP_003400418.1.83601 WP_003400418.1.83611 WP_003400418.1.83638 WP_003400418.1.83648 WP_003400418.1.83667 WP_003400418.1.83689 WP_003400418.1.83692 WP_003400418.1.83704 WP_003400418.1.83705 WP_003400418.1.83766 WP_003400418.1.83793 WP_003400418.1.83794 WP_003400418.1.83802 WP_003400418.1.83805 WP_003400418.1.83839 WP_003400418.1.83842 WP_003400418.1.83850 WP_003400418.1.83861 WP_003400418.1.83884 WP_003400418.1.83920 WP_003400418.1.83929 WP_003400418.1.83930 WP_003400418.1.83975 WP_003400418.1.83991 WP_003400418.1.8400 WP_003400418.1.84027 WP_003400418.1.8404 WP_003400418.1.84057 WP_003400418.1.84070 WP_003400418.1.8409 WP_003400418.1.84112 WP_003400418.1.84146 WP_003400418.1.8415 WP_003400418.1.84176 WP_003400418.1.84186 WP_003400418.1.84192 WP_003400418.1.84228 WP_003400418.1.8424 WP_003400418.1.84244 WP_003400418.1.84259 WP_003400418.1.8426 WP_003400418.1.84277 WP_003400418.1.84287 WP_003400418.1.8434 WP_003400418.1.84388 WP_003400418.1.84408 WP_003400418.1.84409 WP_003400418.1.84438 WP_003400418.1.84460 WP_003400418.1.84488 WP_003400418.1.84504 WP_003400418.1.84525 WP_003400418.1.84623 WP_003400418.1.84641 WP_003400418.1.84655 WP_003400418.1.84666 WP_003400418.1.84670 WP_003400418.1.84739 WP_003400418.1.84748 WP_003400418.1.84766 WP_003400418.1.84772 WP_003400418.1.84774 WP_003400418.1.848 WP_003400418.1.84812 WP_003400418.1.84836 WP_003400418.1.84839 WP_003400418.1.84846 WP_003400418.1.84873 WP_003400418.1.84911 WP_003400418.1.84938 WP_003400418.1.84968 WP_003400418.1.84973 WP_003400418.1.84981 WP_003400418.1.84985 WP_003400418.1.8503 WP_003400418.1.85038 WP_003400418.1.85041 WP_003400418.1.85043 WP_003400418.1.8505 WP_003400418.1.85074 WP_003400418.1.8509 WP_003400418.1.8512 WP_003400418.1.85148 WP_003400418.1.8518 WP_003400418.1.8522 WP_003400418.1.85242 WP_003400418.1.85276 WP_003400418.1.85281 WP_003400418.1.85284 WP_003400418.1.85314 WP_003400418.1.85319 WP_003400418.1.85330 WP_003400418.1.85341 WP_003400418.1.85346 WP_003400418.1.8535 WP_003400418.1.85363 WP_003400418.1.85371 WP_003400418.1.85377 WP_003400418.1.85387 WP_003400418.1.85399 WP_003400418.1.85458 WP_003400418.1.8546 WP_003400418.1.85464 WP_003400418.1.85478 WP_003400418.1.85480 WP_003400418.1.85488 WP_003400418.1.85495 WP_003400418.1.85551 WP_003400418.1.85557 WP_003400418.1.85577 WP_003400418.1.85597 WP_003400418.1.85599 WP_003400418.1.85610 WP_003400418.1.8563 WP_003400418.1.85648 WP_003400418.1.85679 WP_003400418.1.85704 WP_003400418.1.85717 WP_003400418.1.85727 WP_003400418.1.85737 WP_003400418.1.85763 WP_003400418.1.85808 WP_003400418.1.85819 WP_003400418.1.85820 WP_003400418.1.85823 WP_003400418.1.85832 WP_003400418.1.8586 WP_003400418.1.85872 WP_003400418.1.85894 WP_003400418.1.85909 WP_003400418.1.85913 WP_003400418.1.85953 WP_003400418.1.85986 WP_003400418.1.86000 WP_003400418.1.86024 WP_003400418.1.86025 WP_003400418.1.86032 WP_003400418.1.86048 WP_003400418.1.86052 WP_003400418.1.86067 WP_003400418.1.86103 WP_003400418.1.86122 WP_003400418.1.86124 WP_003400418.1.86160 WP_003400418.1.86164 