SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I6WXK4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I6WXK4
Domain Number 1 Region: 5-275
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.54e-60
Family Mycobacterial PtpB-like 0.000000000206
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I6WXK4
Sequence length 276
Comment (tr|I6WXK4|I6WXK4_MYCTU) Phosphotyrosine protein phosphatase PTPB (Protein-tyrosine-phosphatase) (PTPase) {ECO:0000313|EMBL:CCP42878.1} KW=Complete proteome; Reference proteome OX=83332 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv). GN=Rv0153c OC=Mycobacterium; Mycobacterium tuberculosis complex.
Sequence
MAVRELPGAWNFRDVADTATALRPGRLFRSSELSRLDDAGRATLRRLGITDVADLRSSRE
VARRGPGRVPDGIDVHLLPFPDLADDDADDSAPHETAFKRLLTNDGSNGESGESSQSIND
AATRYMTDEYRQFPTRNGAQRALHRVVTLLAAGRPVLTHCFAGKDRTGFVVALVLEAVGL
DRDVIVADYLRSNDSVPQLRARISEMIQQRFDTELAPEVVTFTKARLSDGVLGVRAEYLA
AARQTIDETYGSLGGYLRDAGISQATVNRMRGVLLG
Download sequence
Identical sequences A0A045ISB3 A0A0H3L4R6 A0A109SJW9 A0A109STD9 A0A197IY33 A0A1S1BET9 A5TYM8 F8M046 I6WXK4 L0T4I7 M8CJS8 P96830
gi|392430566|ref|YP_006471610.1| NP_214667.1.84033 WP_003401010.1.100000 WP_003401010.1.100021 WP_003401010.1.100069 WP_003401010.1.100087 WP_003401010.1.10015 WP_003401010.1.100208 WP_003401010.1.100216 WP_003401010.1.10022 WP_003401010.1.100255 WP_003401010.1.100260 WP_003401010.1.100270 WP_003401010.1.100279 WP_003401010.1.100286 WP_003401010.1.100308 WP_003401010.1.100309 WP_003401010.1.100318 WP_003401010.1.100337 WP_003401010.1.100338 WP_003401010.1.10037 WP_003401010.1.100383 WP_003401010.1.100395 WP_003401010.1.100396 WP_003401010.1.1004 WP_003401010.1.100401 WP_003401010.1.100459 WP_003401010.1.100460 WP_003401010.1.100552 WP_003401010.1.100581 WP_003401010.1.100600 WP_003401010.1.100625 WP_003401010.1.10064 WP_003401010.1.100666 WP_003401010.1.100671 WP_003401010.1.100677 WP_003401010.1.100682 WP_003401010.1.100697 WP_003401010.1.100703 WP_003401010.1.100716 WP_003401010.1.100722 WP_003401010.1.100754 WP_003401010.1.100757 WP_003401010.1.100772 WP_003401010.1.1008 WP_003401010.1.100812 WP_003401010.1.100845 WP_003401010.1.100866 WP_003401010.1.10088 WP_003401010.1.100889 WP_003401010.1.10090 WP_003401010.1.100910 WP_003401010.1.100915 WP_003401010.1.100918 WP_003401010.1.100935 WP_003401010.1.100984 WP_003401010.1.100992 WP_003401010.1.100998 WP_003401010.1.101 WP_003401010.1.101025 WP_003401010.1.101028 WP_003401010.1.10104 WP_003401010.1.101048 WP_003401010.1.101054 WP_003401010.1.101075 WP_003401010.1.101143 WP_003401010.1.10116 WP_003401010.1.10117 WP_003401010.1.101209 WP_003401010.1.10125 WP_003401010.1.101290 WP_003401010.1.101323 WP_003401010.1.101324 WP_003401010.1.101350 WP_003401010.1.101367 WP_003401010.1.101398 WP_003401010.1.101403 WP_003401010.1.101421 WP_003401010.1.10144 WP_003401010.1.101442 WP_003401010.1.10145 WP_003401010.1.101452 WP_003401010.1.101456 WP_003401010.1.101481 WP_003401010.1.101493 WP_003401010.1.101496 WP_003401010.1.101525 WP_003401010.1.101533 WP_003401010.1.101535 WP_003401010.1.101553 WP_003401010.1.101558 WP_003401010.1.10156 WP_003401010.1.101573 WP_003401010.1.101576 WP_003401010.1.10159 WP_003401010.1.101592 WP_003401010.1.101604 WP_003401010.1.101607 WP_003401010.1.101622 WP_003401010.1.101644 WP_003401010.1.101659 WP_003401010.1.101671 WP_003401010.1.101687 WP_003401010.1.101698 WP_003401010.1.10170 WP_003401010.1.101713 WP_003401010.1.101722 WP_003401010.1.101733 WP_003401010.1.101743 WP_003401010.1.101753 WP_003401010.1.101754 WP_003401010.1.101764 WP_003401010.1.101773 WP_003401010.1.101795 WP_003401010.1.101797 WP_003401010.1.101798 WP_003401010.1.101802 WP_003401010.1.101826 WP_003401010.1.101836 WP_003401010.1.101858 WP_003401010.1.101859 WP_003401010.1.101862 WP_003401010.1.101888 WP_003401010.1.101894 WP_003401010.1.101899 WP_003401010.1.1019 WP_003401010.1.101923 WP_003401010.1.101925 WP_003401010.1.10193 WP_003401010.1.102 WP_003401010.1.102008 WP_003401010.1.102017 WP_003401010.1.102053 WP_003401010.1.102055 WP_003401010.1.102063 WP_003401010.1.102099 WP_003401010.1.1021 WP_003401010.1.10211 WP_003401010.1.102119 WP_003401010.1.102121 WP_003401010.1.102143 WP_003401010.1.10216 WP_003401010.1.10224 WP_003401010.1.10253 WP_003401010.1.10262 WP_003401010.1.10272 WP_003401010.1.10277 WP_003401010.1.1033 WP_003401010.1.10350 WP_003401010.1.10362 WP_003401010.1.10366 WP_003401010.1.10376 WP_003401010.1.10396 WP_003401010.1.10410 WP_003401010.1.10414 WP_003401010.1.10421 WP_003401010.1.10430 WP_003401010.1.1044 WP_003401010.1.10440 WP_003401010.1.10471 WP_003401010.1.10472 WP_003401010.1.10489 WP_003401010.1.105 WP_003401010.1.10518 WP_003401010.1.10523 WP_003401010.1.10545 WP_003401010.1.1057 WP_003401010.1.10594 WP_003401010.1.10603 WP_003401010.1.10606 WP_003401010.1.10615 WP_003401010.1.10623 WP_003401010.1.10635 WP_003401010.1.10643 WP_003401010.1.10648 WP_003401010.1.10662 WP_003401010.1.10709 WP_003401010.1.10735 WP_003401010.1.10740 WP_003401010.1.10756 WP_003401010.1.1078 WP_003401010.1.10791 WP_003401010.1.10799 WP_003401010.1.10825 WP_003401010.1.10848 WP_003401010.1.10863 WP_003401010.1.10879 WP_003401010.1.10912 WP_003401010.1.10916 WP_003401010.1.10923 WP_003401010.1.10927 WP_003401010.1.1095 WP_003401010.1.10956 WP_003401010.1.10958 WP_003401010.1.10962 WP_003401010.1.10980 WP_003401010.1.10981 WP_003401010.1.10993 WP_003401010.1.1100 WP_003401010.1.11040 WP_003401010.1.11061 WP_003401010.1.11070 WP_003401010.1.11141 WP_003401010.1.11171 WP_003401010.1.11175 WP_003401010.1.11176 WP_003401010.1.11222 WP_003401010.1.11236 WP_003401010.1.11329 WP_003401010.1.1133 WP_003401010.1.11342 WP_003401010.1.11373 WP_003401010.1.11376 WP_003401010.1.11390 WP_003401010.1.11402 WP_003401010.1.11481 WP_003401010.1.11487 WP_003401010.1.11489 WP_003401010.1.11491 WP_003401010.1.11514 WP_003401010.1.11589 WP_003401010.1.11596 WP_003401010.1.11604 WP_003401010.1.11610 WP_003401010.1.11697 WP_003401010.1.11707 WP_003401010.1.11752 WP_003401010.1.11758 WP_003401010.1.11761 WP_003401010.1.11775 WP_003401010.1.11804 WP_003401010.1.11822 WP_003401010.1.11826 WP_003401010.1.11856 WP_003401010.1.11898 WP_003401010.1.11906 WP_003401010.1.11939 WP_003401010.1.11960 WP_003401010.1.11961 WP_003401010.1.11972 WP_003401010.1.11984 WP_003401010.1.120 WP_003401010.1.12001 WP_003401010.1.12049 WP_003401010.1.12052 WP_003401010.1.12100 WP_003401010.1.12116 WP_003401010.1.12130 WP_003401010.1.12133 WP_003401010.1.12161 WP_003401010.1.12165 WP_003401010.1.12184 WP_003401010.1.12190 WP_003401010.1.12216 WP_003401010.1.12265 WP_003401010.1.12275 WP_003401010.1.12293 WP_003401010.1.12294 WP_003401010.1.123 WP_003401010.1.1231 WP_003401010.1.12314 WP_003401010.1.12327 WP_003401010.1.12338 WP_003401010.1.1236 WP_003401010.1.12371 WP_003401010.1.12372 WP_003401010.1.12389 WP_003401010.1.12406 WP_003401010.1.1241 WP_003401010.1.12421 WP_003401010.1.12424 WP_003401010.1.12446 WP_003401010.1.12464 WP_003401010.1.12479 WP_003401010.1.12519 WP_003401010.1.12523 WP_003401010.1.12526 WP_003401010.1.1255 WP_003401010.1.12550 WP_003401010.1.12551 WP_003401010.1.12563 WP_003401010.1.12611 WP_003401010.1.12669 WP_003401010.1.1267 WP_003401010.1.12672 WP_003401010.1.12692 WP_003401010.1.1271 WP_003401010.1.12768 WP_003401010.1.1279 WP_003401010.1.12794 WP_003401010.1.12804 WP_003401010.1.12821 WP_003401010.1.12841 WP_003401010.1.12854 WP_003401010.1.12871 WP_003401010.1.12901 WP_003401010.1.12941 WP_003401010.1.12947 WP_003401010.1.12957 WP_003401010.1.12972 WP_003401010.1.13028 WP_003401010.1.13043 WP_003401010.1.13086 WP_003401010.1.13087 WP_003401010.1.13090 WP_003401010.1.13096 WP_003401010.1.13163 WP_003401010.1.13175 WP_003401010.1.13183 WP_003401010.1.132 WP_003401010.1.13282 WP_003401010.1.13284 WP_003401010.1.13296 WP_003401010.1.13298 WP_003401010.1.13302 WP_003401010.1.13306 WP_003401010.1.13312 WP_003401010.1.13313 WP_003401010.1.13321 WP_003401010.1.13345 WP_003401010.1.13358 WP_003401010.1.13370 WP_003401010.1.13375 WP_003401010.1.1338 WP_003401010.1.13420 WP_003401010.1.13433 WP_003401010.1.13435 WP_003401010.1.13438 WP_003401010.1.13461 WP_003401010.1.13466 WP_003401010.1.13489 WP_003401010.1.13526 WP_003401010.1.13551 WP_003401010.1.13561 WP_003401010.1.13564 WP_003401010.1.13579 WP_003401010.1.13647 WP_003401010.1.13687 WP_003401010.1.13697 WP_003401010.1.13719 WP_003401010.1.13763 WP_003401010.1.1377 WP_003401010.1.13774 WP_003401010.1.13786 WP_003401010.1.13793 WP_003401010.1.13794 WP_003401010.1.13817 WP_003401010.1.13834 WP_003401010.1.13866 WP_003401010.1.13880 WP_003401010.1.13899 WP_003401010.1.13909 WP_003401010.1.13910 WP_003401010.1.13919 WP_003401010.1.13920 WP_003401010.1.13952 WP_003401010.1.13953 WP_003401010.1.13962 WP_003401010.1.1398 WP_003401010.1.13988 WP_003401010.1.14027 WP_003401010.1.14046 WP_003401010.1.14115 WP_003401010.1.1415 WP_003401010.1.14152 WP_003401010.1.14158 WP_003401010.1.14162 WP_003401010.1.14175 WP_003401010.1.14178 WP_003401010.1.14194 WP_003401010.1.14195 WP_003401010.1.14208 WP_003401010.1.14238 WP_003401010.1.14266 WP_003401010.1.14273 WP_003401010.1.14303 WP_003401010.1.14306 WP_003401010.1.14307 WP_003401010.1.14310 WP_003401010.1.14341 WP_003401010.1.14382 WP_003401010.1.14416 WP_003401010.1.14428 WP_003401010.1.14441 WP_003401010.1.14469 WP_003401010.1.14477 WP_003401010.1.14504 WP_003401010.1.14514 WP_003401010.1.1452 WP_003401010.1.14527 WP_003401010.1.1454 WP_003401010.1.14544 WP_003401010.1.14548 WP_003401010.1.14551 WP_003401010.1.14561 WP_003401010.1.14573 WP_003401010.1.1462 WP_003401010.1.14667 WP_003401010.1.14668 WP_003401010.1.14675 WP_003401010.1.14694 WP_003401010.1.14695 WP_003401010.1.14709 WP_003401010.1.14766 WP_003401010.1.14783 WP_003401010.1.14865 WP_003401010.1.14872 WP_003401010.1.14905 WP_003401010.1.14926 WP_003401010.1.14951 WP_003401010.1.14955 WP_003401010.1.15003 WP_003401010.1.15009 WP_003401010.1.15028 WP_003401010.1.15040 WP_003401010.1.15052 WP_003401010.1.15065 WP_003401010.1.15072 WP_003401010.1.15089 WP_003401010.1.1509 WP_003401010.1.15126 WP_003401010.1.15131 WP_003401010.1.15168 WP_003401010.1.15172 WP_003401010.1.15174 WP_003401010.1.15187 WP_003401010.1.15196 WP_003401010.1.15210 WP_003401010.1.15216 WP_003401010.1.15217 WP_003401010.1.1523 WP_003401010.1.15232 WP_003401010.1.15238 WP_003401010.1.15240 WP_003401010.1.15267 WP_003401010.1.1527 WP_003401010.1.15292 WP_003401010.1.15299 WP_003401010.1.15302 WP_003401010.1.15322 WP_003401010.1.1534 WP_003401010.1.15365 WP_003401010.1.15372 WP_003401010.1.15386 WP_003401010.1.15387 WP_003401010.1.15442 WP_003401010.1.15447 WP_003401010.1.15449 WP_003401010.1.15477 WP_003401010.1.15481 WP_003401010.1.15492 WP_003401010.1.15511 WP_003401010.1.15512 WP_003401010.1.15558 WP_003401010.1.15559 WP_003401010.1.15566 WP_003401010.1.15599 WP_003401010.1.1560 WP_003401010.1.15611 WP_003401010.1.1563 WP_003401010.1.15633 WP_003401010.1.15643 WP_003401010.1.15688 WP_003401010.1.15755 WP_003401010.1.15763 WP_003401010.1.15774 WP_003401010.1.1578 WP_003401010.1.15780 WP_003401010.1.15827 WP_003401010.1.15834 WP_003401010.1.15842 WP_003401010.1.15848 WP_003401010.1.15853 WP_003401010.1.15870 WP_003401010.1.15877 WP_003401010.1.15893 WP_003401010.1.15896 WP_003401010.1.15926 WP_003401010.1.15933 WP_003401010.1.15946 WP_003401010.1.15958 WP_003401010.1.15973 WP_003401010.1.15987 WP_003401010.1.15993 WP_003401010.1.16009 WP_003401010.1.16025 WP_003401010.1.16043 WP_003401010.1.16055 WP_003401010.1.16066 WP_003401010.1.16069 WP_003401010.1.16077 WP_003401010.1.16106 WP_003401010.1.16108 WP_003401010.1.16110 WP_003401010.1.16130 WP_003401010.1.16136 WP_003401010.1.16139 WP_003401010.1.16141 WP_003401010.1.16143 WP_003401010.1.1630 WP_003401010.1.16318 WP_003401010.1.1632 WP_003401010.1.16327 WP_003401010.1.16334 WP_003401010.1.16341 WP_003401010.1.16345 WP_003401010.1.16374 WP_003401010.1.16384 WP_003401010.1.16386 WP_003401010.1.164 WP_003401010.1.1642 WP_003401010.1.16421 WP_003401010.1.16424 WP_003401010.1.16426 WP_003401010.1.16431 WP_003401010.1.16438 WP_003401010.1.1644 WP_003401010.1.16442 WP_003401010.1.16448 WP_003401010.1.16451 WP_003401010.1.16476 WP_003401010.1.16480 WP_003401010.1.16494 WP_003401010.1.1652 WP_003401010.1.16549 WP_003401010.1.16560 WP_003401010.1.16598 WP_003401010.1.16609 WP_003401010.1.16619 WP_003401010.1.16620 WP_003401010.1.16622 WP_003401010.1.16637 WP_003401010.1.1669 WP_003401010.1.16707 WP_003401010.1.16724 WP_003401010.1.16731 WP_003401010.1.16743 WP_003401010.1.1683 WP_003401010.1.16837 WP_003401010.1.16852 WP_003401010.1.16937 WP_003401010.1.16940 WP_003401010.1.16950 WP_003401010.1.16959 WP_003401010.1.16968 WP_003401010.1.1697 WP_003401010.1.16977 WP_003401010.1.16987 WP_003401010.1.17005 WP_003401010.1.17006 WP_003401010.1.17010 WP_003401010.1.17015 WP_003401010.1.17019 WP_003401010.1.17041 WP_003401010.1.17052 WP_003401010.1.17057 WP_003401010.1.17062 WP_003401010.1.1707 WP_003401010.1.17094 WP_003401010.1.17130 WP_003401010.1.17138 WP_003401010.1.17147 WP_003401010.1.17167 WP_003401010.1.17224 WP_003401010.1.17251 WP_003401010.1.17288 WP_003401010.1.17304 WP_003401010.1.17345 WP_003401010.1.17381 WP_003401010.1.17391 WP_003401010.1.17412 WP_003401010.1.1743 WP_003401010.1.17440 WP_003401010.1.17466 WP_003401010.1.17477 WP_003401010.1.17483 WP_003401010.1.17505 WP_003401010.1.17527 WP_003401010.1.17535 WP_003401010.1.17540 WP_003401010.1.17553 WP_003401010.1.17558 WP_003401010.1.17599 WP_003401010.1.17635 WP_003401010.1.17655 WP_003401010.1.17679 WP_003401010.1.17687 WP_003401010.1.17700 WP_003401010.1.17710 WP_003401010.1.17713 WP_003401010.1.17722 WP_003401010.1.17746 WP_003401010.1.17788 WP_003401010.1.17798 WP_003401010.1.17803 WP_003401010.1.17816 WP_003401010.1.17821 WP_003401010.1.17830 WP_003401010.1.17868 WP_003401010.1.17878 WP_003401010.1.1792 WP_003401010.1.17923 WP_003401010.1.1795 WP_003401010.1.17955 WP_003401010.1.17973 WP_003401010.1.18009 WP_003401010.1.18013 WP_003401010.1.18033 WP_003401010.1.18057 