WP_003400418.1.86168 WP_003400418.1.86190 WP_003400418.1.86204 WP_003400418.1.86208 WP_003400418.1.86235 WP_003400418.1.86249 WP_003400418.1.86260 WP_003400418.1.86290 WP_003400418.1.863 WP_003400418.1.86327 WP_003400418.1.86334 WP_003400418.1.86337 WP_003400418.1.86368 WP_003400418.1.86377 WP_003400418.1.86425 WP_003400418.1.86459 WP_003400418.1.8649 WP_003400418.1.86499 WP_003400418.1.86520 WP_003400418.1.86561 WP_003400418.1.86568 WP_003400418.1.86575 WP_003400418.1.86584 WP_003400418.1.86605 WP_003400418.1.86626 WP_003400418.1.86648 WP_003400418.1.8666 WP_003400418.1.86684 WP_003400418.1.86696 WP_003400418.1.86705 WP_003400418.1.86718 WP_003400418.1.86725 WP_003400418.1.86757 WP_003400418.1.86766 WP_003400418.1.86801 WP_003400418.1.86814 WP_003400418.1.86820 WP_003400418.1.86825 WP_003400418.1.86834 WP_003400418.1.8685 WP_003400418.1.86851 WP_003400418.1.86855 WP_003400418.1.86867 WP_003400418.1.86877 WP_003400418.1.86883 WP_003400418.1.8689 WP_003400418.1.86892 WP_003400418.1.86933 WP_003400418.1.86941 WP_003400418.1.86950 WP_003400418.1.86962 WP_003400418.1.86979 WP_003400418.1.8700 WP_003400418.1.87001 WP_003400418.1.87002 WP_003400418.1.87031 WP_003400418.1.87116 WP_003400418.1.87117 WP_003400418.1.8714 WP_003400418.1.87162 WP_003400418.1.87178 WP_003400418.1.87191 WP_003400418.1.87201 WP_003400418.1.87209 WP_003400418.1.87240 WP_003400418.1.87266 WP_003400418.1.87273 WP_003400418.1.87275 WP_003400418.1.8733 WP_003400418.1.87345 WP_003400418.1.87369 WP_003400418.1.8737 WP_003400418.1.87401 WP_003400418.1.87404 WP_003400418.1.87406 WP_003400418.1.87409 WP_003400418.1.87444 WP_003400418.1.87446 WP_003400418.1.87459 WP_003400418.1.87472 WP_003400418.1.87489 WP_003400418.1.87494 WP_003400418.1.87496 WP_003400418.1.87582 WP_003400418.1.87588 WP_003400418.1.87617 WP_003400418.1.87619 WP_003400418.1.87620 WP_003400418.1.87634 WP_003400418.1.87643 WP_003400418.1.8765 WP_003400418.1.87650 WP_003400418.1.87654 WP_003400418.1.87658 WP_003400418.1.87665 WP_003400418.1.87676 WP_003400418.1.87677 WP_003400418.1.87684 WP_003400418.1.87692 WP_003400418.1.87707 WP_003400418.1.87732 WP_003400418.1.87784 WP_003400418.1.87796 WP_003400418.1.87809 WP_003400418.1.87817 WP_003400418.1.87827 WP_003400418.1.87831 WP_003400418.1.87835 WP_003400418.1.87837 WP_003400418.1.87866 WP_003400418.1.8789 WP_003400418.1.87911 WP_003400418.1.87924 WP_003400418.1.87951 WP_003400418.1.87955 WP_003400418.1.87956 WP_003400418.1.87991 WP_003400418.1.88 WP_003400418.1.88002 WP_003400418.1.88037 WP_003400418.1.88039 WP_003400418.1.88072 WP_003400418.1.88077 WP_003400418.1.88121 WP_003400418.1.88180 WP_003400418.1.88191 WP_003400418.1.88205 WP_003400418.1.88217 WP_003400418.1.88219 WP_003400418.1.88245 WP_003400418.1.88253 WP_003400418.1.88294 WP_003400418.1.88315 WP_003400418.1.88316 WP_003400418.1.88320 WP_003400418.1.88338 WP_003400418.1.8840 WP_003400418.1.88437 WP_003400418.1.88453 WP_003400418.1.88469 WP_003400418.1.88489 WP_003400418.1.88507 WP_003400418.1.88521 WP_003400418.1.88530 WP_003400418.1.88537 WP_003400418.1.88541 