WP_003401010.1.18065 WP_003401010.1.18070 WP_003401010.1.18116 WP_003401010.1.18120 WP_003401010.1.18126 WP_003401010.1.1817 WP_003401010.1.18170 WP_003401010.1.18206 WP_003401010.1.18216 WP_003401010.1.18240 WP_003401010.1.18257 WP_003401010.1.18297 WP_003401010.1.18306 WP_003401010.1.18364 WP_003401010.1.18399 WP_003401010.1.18411 WP_003401010.1.18444 WP_003401010.1.18448 WP_003401010.1.18467 WP_003401010.1.18476 WP_003401010.1.18522 WP_003401010.1.18580 WP_003401010.1.18582 WP_003401010.1.18587 WP_003401010.1.186 WP_003401010.1.18601 WP_003401010.1.18639 WP_003401010.1.18646 WP_003401010.1.18647 WP_003401010.1.1868 WP_003401010.1.18694 WP_003401010.1.18710 WP_003401010.1.18751 WP_003401010.1.18781 WP_003401010.1.18793 WP_003401010.1.18804 WP_003401010.1.18816 WP_003401010.1.18823 WP_003401010.1.18827 WP_003401010.1.18838 WP_003401010.1.18849 WP_003401010.1.18856 WP_003401010.1.18945 WP_003401010.1.1898 WP_003401010.1.19005 WP_003401010.1.19056 WP_003401010.1.19063 WP_003401010.1.19066 WP_003401010.1.19071 WP_003401010.1.19085 WP_003401010.1.19094 WP_003401010.1.19144 WP_003401010.1.19159 WP_003401010.1.19193 WP_003401010.1.19231 WP_003401010.1.19243 WP_003401010.1.19264 WP_003401010.1.19295 WP_003401010.1.19307 WP_003401010.1.19326 WP_003401010.1.1933 WP_003401010.1.19364 WP_003401010.1.19382 WP_003401010.1.19400 WP_003401010.1.19426 WP_003401010.1.19429 WP_003401010.1.19464 WP_003401010.1.19480 WP_003401010.1.19512 WP_003401010.1.19553 WP_003401010.1.19562 WP_003401010.1.19564 WP_003401010.1.19568 WP_003401010.1.19572 WP_003401010.1.19595 WP_003401010.1.19596 WP_003401010.1.19600 WP_003401010.1.19630 WP_003401010.1.1967 WP_003401010.1.19694 WP_003401010.1.1970 WP_003401010.1.19707 WP_003401010.1.19742 WP_003401010.1.19785 WP_003401010.1.19820 WP_003401010.1.19868 WP_003401010.1.19874 WP_003401010.1.19890 WP_003401010.1.19900 WP_003401010.1.19922 WP_003401010.1.19936 WP_003401010.1.19946 WP_003401010.1.19949 WP_003401010.1.19960 WP_003401010.1.19964 WP_003401010.1.20007 WP_003401010.1.20016 WP_003401010.1.20028 WP_003401010.1.2003 WP_003401010.1.20037 WP_003401010.1.20039 WP_003401010.1.20082 WP_003401010.1.20085 WP_003401010.1.20097 WP_003401010.1.20116 WP_003401010.1.20130 WP_003401010.1.20140 WP_003401010.1.20141 WP_003401010.1.20142 WP_003401010.1.20158 WP_003401010.1.20239 WP_003401010.1.20243 WP_003401010.1.20259 WP_003401010.1.20262 WP_003401010.1.20268 WP_003401010.1.20272 WP_003401010.1.20273 WP_003401010.1.20280 WP_003401010.1.20294 WP_003401010.1.20300 WP_003401010.1.20309 WP_003401010.1.20322 WP_003401010.1.2037 WP_003401010.1.20372 WP_003401010.1.20381 WP_003401010.1.204 WP_003401010.1.20427 WP_003401010.1.20432 WP_003401010.1.20457 WP_003401010.1.20459 WP_003401010.1.20460 WP_003401010.1.20542 WP_003401010.1.20578 WP_003401010.1.20608 WP_003401010.1.20624 WP_003401010.1.20628 WP_003401010.1.2066 WP_003401010.1.20707 WP_003401010.1.20722 WP_003401010.1.20729 WP_003401010.1.20742 WP_003401010.1.20751 WP_003401010.1.20776 WP_003401010.1.20843 WP_003401010.1.20850 WP_003401010.1.2086 WP_003401010.1.20868 WP_003401010.1.20876 WP_003401010.1.20897 WP_003401010.1.20898 WP_003401010.1.2090 WP_003401010.1.20911 WP_003401010.1.20916 WP_003401010.1.20921 WP_003401010.1.20926 WP_003401010.1.20927 WP_003401010.1.20951 WP_003401010.1.20970 WP_003401010.1.2104 WP_003401010.1.21070 WP_003401010.1.21127 WP_003401010.1.21135 WP_003401010.1.21173 WP_003401010.1.21187 WP_003401010.1.212 WP_003401010.1.2120 WP_003401010.1.21218 WP_003401010.1.21219 WP_003401010.1.2123 WP_003401010.1.21231 WP_003401010.1.21234 WP_003401010.1.2126 WP_003401010.1.21292 WP_003401010.1.21307 WP_003401010.1.2131 WP_003401010.1.21311 WP_003401010.1.21321 WP_003401010.1.21365 WP_003401010.1.21392 WP_003401010.1.21397 WP_003401010.1.21403 WP_003401010.1.21415 WP_003401010.1.21418 WP_003401010.1.21430 WP_003401010.1.21434 WP_003401010.1.21444 WP_003401010.1.21468 WP_003401010.1.21498 WP_003401010.1.21509 WP_003401010.1.21513 WP_003401010.1.21560 WP_003401010.1.21565 WP_003401010.1.21586 WP_003401010.1.21591 WP_003401010.1.21594 WP_003401010.1.21602 WP_003401010.1.21615 WP_003401010.1.21638 WP_003401010.1.21639 WP_003401010.1.21655 WP_003401010.1.21658 WP_003401010.1.2168 WP_003401010.1.2174 WP_003401010.1.21741 WP_003401010.1.21777 WP_003401010.1.21786 WP_003401010.1.21795 WP_003401010.1.218 WP_003401010.1.21826 WP_003401010.1.21829 WP_003401010.1.21840 WP_003401010.1.21843 WP_003401010.1.21872 WP_003401010.1.21873 WP_003401010.1.2188 WP_003401010.1.21882 WP_003401010.1.21906 WP_003401010.1.21912 WP_003401010.1.2194 WP_003401010.1.21941 WP_003401010.1.21956 WP_003401010.1.21958 WP_003401010.1.21960 WP_003401010.1.21971 WP_003401010.1.21973 WP_003401010.1.21983 WP_003401010.1.22003 WP_003401010.1.22013 WP_003401010.1.22025 WP_003401010.1.22036 WP_003401010.1.22075 WP_003401010.1.22092 WP_003401010.1.2212 WP_003401010.1.22127 WP_003401010.1.22140 WP_003401010.1.22233 WP_003401010.1.22255 WP_003401010.1.22277 WP_003401010.1.22305 WP_003401010.1.22348 WP_003401010.1.22356 WP_003401010.1.22366 WP_003401010.1.2238 WP_003401010.1.22380 WP_003401010.1.22437 WP_003401010.1.22438 WP_003401010.1.22445 WP_003401010.1.22490 WP_003401010.1.22511 WP_003401010.1.22524 WP_003401010.1.2253 WP_003401010.1.22585 WP_003401010.1.22589 WP_003401010.1.22606 WP_003401010.1.22608 WP_003401010.1.22609 WP_003401010.1.22618 WP_003401010.1.2262 WP_003401010.1.22624 WP_003401010.1.22629 WP_003401010.1.22647 WP_003401010.1.22664 WP_003401010.1.22665 WP_003401010.1.22670 WP_003401010.1.22674 WP_003401010.1.22725 WP_003401010.1.22728 WP_003401010.1.22733 WP_003401010.1.22737 WP_003401010.1.2275 WP_003401010.1.22754 WP_003401010.1.22797 WP_003401010.1.22800 WP_003401010.1.22804 WP_003401010.1.22829 WP_003401010.1.22840 WP_003401010.1.22844 WP_003401010.1.22963 WP_003401010.1.22970 WP_003401010.1.22996 WP_003401010.1.22997 WP_003401010.1.22999 WP_003401010.1.23015 WP_003401010.1.23032 WP_003401010.1.231 WP_003401010.1.23101 WP_003401010.1.2312 WP_003401010.1.23153 WP_003401010.1.23171 WP_003401010.1.23199 WP_003401010.1.2320 WP_003401010.1.23204 WP_003401010.1.23216 WP_003401010.1.23229 WP_003401010.1.23233 WP_003401010.1.2326 WP_003401010.1.23261 WP_003401010.1.23272 WP_003401010.1.23289 WP_003401010.1.2329 WP_003401010.1.23308 WP_003401010.1.23316 WP_003401010.1.23321 WP_003401010.1.23325 WP_003401010.1.2339 WP_003401010.1.23406 WP_003401010.1.23438 WP_003401010.1.23445 WP_003401010.1.23447 WP_003401010.1.23452 WP_003401010.1.23461 WP_003401010.1.2349 WP_003401010.1.23496 WP_003401010.1.23506 WP_003401010.1.23530 WP_003401010.1.23539 WP_003401010.1.23546 WP_003401010.1.23551 WP_003401010.1.23573 WP_003401010.1.23583 WP_003401010.1.23588 WP_003401010.1.23628 WP_003401010.1.23677 WP_003401010.1.23683 WP_003401010.1.23692 WP_003401010.1.23694 WP_003401010.1.23699 WP_003401010.1.2371 WP_003401010.1.23803 WP_003401010.1.23807 WP_003401010.1.23825 WP_003401010.1.23832 WP_003401010.1.2384 WP_003401010.1.23843 WP_003401010.1.23863 WP_003401010.1.2387 WP_003401010.1.23894 WP_003401010.1.23993 WP_003401010.1.2400 WP_003401010.1.24007 WP_003401010.1.24008 WP_003401010.1.24046 WP_003401010.1.24057 WP_003401010.1.24113 WP_003401010.1.24119 WP_003401010.1.24128 WP_003401010.1.24140 WP_003401010.1.24176 WP_003401010.1.24190 WP_003401010.1.24202 WP_003401010.1.24244 WP_003401010.1.24261 WP_003401010.1.24284 WP_003401010.1.24294 WP_003401010.1.24357 WP_003401010.1.24396 WP_003401010.1.24414 WP_003401010.1.24423 WP_003401010.1.2443 WP_003401010.1.24446 WP_003401010.1.24461 WP_003401010.1.24500 WP_003401010.1.24507 WP_003401010.1.24509 WP_003401010.1.24529 WP_003401010.1.24553 WP_003401010.1.24599 WP_003401010.1.24629 WP_003401010.1.24638 WP_003401010.1.2466 WP_003401010.1.24767 WP_003401010.1.24824 WP_003401010.1.24831 WP_003401010.1.24840 WP_003401010.1.24848 WP_003401010.1.24857 WP_003401010.1.2487 WP_003401010.1.24893 WP_003401010.1.24907 WP_003401010.1.24933 WP_003401010.1.24956 WP_003401010.1.24958 WP_003401010.1.24985 WP_003401010.1.2499 WP_003401010.1.25004 WP_003401010.1.2505 WP_003401010.1.25051 WP_003401010.1.2507 WP_003401010.1.25103 WP_003401010.1.25129 WP_003401010.1.25171 WP_003401010.1.25184 WP_003401010.1.25247 WP_003401010.1.25252 WP_003401010.1.25278 WP_003401010.1.25283 WP_003401010.1.25309 WP_003401010.1.25313 WP_003401010.1.25338 WP_003401010.1.25342 WP_003401010.1.25343 WP_003401010.1.25367 WP_003401010.1.25393 WP_003401010.1.25406 WP_003401010.1.25435 WP_003401010.1.25437 WP_003401010.1.25445 WP_003401010.1.25455 WP_003401010.1.25473 WP_003401010.1.25504 WP_003401010.1.25513 WP_003401010.1.25542 WP_003401010.1.25579 WP_003401010.1.25594 WP_003401010.1.25606 WP_003401010.1.25645 WP_003401010.1.2566 WP_003401010.1.25673 WP_003401010.1.25674 WP_003401010.1.25693 WP_003401010.1.25699 WP_003401010.1.25727 WP_003401010.1.25736 WP_003401010.1.25738 WP_003401010.1.25756 WP_003401010.1.25759 WP_003401010.1.2580 WP_003401010.1.25813 WP_003401010.1.25853 WP_003401010.1.25854 WP_003401010.1.25874 WP_003401010.1.25885 WP_003401010.1.25892 WP_003401010.1.25906 WP_003401010.1.25914 WP_003401010.1.25916 WP_003401010.1.2594 WP_003401010.1.25954 WP_003401010.1.25972 WP_003401010.1.26017 WP_003401010.1.26032 WP_003401010.1.26038 WP_003401010.1.26072 WP_003401010.1.26089 WP_003401010.1.26097 WP_003401010.1.26098 WP_003401010.1.26108 WP_003401010.1.26109 WP_003401010.1.26118 WP_003401010.1.26126 WP_003401010.1.2614 WP_003401010.1.26168 WP_003401010.1.26182 WP_003401010.1.26190 WP_003401010.1.2620 WP_003401010.1.26234 WP_003401010.1.26243 WP_003401010.1.26267 WP_003401010.1.26292 WP_003401010.1.26310 WP_003401010.1.26328 WP_003401010.1.26349 WP_003401010.1.26366 WP_003401010.1.26374 WP_003401010.1.26407 WP_003401010.1.26454 WP_003401010.1.26464 WP_003401010.1.2653 WP_003401010.1.26560 WP_003401010.1.26571 WP_003401010.1.2659 WP_003401010.1.26597 WP_003401010.1.26603 WP_003401010.1.26629 WP_003401010.1.26651 WP_003401010.1.26702 WP_003401010.1.26707 WP_003401010.1.26710 WP_003401010.1.26719 WP_003401010.1.26737 WP_003401010.1.26738 WP_003401010.1.26745 WP_003401010.1.26756 WP_003401010.1.2676 WP_003401010.1.2677 WP_003401010.1.26779 WP_003401010.1.26780 WP_003401010.1.26798 WP_003401010.1.26854 WP_003401010.1.26868 WP_003401010.1.26876 WP_003401010.1.26888 WP_003401010.1.26914 WP_003401010.1.26945 WP_003401010.1.26959 WP_003401010.1.26969 WP_003401010.1.26984 WP_003401010.1.26992 WP_003401010.1.27004 WP_003401010.1.27017 WP_003401010.1.27045 WP_003401010.1.27074 WP_003401010.1.27075 WP_003401010.1.27128 WP_003401010.1.27130 WP_003401010.1.27139 WP_003401010.1.27152 WP_003401010.1.27162 WP_003401010.1.27164 WP_003401010.1.27193 WP_003401010.1.27235 WP_003401010.1.27278 WP_003401010.1.27343 WP_003401010.1.27352 WP_003401010.1.27369 WP_003401010.1.27391 WP_003401010.1.27398 WP_003401010.1.27402 WP_003401010.1.27410 WP_003401010.1.27411 WP_003401010.1.27449 WP_003401010.1.27460 WP_003401010.1.27463 WP_003401010.1.2749 WP_003401010.1.27492 WP_003401010.1.27528 WP_003401010.1.27541 WP_003401010.1.27576 WP_003401010.1.27582 WP_003401010.1.27596 WP_003401010.1.27607 WP_003401010.1.2766 WP_003401010.1.277 WP_003401010.1.27724 WP_003401010.1.27730 WP_003401010.1.27736 WP_003401010.1.27743 WP_003401010.1.27750 WP_003401010.1.27771 WP_003401010.1.27779 WP_003401010.1.27795 WP_003401010.1.27803 WP_003401010.1.27819 WP_003401010.1.27835 WP_003401010.1.27915 WP_003401010.1.27935 WP_003401010.1.27962 WP_003401010.1.28053 WP_003401010.1.28092 WP_003401010.1.28106 WP_003401010.1.28131 WP_003401010.1.28142 WP_003401010.1.28159 WP_003401010.1.2816 WP_003401010.1.28161 WP_003401010.1.28192 WP_003401010.1.28202 WP_003401010.1.28241 WP_003401010.1.28242 WP_003401010.1.28251 WP_003401010.1.28255 WP_003401010.1.28269 WP_003401010.1.28276 WP_003401010.1.28293 WP_003401010.1.28331 WP_003401010.1.28367 WP_003401010.1.28378 WP_003401010.1.28391 WP_003401010.1.2842 WP_003401010.1.28448 WP_003401010.1.2847 WP_003401010.1.28471 WP_003401010.1.28473 WP_003401010.1.28493 WP_003401010.1.28497 WP_003401010.1.28530 WP_003401010.1.28545 WP_003401010.1.28561 WP_003401010.1.28567 WP_003401010.1.28585 WP_003401010.1.286 WP_003401010.1.28610 WP_003401010.1.28617 WP_003401010.1.28634 WP_003401010.1.28642 WP_003401010.1.28671 WP_003401010.1.28682 WP_003401010.1.28698 WP_003401010.1.28703 WP_003401010.1.28739 WP_003401010.1.28758 WP_003401010.1.28781 WP_003401010.1.28787 WP_003401010.1.28827 WP_003401010.1.28839 WP_003401010.1.28847 WP_003401010.1.28850 WP_003401010.1.28851 WP_003401010.1.28865 WP_003401010.1.28897 WP_003401010.1.28914 WP_003401010.1.28935 WP_003401010.1.28936 WP_003401010.1.28939 WP_003401010.1.28943 WP_003401010.1.28952 WP_003401010.1.28975 WP_003401010.1.2899 WP_003401010.1.28993 WP_003401010.1.29000 WP_003401010.1.2901 WP_003401010.1.29028 WP_003401010.1.29033 WP_003401010.1.29058 WP_003401010.1.29078 WP_003401010.1.29102 WP_003401010.1.29115 WP_003401010.1.2916 WP_003401010.1.29217 WP_003401010.1.29223 WP_003401010.1.29234 WP_003401010.1.29264 WP_003401010.1.29275 WP_003401010.1.29306 WP_003401010.1.29339 WP_003401010.1.29348 WP_003401010.1.29364 WP_003401010.1.29367 WP_003401010.1.2938 WP_003401010.1.29399 WP_003401010.1.29426 WP_003401010.1.2944 WP_003401010.1.29449 WP_003401010.1.29450 WP_003401010.1.29452 WP_003401010.1.2949 WP_003401010.1.29510 WP_003401010.1.29515 WP_003401010.1.29525 WP_003401010.1.2953 WP_003401010.1.29587 WP_003401010.1.2959 WP_003401010.1.29592 WP_003401010.1.29599 WP_003401010.1.29611 WP_003401010.1.29632 WP_003401010.1.29649 WP_003401010.1.2965 WP_003401010.1.29659 WP_003401010.1.2969 WP_003401010.1.29696 WP_003401010.1.29698 WP_003401010.1.29718 WP_003401010.1.29742 WP_003401010.1.29745 WP_003401010.1.29747 WP_003401010.1.29769 WP_003401010.1.29825 WP_003401010.1.29830 WP_003401010.1.29847 WP_003401010.1.29861 WP_003401010.1.29869 WP_003401010.1.29883 WP_003401010.1.29890 WP_003401010.1.299 WP_003401010.1.29931 WP_003401010.1.29960 WP_003401010.1.30014 