WP_003400418.1.88592 WP_003400418.1.88616 WP_003400418.1.88618 WP_003400418.1.8862 WP_003400418.1.88625 WP_003400418.1.88632 WP_003400418.1.88634 WP_003400418.1.88649 WP_003400418.1.8870 WP_003400418.1.88737 WP_003400418.1.88756 WP_003400418.1.888 WP_003400418.1.88824 WP_003400418.1.88886 WP_003400418.1.88965 WP_003400418.1.88985 WP_003400418.1.8902 WP_003400418.1.89025 WP_003400418.1.89041 WP_003400418.1.89046 WP_003400418.1.89082 WP_003400418.1.89162 WP_003400418.1.89168 WP_003400418.1.8917 WP_003400418.1.89193 WP_003400418.1.89205 WP_003400418.1.89207 WP_003400418.1.89225 WP_003400418.1.8925 WP_003400418.1.89277 WP_003400418.1.89286 WP_003400418.1.89293 WP_003400418.1.89320 WP_003400418.1.8935 WP_003400418.1.89371 WP_003400418.1.89378 WP_003400418.1.89392 WP_003400418.1.89406 WP_003400418.1.8943 WP_003400418.1.89451 WP_003400418.1.89453 WP_003400418.1.89473 WP_003400418.1.89475 WP_003400418.1.89483 WP_003400418.1.895 WP_003400418.1.89513 WP_003400418.1.89517 WP_003400418.1.89522 WP_003400418.1.8954 WP_003400418.1.89543 WP_003400418.1.89567 WP_003400418.1.8957 WP_003400418.1.89572 WP_003400418.1.89589 WP_003400418.1.89607 WP_003400418.1.89613 WP_003400418.1.89625 WP_003400418.1.89648 WP_003400418.1.8967 WP_003400418.1.89670 WP_003400418.1.89676 WP_003400418.1.89729 WP_003400418.1.89739 WP_003400418.1.89762 WP_003400418.1.8977 WP_003400418.1.89802 WP_003400418.1.89808 WP_003400418.1.8982 WP_003400418.1.89829 WP_003400418.1.89831 WP_003400418.1.89844 WP_003400418.1.89849 WP_003400418.1.8989 WP_003400418.1.89901 WP_003400418.1.89903 WP_003400418.1.89909 WP_003400418.1.89922 WP_003400418.1.89926 WP_003400418.1.89963 WP_003400418.1.89971 WP_003400418.1.8998 WP_003400418.1.89987 WP_003400418.1.900 WP_003400418.1.90048 WP_003400418.1.9007 WP_003400418.1.90080 WP_003400418.1.90130 WP_003400418.1.90134 WP_003400418.1.90137 WP_003400418.1.90157 WP_003400418.1.90184 WP_003400418.1.90199 WP_003400418.1.90231 WP_003400418.1.90245 WP_003400418.1.90308 WP_003400418.1.90322 WP_003400418.1.90328 WP_003400418.1.90372 WP_003400418.1.90439 WP_003400418.1.90481 WP_003400418.1.90499 WP_003400418.1.9050 WP_003400418.1.90527 WP_003400418.1.90550 WP_003400418.1.90560 WP_003400418.1.90612 WP_003400418.1.90640 WP_003400418.1.90672 WP_003400418.1.90687 WP_003400418.1.90691 WP_003400418.1.90711 WP_003400418.1.90722 WP_003400418.1.90744 WP_003400418.1.9075 WP_003400418.1.90756 WP_003400418.1.90767 WP_003400418.1.90771 WP_003400418.1.90785 WP_003400418.1.90788 WP_003400418.1.90800 WP_003400418.1.90810 WP_003400418.1.90816 WP_003400418.1.90819 WP_003400418.1.9082 WP_003400418.1.90831 WP_003400418.1.90884 WP_003400418.1.90899 WP_003400418.1.90906 WP_003400418.1.90958 WP_003400418.1.90976 WP_003400418.1.90977 WP_003400418.1.90987 WP_003400418.1.9102 WP_003400418.1.91026 WP_003400418.1.91032 WP_003400418.1.91043 WP_003400418.1.91053 WP_003400418.1.91082 WP_003400418.1.91106 WP_003400418.1.91112 WP_003400418.1.91144 WP_003400418.1.91151 WP_003400418.1.91157 WP_003400418.1.91167 WP_003400418.1.91169 