WP_003401010.1.3004 WP_003401010.1.30040 WP_003401010.1.30043 WP_003401010.1.30074 WP_003401010.1.30097 WP_003401010.1.30101 WP_003401010.1.30106 WP_003401010.1.30114 WP_003401010.1.30126 WP_003401010.1.30131 WP_003401010.1.30138 WP_003401010.1.30139 WP_003401010.1.30145 WP_003401010.1.30211 WP_003401010.1.30224 WP_003401010.1.30235 WP_003401010.1.30237 WP_003401010.1.3027 WP_003401010.1.30279 WP_003401010.1.30282 WP_003401010.1.30283 WP_003401010.1.30288 WP_003401010.1.30291 WP_003401010.1.30363 WP_003401010.1.30374 WP_003401010.1.30404 WP_003401010.1.30433 WP_003401010.1.30438 WP_003401010.1.30462 WP_003401010.1.30464 WP_003401010.1.30468 WP_003401010.1.30500 WP_003401010.1.3057 WP_003401010.1.30574 WP_003401010.1.30628 WP_003401010.1.30641 WP_003401010.1.30642 WP_003401010.1.30661 WP_003401010.1.30683 WP_003401010.1.30699 WP_003401010.1.30709 WP_003401010.1.30713 WP_003401010.1.30716 WP_003401010.1.30719 WP_003401010.1.30730 WP_003401010.1.30736 WP_003401010.1.30745 WP_003401010.1.30760 WP_003401010.1.30791 WP_003401010.1.308 WP_003401010.1.30807 WP_003401010.1.30818 WP_003401010.1.30824 WP_003401010.1.30848 WP_003401010.1.30877 WP_003401010.1.30888 WP_003401010.1.30901 WP_003401010.1.30903 WP_003401010.1.30912 WP_003401010.1.30913 WP_003401010.1.30914 WP_003401010.1.30919 WP_003401010.1.30977 WP_003401010.1.3100 WP_003401010.1.31002 WP_003401010.1.3101 WP_003401010.1.31034 WP_003401010.1.31047 WP_003401010.1.31070 WP_003401010.1.31074 WP_003401010.1.31102 WP_003401010.1.31127 WP_003401010.1.31184 WP_003401010.1.31199 WP_003401010.1.31226 WP_003401010.1.31230 WP_003401010.1.31233 WP_003401010.1.31263 WP_003401010.1.31264 WP_003401010.1.31270 WP_003401010.1.31287 WP_003401010.1.31290 WP_003401010.1.31304 WP_003401010.1.31346 WP_003401010.1.31348 WP_003401010.1.31354 WP_003401010.1.31390 WP_003401010.1.31414 WP_003401010.1.31417 WP_003401010.1.3143 WP_003401010.1.31458 WP_003401010.1.31483 WP_003401010.1.3149 WP_003401010.1.31498 WP_003401010.1.31507 WP_003401010.1.31537 WP_003401010.1.31548 WP_003401010.1.31569 WP_003401010.1.316 WP_003401010.1.31629 WP_003401010.1.31666 WP_003401010.1.31693 WP_003401010.1.31703 WP_003401010.1.31744 WP_003401010.1.31745 WP_003401010.1.31770 WP_003401010.1.31776 WP_003401010.1.31783 WP_003401010.1.318 WP_003401010.1.3184 WP_003401010.1.31840 WP_003401010.1.31880 WP_003401010.1.31911 WP_003401010.1.31930 WP_003401010.1.31932 WP_003401010.1.31955 WP_003401010.1.31985 WP_003401010.1.31991 WP_003401010.1.31995 WP_003401010.1.32004 WP_003401010.1.32039 WP_003401010.1.3204 WP_003401010.1.32045 WP_003401010.1.32071 WP_003401010.1.32098 WP_003401010.1.32132 WP_003401010.1.32157 WP_003401010.1.32164 WP_003401010.1.32179 WP_003401010.1.32198 WP_003401010.1.32297 WP_003401010.1.32317 WP_003401010.1.32383 WP_003401010.1.32400 WP_003401010.1.32403 WP_003401010.1.32416 WP_003401010.1.32421 WP_003401010.1.32433 WP_003401010.1.32461 WP_003401010.1.32482 WP_003401010.1.32503 WP_003401010.1.32556 WP_003401010.1.32562 WP_003401010.1.32569 WP_003401010.1.32592 WP_003401010.1.32620 WP_003401010.1.32647 WP_003401010.1.32653 WP_003401010.1.32654 WP_003401010.1.3268 WP_003401010.1.32695 WP_003401010.1.32706 WP_003401010.1.32716 WP_003401010.1.32738 WP_003401010.1.32752 WP_003401010.1.32780 WP_003401010.1.32781 WP_003401010.1.32793 WP_003401010.1.32799 WP_003401010.1.32833 WP_003401010.1.32862 WP_003401010.1.32880 WP_003401010.1.32897 WP_003401010.1.32909 WP_003401010.1.32935 WP_003401010.1.32974 WP_003401010.1.33007 WP_003401010.1.3302 WP_003401010.1.33028 WP_003401010.1.33035 WP_003401010.1.33044 WP_003401010.1.33054 WP_003401010.1.33082 WP_003401010.1.33141 WP_003401010.1.33148 WP_003401010.1.33155 WP_003401010.1.33168 WP_003401010.1.3321 WP_003401010.1.33215 WP_003401010.1.3325 WP_003401010.1.3327 WP_003401010.1.33278 WP_003401010.1.33288 WP_003401010.1.33305 WP_003401010.1.3331 WP_003401010.1.33319 WP_003401010.1.3333 WP_003401010.1.33393 WP_003401010.1.33403 WP_003401010.1.33452 WP_003401010.1.33467 WP_003401010.1.33477 WP_003401010.1.3349 WP_003401010.1.33519 WP_003401010.1.33542 WP_003401010.1.33601 WP_003401010.1.33602 WP_003401010.1.33633 WP_003401010.1.33646 WP_003401010.1.33673 WP_003401010.1.3369 WP_003401010.1.33705 WP_003401010.1.33762 WP_003401010.1.33783 WP_003401010.1.33789 WP_003401010.1.3383 WP_003401010.1.33832 WP_003401010.1.33839 WP_003401010.1.33848 WP_003401010.1.3387 WP_003401010.1.33886 WP_003401010.1.33895 WP_003401010.1.33906 WP_003401010.1.33912 WP_003401010.1.33954 WP_003401010.1.3399 WP_003401010.1.34042 WP_003401010.1.3405 WP_003401010.1.34055 WP_003401010.1.34056 WP_003401010.1.34065 WP_003401010.1.3408 WP_003401010.1.34090 WP_003401010.1.34109 WP_003401010.1.34131 WP_003401010.1.34152 WP_003401010.1.34153 WP_003401010.1.34163 WP_003401010.1.34181 WP_003401010.1.34197 WP_003401010.1.34198 WP_003401010.1.34215 WP_003401010.1.34219 WP_003401010.1.34255 WP_003401010.1.34260 WP_003401010.1.34275 WP_003401010.1.343 WP_003401010.1.34347 WP_003401010.1.34392 WP_003401010.1.344 WP_003401010.1.34428 WP_003401010.1.3443 WP_003401010.1.34435 WP_003401010.1.34446 WP_003401010.1.34499 WP_003401010.1.34505 WP_003401010.1.34516 WP_003401010.1.34529 WP_003401010.1.34551 WP_003401010.1.34563 WP_003401010.1.34576 WP_003401010.1.34581 WP_003401010.1.34588 WP_003401010.1.34596 WP_003401010.1.34599 WP_003401010.1.34639 WP_003401010.1.34673 WP_003401010.1.34724 WP_003401010.1.34740 WP_003401010.1.34755 WP_003401010.1.34777 WP_003401010.1.34783 WP_003401010.1.34841 WP_003401010.1.34908 WP_003401010.1.34919 WP_003401010.1.3492 WP_003401010.1.34933 WP_003401010.1.34945 WP_003401010.1.34946 WP_003401010.1.34954 WP_003401010.1.34960 WP_003401010.1.34961 WP_003401010.1.34963 WP_003401010.1.34965 WP_003401010.1.34968 WP_003401010.1.35023 WP_003401010.1.35069 WP_003401010.1.35072 WP_003401010.1.35078 WP_003401010.1.35100 WP_003401010.1.35146 WP_003401010.1.35156 WP_003401010.1.35160 WP_003401010.1.35162 WP_003401010.1.35176 WP_003401010.1.3520 WP_003401010.1.35213 WP_003401010.1.35221 WP_003401010.1.35246 WP_003401010.1.35278 WP_003401010.1.35301 WP_003401010.1.35311 WP_003401010.1.35317 WP_003401010.1.35319 WP_003401010.1.35347 WP_003401010.1.35363 WP_003401010.1.35382 WP_003401010.1.35385 WP_003401010.1.35396 WP_003401010.1.35397 WP_003401010.1.35426 WP_003401010.1.35439 WP_003401010.1.35455 WP_003401010.1.3548 WP_003401010.1.35484 WP_003401010.1.35492 WP_003401010.1.3553 WP_003401010.1.35553 WP_003401010.1.35555 WP_003401010.1.35561 WP_003401010.1.35602 WP_003401010.1.35610 WP_003401010.1.35635 WP_003401010.1.35657 WP_003401010.1.35687 WP_003401010.1.35689 WP_003401010.1.35707 WP_003401010.1.35732 WP_003401010.1.35754 WP_003401010.1.35767 WP_003401010.1.35770 WP_003401010.1.35771 WP_003401010.1.35780 WP_003401010.1.35805 WP_003401010.1.35811 WP_003401010.1.35821 WP_003401010.1.3584 WP_003401010.1.35848 WP_003401010.1.35864 WP_003401010.1.35874 WP_003401010.1.35876 WP_003401010.1.35897 WP_003401010.1.35899 WP_003401010.1.35923 