WP_003400418.1.91192 WP_003400418.1.91201 WP_003400418.1.91207 WP_003400418.1.91208 WP_003400418.1.91211 WP_003400418.1.91214 WP_003400418.1.91230 WP_003400418.1.91244 WP_003400418.1.91251 WP_003400418.1.91260 WP_003400418.1.91265 WP_003400418.1.9128 WP_003400418.1.91284 WP_003400418.1.91294 WP_003400418.1.91303 WP_003400418.1.91322 WP_003400418.1.91352 WP_003400418.1.91386 WP_003400418.1.9139 WP_003400418.1.91398 WP_003400418.1.91411 WP_003400418.1.91430 WP_003400418.1.91436 WP_003400418.1.91483 WP_003400418.1.91496 WP_003400418.1.91507 WP_003400418.1.91508 WP_003400418.1.91576 WP_003400418.1.91589 WP_003400418.1.91694 WP_003400418.1.91695 WP_003400418.1.91713 WP_003400418.1.91716 WP_003400418.1.91717 WP_003400418.1.91728 WP_003400418.1.91743 WP_003400418.1.91759 WP_003400418.1.91784 WP_003400418.1.91785 WP_003400418.1.91786 WP_003400418.1.91802 WP_003400418.1.91822 WP_003400418.1.91828 WP_003400418.1.9189 WP_003400418.1.91896 WP_003400418.1.9190 WP_003400418.1.91915 WP_003400418.1.91931 WP_003400418.1.91937 WP_003400418.1.91944 WP_003400418.1.91953 WP_003400418.1.91957 WP_003400418.1.91976 WP_003400418.1.91978 WP_003400418.1.92021 WP_003400418.1.92083 WP_003400418.1.92127 WP_003400418.1.92144 WP_003400418.1.92150 WP_003400418.1.92153 WP_003400418.1.92190 WP_003400418.1.92192 WP_003400418.1.92200 WP_003400418.1.92220 WP_003400418.1.92221 WP_003400418.1.92222 WP_003400418.1.92273 WP_003400418.1.92289 WP_003400418.1.9229 WP_003400418.1.92294 WP_003400418.1.92300 WP_003400418.1.92317 WP_003400418.1.92334 WP_003400418.1.92338 WP_003400418.1.92345 WP_003400418.1.92356 WP_003400418.1.92364 WP_003400418.1.92380 WP_003400418.1.92416 WP_003400418.1.92428 WP_003400418.1.92447 WP_003400418.1.92456 WP_003400418.1.92467 WP_003400418.1.92471 WP_003400418.1.92490 WP_003400418.1.92508 WP_003400418.1.9251 WP_003400418.1.92511 WP_003400418.1.92523 WP_003400418.1.92527 WP_003400418.1.92536 WP_003400418.1.92592 WP_003400418.1.92597 WP_003400418.1.92603 WP_003400418.1.92606 WP_003400418.1.92610 WP_003400418.1.92613 WP_003400418.1.9263 WP_003400418.1.9265 WP_003400418.1.92650 WP_003400418.1.92660 WP_003400418.1.92677 WP_003400418.1.92685 WP_003400418.1.92689 WP_003400418.1.92690 WP_003400418.1.92706 WP_003400418.1.92714 WP_003400418.1.92736 WP_003400418.1.9274 WP_003400418.1.92752 WP_003400418.1.92760 WP_003400418.1.92777 WP_003400418.1.92803 WP_003400418.1.92833 WP_003400418.1.92856 WP_003400418.1.92881 WP_003400418.1.92892 WP_003400418.1.92907 WP_003400418.1.92908 WP_003400418.1.9291 WP_003400418.1.92917 WP_003400418.1.92996 WP_003400418.1.93006 WP_003400418.1.93008 WP_003400418.1.93009 WP_003400418.1.93015 WP_003400418.1.93043 WP_003400418.1.9307 WP_003400418.1.93083 WP_003400418.1.93097 WP_003400418.1.93137 WP_003400418.1.93192 WP_003400418.1.93199 WP_003400418.1.93203 WP_003400418.1.93212 WP_003400418.1.93234 WP_003400418.1.93245 WP_003400418.1.93257 WP_003400418.1.93265 WP_003400418.1.93297 WP_003400418.1.93320 WP_003400418.1.93328 WP_003400418.1.93337 WP_003400418.1.93343 WP_003400418.1.93349 