WP_003401010.1.3593 WP_003401010.1.35954 WP_003401010.1.36005 WP_003401010.1.36014 WP_003401010.1.36023 WP_003401010.1.36051 WP_003401010.1.36053 WP_003401010.1.36075 WP_003401010.1.36089 WP_003401010.1.36097 WP_003401010.1.36098 WP_003401010.1.36116 WP_003401010.1.36145 WP_003401010.1.36156 WP_003401010.1.36205 WP_003401010.1.36228 WP_003401010.1.36252 WP_003401010.1.36260 WP_003401010.1.36270 WP_003401010.1.36271 WP_003401010.1.36303 WP_003401010.1.36309 WP_003401010.1.36315 WP_003401010.1.36319 WP_003401010.1.36321 WP_003401010.1.36326 WP_003401010.1.3634 WP_003401010.1.36356 WP_003401010.1.36357 WP_003401010.1.3636 WP_003401010.1.36385 WP_003401010.1.36399 WP_003401010.1.36436 WP_003401010.1.36465 WP_003401010.1.36469 WP_003401010.1.36473 WP_003401010.1.36485 WP_003401010.1.36508 WP_003401010.1.36540 WP_003401010.1.36561 WP_003401010.1.36571 WP_003401010.1.36573 WP_003401010.1.36578 WP_003401010.1.36585 WP_003401010.1.36597 WP_003401010.1.36614 WP_003401010.1.36674 WP_003401010.1.36720 WP_003401010.1.36727 WP_003401010.1.36733 WP_003401010.1.36785 WP_003401010.1.36810 WP_003401010.1.36844 WP_003401010.1.36851 WP_003401010.1.36862 WP_003401010.1.36893 WP_003401010.1.36901 WP_003401010.1.36921 WP_003401010.1.36935 WP_003401010.1.36941 WP_003401010.1.3695 WP_003401010.1.36951 WP_003401010.1.36968 WP_003401010.1.3700 WP_003401010.1.37004 WP_003401010.1.37012 WP_003401010.1.37071 WP_003401010.1.37088 WP_003401010.1.37131 WP_003401010.1.37157 WP_003401010.1.37175 WP_003401010.1.37188 WP_003401010.1.37213 WP_003401010.1.37229 WP_003401010.1.3724 WP_003401010.1.37277 WP_003401010.1.37305 WP_003401010.1.37330 WP_003401010.1.37389 WP_003401010.1.37400 WP_003401010.1.37440 WP_003401010.1.37459 WP_003401010.1.37468 WP_003401010.1.37475 WP_003401010.1.37484 WP_003401010.1.37601 WP_003401010.1.37612 WP_003401010.1.37632 WP_003401010.1.37643 WP_003401010.1.37655 WP_003401010.1.37660 WP_003401010.1.37674 WP_003401010.1.37700 WP_003401010.1.37701 WP_003401010.1.37709 WP_003401010.1.37711 WP_003401010.1.37721 WP_003401010.1.37722 WP_003401010.1.37747 WP_003401010.1.37765 WP_003401010.1.37772 WP_003401010.1.37804 WP_003401010.1.37809 WP_003401010.1.37859 WP_003401010.1.37877 WP_003401010.1.37912 WP_003401010.1.37913 WP_003401010.1.37950 WP_003401010.1.37973 WP_003401010.1.37975 WP_003401010.1.37983 WP_003401010.1.38 WP_003401010.1.38002 WP_003401010.1.3802 WP_003401010.1.38039 WP_003401010.1.38040 WP_003401010.1.38067 WP_003401010.1.38068 WP_003401010.1.38138 WP_003401010.1.38144 WP_003401010.1.38158 WP_003401010.1.38159 WP_003401010.1.38210 WP_003401010.1.38233 WP_003401010.1.38240 WP_003401010.1.38299 WP_003401010.1.38332 WP_003401010.1.38347 WP_003401010.1.38354 WP_003401010.1.38380 WP_003401010.1.38384 WP_003401010.1.38389 WP_003401010.1.38398 WP_003401010.1.38402 WP_003401010.1.38418 WP_003401010.1.38421 WP_003401010.1.38466 WP_003401010.1.38477 WP_003401010.1.38483 WP_003401010.1.3849 WP_003401010.1.385 WP_003401010.1.38530 WP_003401010.1.38535 WP_003401010.1.38539 WP_003401010.1.38594 WP_003401010.1.38611 WP_003401010.1.38638 WP_003401010.1.38639 WP_003401010.1.38646 WP_003401010.1.38648 WP_003401010.1.38654 WP_003401010.1.38659 WP_003401010.1.38660 WP_003401010.1.38666 WP_003401010.1.38671 WP_003401010.1.38672 WP_003401010.1.38677 WP_003401010.1.38750 WP_003401010.1.38772 WP_003401010.1.38812 WP_003401010.1.38821 WP_003401010.1.38844 WP_003401010.1.38863 WP_003401010.1.38865 WP_003401010.1.38873 WP_003401010.1.3889 WP_003401010.1.38894 WP_003401010.1.38909 WP_003401010.1.38939 WP_003401010.1.38974 WP_003401010.1.38975 WP_003401010.1.38991 WP_003401010.1.39025 WP_003401010.1.39070 WP_003401010.1.39072 WP_003401010.1.39095 WP_003401010.1.39106 WP_003401010.1.39165 WP_003401010.1.39174 WP_003401010.1.39176 WP_003401010.1.39178 WP_003401010.1.39190 WP_003401010.1.39201 WP_003401010.1.39207 WP_003401010.1.39211 WP_003401010.1.39236 WP_003401010.1.39239 WP_003401010.1.39252 WP_003401010.1.39288 WP_003401010.1.39295 WP_003401010.1.39306 WP_003401010.1.39359 WP_003401010.1.39364 WP_003401010.1.39400 WP_003401010.1.39447 WP_003401010.1.3945 WP_003401010.1.39450 WP_003401010.1.39455 WP_003401010.1.3949 WP_003401010.1.39521 WP_003401010.1.39560 WP_003401010.1.39592 WP_003401010.1.39593 WP_003401010.1.396 WP_003401010.1.3960 WP_003401010.1.39616 WP_003401010.1.39654 WP_003401010.1.39657 WP_003401010.1.39661 WP_003401010.1.39674 WP_003401010.1.39678 WP_003401010.1.3968 WP_003401010.1.39694 WP_003401010.1.3971 WP_003401010.1.39718 WP_003401010.1.39728 WP_003401010.1.39739 WP_003401010.1.39748 WP_003401010.1.39751 WP_003401010.1.39759 WP_003401010.1.39801 WP_003401010.1.39804 WP_003401010.1.39848 WP_003401010.1.39877 WP_003401010.1.39925 WP_003401010.1.3994 WP_003401010.1.39959 WP_003401010.1.3996 WP_003401010.1.39960 WP_003401010.1.3997 WP_003401010.1.39980 WP_003401010.1.40000 WP_003401010.1.40028 WP_003401010.1.40029 WP_003401010.1.4003 WP_003401010.1.40094 WP_003401010.1.40096 WP_003401010.1.40150 WP_003401010.1.40156 WP_003401010.1.40174 WP_003401010.1.40186 WP_003401010.1.40276 WP_003401010.1.40277 WP_003401010.1.40323 WP_003401010.1.40336 WP_003401010.1.40353 WP_003401010.1.4036 WP_003401010.1.40372 WP_003401010.1.40402 WP_003401010.1.40413 WP_003401010.1.40440 WP_003401010.1.40446 WP_003401010.1.40451 WP_003401010.1.40455 WP_003401010.1.40523 WP_003401010.1.40543 WP_003401010.1.40641 WP_003401010.1.40646 WP_003401010.1.40651 WP_003401010.1.40653 WP_003401010.1.40705 WP_003401010.1.40723 WP_003401010.1.40731 WP_003401010.1.40735 WP_003401010.1.40795 WP_003401010.1.40799 WP_003401010.1.40852 WP_003401010.1.40876 WP_003401010.1.40881 WP_003401010.1.40922 WP_003401010.1.40948 WP_003401010.1.4095 WP_003401010.1.40956 WP_003401010.1.40957 WP_003401010.1.40964 WP_003401010.1.4097 WP_003401010.1.410 WP_003401010.1.41000 WP_003401010.1.41055 WP_003401010.1.41108 WP_003401010.1.41123 WP_003401010.1.41177 WP_003401010.1.41202 WP_003401010.1.41219 WP_003401010.1.41231 WP_003401010.1.41249 WP_003401010.1.4127 WP_003401010.1.41296 WP_003401010.1.41355 WP_003401010.1.41376 WP_003401010.1.41430 WP_003401010.1.41447 WP_003401010.1.41469 WP_003401010.1.41504 WP_003401010.1.41564 WP_003401010.1.41616 WP_003401010.1.41632 WP_003401010.1.41635 WP_003401010.1.41636 WP_003401010.1.41648 WP_003401010.1.41660 WP_003401010.1.41685 WP_003401010.1.41695 WP_003401010.1.41704 WP_003401010.1.4171 WP_003401010.1.41719 WP_003401010.1.41733 WP_003401010.1.41744 WP_003401010.1.41774 WP_003401010.1.41791 WP_003401010.1.41803 WP_003401010.1.41820 WP_003401010.1.41828 WP_003401010.1.41829 WP_003401010.1.41860 WP_003401010.1.41912 WP_003401010.1.41921 WP_003401010.1.41933 WP_003401010.1.41944 WP_003401010.1.42043 WP_003401010.1.42075 WP_003401010.1.42078 WP_003401010.1.42094 WP_003401010.1.42112 WP_003401010.1.4212 WP_003401010.1.42122 WP_003401010.1.42134 WP_003401010.1.42183 WP_003401010.1.42188 WP_003401010.1.42202 WP_003401010.1.42208 WP_003401010.1.42247 WP_003401010.1.42255 