WP_003400418.1.93363 WP_003400418.1.93377 WP_003400418.1.9338 WP_003400418.1.93407 WP_003400418.1.93417 WP_003400418.1.93419 WP_003400418.1.93426 WP_003400418.1.9344 WP_003400418.1.93443 WP_003400418.1.93447 WP_003400418.1.93470 WP_003400418.1.93483 WP_003400418.1.93487 WP_003400418.1.93495 WP_003400418.1.93499 WP_003400418.1.93516 WP_003400418.1.93536 WP_003400418.1.93544 WP_003400418.1.93555 WP_003400418.1.93560 WP_003400418.1.93564 WP_003400418.1.9357 WP_003400418.1.93573 WP_003400418.1.93576 WP_003400418.1.93588 WP_003400418.1.9363 WP_003400418.1.93645 WP_003400418.1.93649 WP_003400418.1.93659 WP_003400418.1.93677 WP_003400418.1.9368 WP_003400418.1.93689 WP_003400418.1.93693 WP_003400418.1.93698 WP_003400418.1.93706 WP_003400418.1.9371 WP_003400418.1.93792 WP_003400418.1.93823 WP_003400418.1.93871 WP_003400418.1.9388 WP_003400418.1.93894 WP_003400418.1.93903 WP_003400418.1.93907 WP_003400418.1.93913 WP_003400418.1.93946 WP_003400418.1.93950 WP_003400418.1.93953 WP_003400418.1.93954 WP_003400418.1.93988 WP_003400418.1.9407 WP_003400418.1.94143 WP_003400418.1.94154 WP_003400418.1.94184 WP_003400418.1.94204 WP_003400418.1.94205 WP_003400418.1.94226 WP_003400418.1.94231 WP_003400418.1.94256 WP_003400418.1.94261 WP_003400418.1.94281 WP_003400418.1.94292 WP_003400418.1.94297 WP_003400418.1.9431 WP_003400418.1.94326 WP_003400418.1.94339 WP_003400418.1.94392 WP_003400418.1.94416 WP_003400418.1.94421 WP_003400418.1.94456 WP_003400418.1.94470 WP_003400418.1.94480 WP_003400418.1.94495 WP_003400418.1.94511 WP_003400418.1.94512 WP_003400418.1.94525 WP_003400418.1.94528 WP_003400418.1.94564 WP_003400418.1.946 WP_003400418.1.94602 WP_003400418.1.94623 WP_003400418.1.94629 WP_003400418.1.9465 WP_003400418.1.94673 WP_003400418.1.94714 WP_003400418.1.94730 WP_003400418.1.94736 WP_003400418.1.94776 WP_003400418.1.9478 WP_003400418.1.94834 WP_003400418.1.94852 WP_003400418.1.94872 WP_003400418.1.9488 WP_003400418.1.94902 WP_003400418.1.94916 WP_003400418.1.94979 WP_003400418.1.94994 WP_003400418.1.94996 WP_003400418.1.94998 WP_003400418.1.95007 WP_003400418.1.95010 WP_003400418.1.95015 WP_003400418.1.95034 WP_003400418.1.95068 WP_003400418.1.95081 WP_003400418.1.95082 WP_003400418.1.9509 WP_003400418.1.95096 WP_003400418.1.95112 WP_003400418.1.95138 WP_003400418.1.9514 WP_003400418.1.95179 WP_003400418.1.95188 WP_003400418.1.95190 WP_003400418.1.95234 WP_003400418.1.95241 WP_003400418.1.95245 WP_003400418.1.95257 WP_003400418.1.95279 WP_003400418.1.9531 WP_003400418.1.95335 WP_003400418.1.95344 WP_003400418.1.9535 WP_003400418.1.95370 WP_003400418.1.95392 WP_003400418.1.95416 WP_003400418.1.95417 WP_003400418.1.95454 WP_003400418.1.95455 WP_003400418.1.95491 WP_003400418.1.95497 WP_003400418.1.95508 WP_003400418.1.95509 WP_003400418.1.95529 WP_003400418.1.95556 WP_003400418.1.95557 WP_003400418.1.95565 WP_003400418.1.95578 WP_003400418.1.95580 WP_003400418.1.95585 WP_003400418.1.95679 WP_003400418.1.95685 WP_003400418.1.957 WP_003400418.1.95724 WP_003400418.1.95727 WP_003400418.1.95730 WP_003400418.1.95735 WP_003400418.1.95758 WP_003400418.1.95772 WP_003400418.1.95797 WP_003400418.1.95839 WP_003400418.1.9585 WP_003400418.1.9590 WP_003400418.1.95902 WP_003400418.1.95908 WP_003400418.1.95924 WP_003400418.1.95926 WP_003400418.1.95953 WP_003400418.1.95958 WP_003400418.1.95964 WP_003400418.1.95973 WP_003400418.1.96006 WP_003400418.1.9602 WP_003400418.1.96036 WP_003400418.1.96062 WP_003400418.1.96065 WP_003400418.1.96098 WP_003400418.1.96146 WP_003400418.1.96166 WP_003400418.1.96171 WP_003400418.1.96182 WP_003400418.1.96204 WP_003400418.1.96230 WP_003400418.1.96235 WP_003400418.1.96245 WP_003400418.1.96254 WP_003400418.1.96259 WP_003400418.1.96286 WP_003400418.1.96313 WP_003400418.1.96318 WP_003400418.1.96345 WP_003400418.1.96360 WP_003400418.1.96373 WP_003400418.1.96456 WP_003400418.1.96486 WP_003400418.1.96560 WP_003400418.1.96569 WP_003400418.1.96573 WP_003400418.1.96575 WP_003400418.1.96576 WP_003400418.1.96611 WP_003400418.1.96621 WP_003400418.1.9667 WP_003400418.1.96681 WP_003400418.1.96726 WP_003400418.1.96733 WP_003400418.1.96742 WP_003400418.1.96754 WP_003400418.1.9678 WP_003400418.1.96832 WP_003400418.1.9685 WP_003400418.1.97008 WP_003400418.1.97009 WP_003400418.1.97056 WP_003400418.1.97084 WP_003400418.1.97087 WP_003400418.1.97094 WP_003400418.1.97096 WP_003400418.1.97099 WP_003400418.1.97108 WP_003400418.1.97113 WP_003400418.1.97122 WP_003400418.1.97127 WP_003400418.1.97129 WP_003400418.1.97136 WP_003400418.1.9716 WP_003400418.1.97176 WP_003400418.1.97222 WP_003400418.1.97223 WP_003400418.1.97237 WP_003400418.1.97242 WP_003400418.1.97270 WP_003400418.1.97283 WP_003400418.1.97296 WP_003400418.1.97321 WP_003400418.1.97325 WP_003400418.1.97330 WP_003400418.1.97366 WP_003400418.1.97376 WP_003400418.1.97380 WP_003400418.1.9739 WP_003400418.1.97462 WP_003400418.1.97517 WP_003400418.1.97519 WP_003400418.1.97535 WP_003400418.1.97540 WP_003400418.1.97545 WP_003400418.1.97546 WP_003400418.1.97550 WP_003400418.1.97568 WP_003400418.1.97577 WP_003400418.1.97584 WP_003400418.1.9759 WP_003400418.1.97591 WP_003400418.1.97596 WP_003400418.1.97609 WP_003400418.1.97618 WP_003400418.1.9763 WP_003400418.1.97669 WP_003400418.1.97673 WP_003400418.1.97700 WP_003400418.1.97701 WP_003400418.1.9773 WP_003400418.1.97730 WP_003400418.1.97740 WP_003400418.1.97751 WP_003400418.1.97754 WP_003400418.1.97797 WP_003400418.1.9782 WP_003400418.1.9784 WP_003400418.1.97888 WP_003400418.1.9790 WP_003400418.1.9795 WP_003400418.1.97951 WP_003400418.1.97958 WP_003400418.1.97966 WP_003400418.1.97977 WP_003400418.1.97979 WP_003400418.1.97995 WP_003400418.1.98018 WP_003400418.1.98034 WP_003400418.1.98052 WP_003400418.1.98071 WP_003400418.1.98072 WP_003400418.1.98113 WP_003400418.1.98114 WP_003400418.1.98128 WP_003400418.1.98181 WP_003400418.1.98188 WP_003400418.1.98189 WP_003400418.1.98213 WP_003400418.1.98225 WP_003400418.1.98291 WP_003400418.1.98335 WP_003400418.1.98350 WP_003400418.1.98395 WP_003400418.1.98412 WP_003400418.1.98441 WP_003400418.1.98443 WP_003400418.1.98462 WP_003400418.1.9848 WP_003400418.1.98482 