WP_003401010.1.42273 WP_003401010.1.42278 WP_003401010.1.42304 WP_003401010.1.42309 WP_003401010.1.42370 WP_003401010.1.42385 WP_003401010.1.42400 WP_003401010.1.42409 WP_003401010.1.42414 WP_003401010.1.42430 WP_003401010.1.42465 WP_003401010.1.42467 WP_003401010.1.42473 WP_003401010.1.42474 WP_003401010.1.4248 WP_003401010.1.42494 WP_003401010.1.42519 WP_003401010.1.42524 WP_003401010.1.42534 WP_003401010.1.4255 WP_003401010.1.42562 WP_003401010.1.42568 WP_003401010.1.42570 WP_003401010.1.42618 WP_003401010.1.42660 WP_003401010.1.42695 WP_003401010.1.42704 WP_003401010.1.42705 WP_003401010.1.42722 WP_003401010.1.42777 WP_003401010.1.42782 WP_003401010.1.42835 WP_003401010.1.42839 WP_003401010.1.42842 WP_003401010.1.42905 WP_003401010.1.42916 WP_003401010.1.42930 WP_003401010.1.42971 WP_003401010.1.43005 WP_003401010.1.43009 WP_003401010.1.43053 WP_003401010.1.43082 WP_003401010.1.43087 WP_003401010.1.43098 WP_003401010.1.43208 WP_003401010.1.43236 WP_003401010.1.43246 WP_003401010.1.43255 WP_003401010.1.43266 WP_003401010.1.43269 WP_003401010.1.43273 WP_003401010.1.43296 WP_003401010.1.43306 WP_003401010.1.4335 WP_003401010.1.43368 WP_003401010.1.43395 WP_003401010.1.43462 WP_003401010.1.43475 WP_003401010.1.43478 WP_003401010.1.43484 WP_003401010.1.43557 WP_003401010.1.43578 WP_003401010.1.43588 WP_003401010.1.43643 WP_003401010.1.43664 WP_003401010.1.43684 WP_003401010.1.43686 WP_003401010.1.43706 WP_003401010.1.43716 WP_003401010.1.4377 WP_003401010.1.43781 WP_003401010.1.43794 WP_003401010.1.43815 WP_003401010.1.43846 WP_003401010.1.43861 WP_003401010.1.43863 WP_003401010.1.43866 WP_003401010.1.43872 WP_003401010.1.43885 WP_003401010.1.43897 WP_003401010.1.4390 WP_003401010.1.43902 WP_003401010.1.43921 WP_003401010.1.43936 WP_003401010.1.43937 WP_003401010.1.43960 WP_003401010.1.43965 WP_003401010.1.4399 WP_003401010.1.43993 WP_003401010.1.43996 WP_003401010.1.44 WP_003401010.1.44001 WP_003401010.1.44008 WP_003401010.1.44033 WP_003401010.1.44037 WP_003401010.1.44041 WP_003401010.1.44070 WP_003401010.1.44071 WP_003401010.1.44076 WP_003401010.1.44104 WP_003401010.1.44111 WP_003401010.1.44124 WP_003401010.1.44169 WP_003401010.1.44219 WP_003401010.1.44237 WP_003401010.1.44277 WP_003401010.1.44279 WP_003401010.1.44336 WP_003401010.1.44355 WP_003401010.1.44358 WP_003401010.1.4438 WP_003401010.1.44390 WP_003401010.1.44392 WP_003401010.1.4441 WP_003401010.1.44415 WP_003401010.1.44464 WP_003401010.1.44466 WP_003401010.1.44489 WP_003401010.1.44492 WP_003401010.1.44494 WP_003401010.1.44500 WP_003401010.1.44519 WP_003401010.1.44526 WP_003401010.1.44532 WP_003401010.1.44534 WP_003401010.1.44562 WP_003401010.1.44589 WP_003401010.1.44597 WP_003401010.1.44600 WP_003401010.1.44602 WP_003401010.1.44615 WP_003401010.1.4464 WP_003401010.1.44651 WP_003401010.1.44659 WP_003401010.1.44665 WP_003401010.1.44694 WP_003401010.1.44700 WP_003401010.1.44713 WP_003401010.1.44735 WP_003401010.1.44740 WP_003401010.1.44757 WP_003401010.1.4476 WP_003401010.1.44761 WP_003401010.1.44767 WP_003401010.1.44776 WP_003401010.1.44779 WP_003401010.1.44786 WP_003401010.1.44808 WP_003401010.1.44864 WP_003401010.1.44901 WP_003401010.1.44908 WP_003401010.1.44913 WP_003401010.1.4492 WP_003401010.1.44939 WP_003401010.1.44979 WP_003401010.1.44981 WP_003401010.1.45002 WP_003401010.1.45011 WP_003401010.1.4504 WP_003401010.1.45066 WP_003401010.1.45081 WP_003401010.1.45113 WP_003401010.1.45129 WP_003401010.1.45135 WP_003401010.1.45147 WP_003401010.1.45168 WP_003401010.1.4517 WP_003401010.1.45181 WP_003401010.1.45185 WP_003401010.1.45192 WP_003401010.1.45200 WP_003401010.1.45205 WP_003401010.1.45211 WP_003401010.1.45249 WP_003401010.1.4526 WP_003401010.1.45286 WP_003401010.1.45326 WP_003401010.1.45347 WP_003401010.1.45374 WP_003401010.1.45390 WP_003401010.1.454 WP_003401010.1.45407 WP_003401010.1.45451 WP_003401010.1.45453 WP_003401010.1.45460 WP_003401010.1.45463 WP_003401010.1.45470 WP_003401010.1.45474 WP_003401010.1.45491 WP_003401010.1.45510 WP_003401010.1.45563 WP_003401010.1.45584 WP_003401010.1.45590 WP_003401010.1.45619 WP_003401010.1.45626 WP_003401010.1.45631 WP_003401010.1.45666 WP_003401010.1.45697 WP_003401010.1.4571 WP_003401010.1.45731 WP_003401010.1.45743 WP_003401010.1.45765 WP_003401010.1.45776 WP_003401010.1.45783 WP_003401010.1.45805 WP_003401010.1.45815 WP_003401010.1.45849 WP_003401010.1.45867 WP_003401010.1.45884 WP_003401010.1.4590 WP_003401010.1.45923 WP_003401010.1.45926 WP_003401010.1.45963 WP_003401010.1.45989 WP_003401010.1.45992 WP_003401010.1.46025 WP_003401010.1.46083 WP_003401010.1.46090 WP_003401010.1.46092 WP_003401010.1.46100 WP_003401010.1.46101 WP_003401010.1.46103 WP_003401010.1.46107 WP_003401010.1.46127 WP_003401010.1.46128 WP_003401010.1.46129 WP_003401010.1.46141 WP_003401010.1.46150 WP_003401010.1.46201 WP_003401010.1.46226 WP_003401010.1.4624 WP_003401010.1.46253 WP_003401010.1.46268 WP_003401010.1.46285 WP_003401010.1.46300 WP_003401010.1.46313 WP_003401010.1.46336 WP_003401010.1.46365 WP_003401010.1.46370 WP_003401010.1.46381 WP_003401010.1.46402 WP_003401010.1.46411 WP_003401010.1.4644 WP_003401010.1.46442 WP_003401010.1.46453 WP_003401010.1.46463 WP_003401010.1.46478 WP_003401010.1.46492 WP_003401010.1.46521 WP_003401010.1.4653 WP_003401010.1.46532 WP_003401010.1.46539 WP_003401010.1.46568 WP_003401010.1.46585 WP_003401010.1.46609 WP_003401010.1.46613 WP_003401010.1.46625 WP_003401010.1.46642 WP_003401010.1.46647 WP_003401010.1.46674 WP_003401010.1.46724 WP_003401010.1.46758 WP_003401010.1.46773 WP_003401010.1.46777 WP_003401010.1.46786 WP_003401010.1.46792 WP_003401010.1.46847 WP_003401010.1.46851 WP_003401010.1.4687 WP_003401010.1.46897 WP_003401010.1.46936 WP_003401010.1.46980 WP_003401010.1.47011 WP_003401010.1.47012 WP_003401010.1.47066 WP_003401010.1.47077 WP_003401010.1.47083 WP_003401010.1.47106 WP_003401010.1.47142 WP_003401010.1.47147 WP_003401010.1.47166 WP_003401010.1.47178 WP_003401010.1.47179 WP_003401010.1.47194 WP_003401010.1.47207 WP_003401010.1.47210 WP_003401010.1.47261 WP_003401010.1.47262 WP_003401010.1.47402 WP_003401010.1.47423 WP_003401010.1.47467 WP_003401010.1.47502 WP_003401010.1.4751 WP_003401010.1.47511 WP_003401010.1.47537 WP_003401010.1.47540 WP_003401010.1.47568 WP_003401010.1.47572 WP_003401010.1.47588 WP_003401010.1.47636 WP_003401010.1.4764 WP_003401010.1.47653 WP_003401010.1.47679 WP_003401010.1.47681 WP_003401010.1.47690 WP_003401010.1.4771 WP_003401010.1.47717 WP_003401010.1.47743 WP_003401010.1.47754 WP_003401010.1.47773 WP_003401010.1.47776 WP_003401010.1.47780 WP_003401010.1.47805 WP_003401010.1.47832 WP_003401010.1.47847 WP_003401010.1.47858 WP_003401010.1.47861 WP_003401010.1.47868 WP_003401010.1.47893 WP_003401010.1.47899 WP_003401010.1.479 WP_003401010.1.47912 WP_003401010.1.47913 WP_003401010.1.47926 WP_003401010.1.4794 WP_003401010.1.47943 WP_003401010.1.47944 WP_003401010.1.47959 WP_003401010.1.47974 WP_003401010.1.47993 WP_003401010.1.48004 WP_003401010.1.48039 WP_003401010.1.48050 WP_003401010.1.48084 