WP_003400418.1.98486 WP_003400418.1.98488 WP_003400418.1.98503 WP_003400418.1.98516 WP_003400418.1.98524 WP_003400418.1.98536 WP_003400418.1.98541 WP_003400418.1.98566 WP_003400418.1.98576 WP_003400418.1.98590 WP_003400418.1.98594 WP_003400418.1.98599 WP_003400418.1.98629 WP_003400418.1.98645 WP_003400418.1.98646 WP_003400418.1.98649 WP_003400418.1.98656 WP_003400418.1.9867 WP_003400418.1.98674 WP_003400418.1.98697 WP_003400418.1.98701 WP_003400418.1.98739 WP_003400418.1.98749 WP_003400418.1.98765 WP_003400418.1.98770 WP_003400418.1.98777 WP_003400418.1.98778 WP_003400418.1.98802 WP_003400418.1.98838 WP_003400418.1.98850 WP_003400418.1.98906 WP_003400418.1.98935 WP_003400418.1.98948 WP_003400418.1.98953 WP_003400418.1.98984 WP_003400418.1.99000 WP_003400418.1.99023 WP_003400418.1.99030 WP_003400418.1.99037 WP_003400418.1.99055 WP_003400418.1.99062 WP_003400418.1.99086 WP_003400418.1.99115 WP_003400418.1.99117 WP_003400418.1.99161 WP_003400418.1.99176 WP_003400418.1.99205 WP_003400418.1.99211 WP_003400418.1.99216 WP_003400418.1.99222 WP_003400418.1.99251 WP_003400418.1.99269 WP_003400418.1.99294 WP_003400418.1.99312 WP_003400418.1.99315 WP_003400418.1.99316 WP_003400418.1.99322 WP_003400418.1.99328 WP_003400418.1.99365 WP_003400418.1.99368 WP_003400418.1.99396 WP_003400418.1.99402 WP_003400418.1.99404 WP_003400418.1.99419 WP_003400418.1.99438 WP_003400418.1.99460 WP_003400418.1.99468 WP_003400418.1.99473 WP_003400418.1.99513 WP_003400418.1.99529 WP_003400418.1.99548 WP_003400418.1.99572 WP_003400418.1.99578 WP_003400418.1.99605 WP_003400418.1.99609 WP_003400418.1.99617 WP_003400418.1.99635 WP_003400418.1.99650 WP_003400418.1.99672 WP_003400418.1.99701 WP_003400418.1.99711 WP_003400418.1.99716 WP_003400418.1.99740 WP_003400418.1.99745 WP_003400418.1.99749 WP_003400418.1.9976 WP_003400418.1.99798 WP_003400418.1.99817 WP_003400418.1.99832 WP_003400418.1.99847 WP_003400418.1.99852 WP_003400418.1.99886 WP_003400418.1.99897 WP_003400418.1.99899 WP_003400418.1.99915 WP_003400418.1.9993 WP_003400418.1.99982 WP_003400418.1.99991 gi|148821223|ref|YP_001285977.1| gi|148659793|ref|YP_001281316.1| gi|392430442|ref|YP_006471486.1| gi|340625066|ref|YP_004743518.1| gi|15839410|ref|NP_334447.1| gi|121635943|ref|YP_976166.1| gi|506924424|ref|YP_008004874.1| gi|494698399|ref|YP_007963881.1| gi|253796948|ref|YP_003029949.1| gi|224988416|ref|YP_002643083.1| gi|378769776|ref|YP_005169509.1| gi|385996804|ref|YP_005915102.1| gi|525672907|ref|YP_008224132.1| gi|433625125|ref|YP_007258754.1| gi|15607175|ref|NP_214547.1| gi|449062012|ref|YP_007429095.1| gi|383305972|ref|YP_005358783.1| gi|392384753|ref|YP_005306382.1| gi|479053965|ref|YP_007349771.1| gi|494694418|ref|YP_007959921.1| gi|15607175|ref|NP_214547.1| gi|471335822|ref|YP_007608535.1| 233413.Mb0034 336982.TBFG_10032 410289.BCG_0064 419947.MRA_0036 478434.TBMG_00032 561275.JTY_0034 83331.MT0038 83332.Rv0033 gi|31791210|ref|NP_853703.1| gi|479312869|ref|YP_007852921.1| gi|375294233|ref|YP_005098500.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]