WP_003401010.1.48097 WP_003401010.1.48101 WP_003401010.1.4813 WP_003401010.1.48130 WP_003401010.1.48135 WP_003401010.1.48143 WP_003401010.1.48152 WP_003401010.1.48155 WP_003401010.1.48170 WP_003401010.1.48173 WP_003401010.1.48177 WP_003401010.1.48185 WP_003401010.1.48204 WP_003401010.1.48219 WP_003401010.1.4823 WP_003401010.1.48240 WP_003401010.1.48256 WP_003401010.1.48264 WP_003401010.1.48287 WP_003401010.1.48330 WP_003401010.1.48333 WP_003401010.1.48348 WP_003401010.1.48354 WP_003401010.1.48372 WP_003401010.1.48383 WP_003401010.1.48388 WP_003401010.1.48419 WP_003401010.1.48423 WP_003401010.1.48443 WP_003401010.1.48450 WP_003401010.1.48462 WP_003401010.1.48543 WP_003401010.1.48550 WP_003401010.1.48605 WP_003401010.1.48618 WP_003401010.1.4863 WP_003401010.1.48648 WP_003401010.1.48658 WP_003401010.1.48666 WP_003401010.1.48687 WP_003401010.1.48779 WP_003401010.1.4878 WP_003401010.1.48798 WP_003401010.1.48802 WP_003401010.1.48826 WP_003401010.1.48831 WP_003401010.1.48843 WP_003401010.1.48857 WP_003401010.1.4890 WP_003401010.1.48946 WP_003401010.1.48979 WP_003401010.1.49017 WP_003401010.1.49048 WP_003401010.1.49059 WP_003401010.1.4906 WP_003401010.1.4907 WP_003401010.1.49103 WP_003401010.1.49110 WP_003401010.1.49111 WP_003401010.1.49112 WP_003401010.1.4919 WP_003401010.1.49251 WP_003401010.1.49254 WP_003401010.1.49263 WP_003401010.1.49291 WP_003401010.1.49296 WP_003401010.1.49335 WP_003401010.1.49337 WP_003401010.1.49419 WP_003401010.1.49426 WP_003401010.1.49437 WP_003401010.1.49439 WP_003401010.1.49474 WP_003401010.1.49506 WP_003401010.1.49516 WP_003401010.1.49523 WP_003401010.1.49526 WP_003401010.1.49532 WP_003401010.1.49588 WP_003401010.1.4959 WP_003401010.1.49678 WP_003401010.1.49687 WP_003401010.1.49699 WP_003401010.1.49709 WP_003401010.1.4971 WP_003401010.1.4972 WP_003401010.1.49736 WP_003401010.1.49746 WP_003401010.1.49764 WP_003401010.1.49773 WP_003401010.1.49796 WP_003401010.1.49814 WP_003401010.1.49815 WP_003401010.1.49816 WP_003401010.1.49839 WP_003401010.1.49857 WP_003401010.1.49878 WP_003401010.1.49880 WP_003401010.1.49944 WP_003401010.1.4999 WP_003401010.1.49990 WP_003401010.1.50068 WP_003401010.1.50077 WP_003401010.1.5008 WP_003401010.1.50081 WP_003401010.1.50122 WP_003401010.1.50126 WP_003401010.1.50149 WP_003401010.1.50162 WP_003401010.1.5018 WP_003401010.1.50194 WP_003401010.1.50235 WP_003401010.1.50249 WP_003401010.1.50265 WP_003401010.1.50271 WP_003401010.1.50324 WP_003401010.1.50347 WP_003401010.1.50372 WP_003401010.1.50398 WP_003401010.1.50407 WP_003401010.1.50444 WP_003401010.1.50466 WP_003401010.1.50472 WP_003401010.1.5048 WP_003401010.1.50498 WP_003401010.1.5050 WP_003401010.1.50540 WP_003401010.1.50554 WP_003401010.1.50557 WP_003401010.1.50601 WP_003401010.1.50610 WP_003401010.1.50632 WP_003401010.1.50633 WP_003401010.1.50642 WP_003401010.1.50655 WP_003401010.1.50659 WP_003401010.1.50683 WP_003401010.1.50689 WP_003401010.1.50692 WP_003401010.1.50714 WP_003401010.1.50729 WP_003401010.1.50756 WP_003401010.1.50784 WP_003401010.1.50794 WP_003401010.1.50841 WP_003401010.1.50877 WP_003401010.1.5096 WP_003401010.1.50981 WP_003401010.1.50987 WP_003401010.1.51003 WP_003401010.1.51009 WP_003401010.1.51037 WP_003401010.1.51074 WP_003401010.1.51082 WP_003401010.1.51101 WP_003401010.1.51116 WP_003401010.1.51149 WP_003401010.1.51156 WP_003401010.1.51157 WP_003401010.1.51213 WP_003401010.1.51232 WP_003401010.1.51239 WP_003401010.1.51247 WP_003401010.1.51266 WP_003401010.1.51279 WP_003401010.1.51291 WP_003401010.1.51294 WP_003401010.1.51301 WP_003401010.1.51329 WP_003401010.1.51391 WP_003401010.1.51422 WP_003401010.1.51445 WP_003401010.1.51455 WP_003401010.1.51466 WP_003401010.1.51468 WP_003401010.1.51478 WP_003401010.1.51497 WP_003401010.1.51520 WP_003401010.1.51593 WP_003401010.1.51628 WP_003401010.1.5164 WP_003401010.1.51647 WP_003401010.1.51660 WP_003401010.1.51696 WP_003401010.1.51721 WP_003401010.1.51788 WP_003401010.1.51795 WP_003401010.1.51801 WP_003401010.1.51817 WP_003401010.1.51819 WP_003401010.1.51854 WP_003401010.1.51923 WP_003401010.1.51942 WP_003401010.1.51948 WP_003401010.1.51963 WP_003401010.1.51969 WP_003401010.1.52000 WP_003401010.1.52001 WP_003401010.1.52003 WP_003401010.1.52006 WP_003401010.1.52036 WP_003401010.1.52038 WP_003401010.1.52046 WP_003401010.1.52059 WP_003401010.1.52069 WP_003401010.1.52082 WP_003401010.1.52102 WP_003401010.1.52106 WP_003401010.1.52166 WP_003401010.1.52168 WP_003401010.1.52173 WP_003401010.1.52178 WP_003401010.1.52206 WP_003401010.1.52216 WP_003401010.1.52238 WP_003401010.1.52241 WP_003401010.1.52280 WP_003401010.1.52314 WP_003401010.1.52385 WP_003401010.1.52390 WP_003401010.1.524 WP_003401010.1.52460 WP_003401010.1.52485 WP_003401010.1.52486 WP_003401010.1.52495 WP_003401010.1.52504 WP_003401010.1.52522 WP_003401010.1.52531 WP_003401010.1.52533 WP_003401010.1.52545 WP_003401010.1.52553 WP_003401010.1.52563 WP_003401010.1.52564 WP_003401010.1.52574 WP_003401010.1.52641 WP_003401010.1.52673 WP_003401010.1.52674 WP_003401010.1.52708 WP_003401010.1.52713 WP_003401010.1.52761 WP_003401010.1.52778 WP_003401010.1.52791 WP_003401010.1.52797 WP_003401010.1.52818 WP_003401010.1.52872 WP_003401010.1.52873 WP_003401010.1.52891 WP_003401010.1.52892 WP_003401010.1.52909 WP_003401010.1.52970 WP_003401010.1.52998 WP_003401010.1.53053 WP_003401010.1.53056 WP_003401010.1.5306 WP_003401010.1.53088 WP_003401010.1.5309 WP_003401010.1.531 WP_003401010.1.53117 WP_003401010.1.53118 WP_003401010.1.53142 WP_003401010.1.53143 WP_003401010.1.53157 WP_003401010.1.53167 WP_003401010.1.53200 WP_003401010.1.53204 WP_003401010.1.53213 WP_003401010.1.53217 WP_003401010.1.53226 WP_003401010.1.53229 WP_003401010.1.53230 WP_003401010.1.53237 WP_003401010.1.53254 WP_003401010.1.53257 WP_003401010.1.5327 WP_003401010.1.53276 WP_003401010.1.53278 WP_003401010.1.533 WP_003401010.1.53302 WP_003401010.1.53306 WP_003401010.1.5334 WP_003401010.1.5335 WP_003401010.1.53353 WP_003401010.1.53381 WP_003401010.1.53413 WP_003401010.1.53458 WP_003401010.1.53460 WP_003401010.1.53480 WP_003401010.1.53517 WP_003401010.1.53522 WP_003401010.1.53525 WP_003401010.1.53526 WP_003401010.1.53553 WP_003401010.1.53606 WP_003401010.1.53609 WP_003401010.1.53628 WP_003401010.1.53643 WP_003401010.1.53667 WP_003401010.1.53679 WP_003401010.1.53715 WP_003401010.1.53730 WP_003401010.1.53742 WP_003401010.1.53743 WP_003401010.1.53754 WP_003401010.1.53775 WP_003401010.1.53787 WP_003401010.1.53803 WP_003401010.1.53818 WP_003401010.1.53822 WP_003401010.1.53853 WP_003401010.1.53865 WP_003401010.1.53888 WP_003401010.1.53900 WP_003401010.1.53912 WP_003401010.1.53914 WP_003401010.1.53952 WP_003401010.1.5398 WP_003401010.1.5408 WP_003401010.1.54089 WP_003401010.1.54093 WP_003401010.1.54099 WP_003401010.1.54112 WP_003401010.1.54125 WP_003401010.1.54141 WP_003401010.1.54162 WP_003401010.1.54179 WP_003401010.1.54206 WP_003401010.1.54218 WP_003401010.1.54225 WP_003401010.1.54227 WP_003401010.1.54232 WP_003401010.1.54241 WP_003401010.1.54245 WP_003401010.1.54247 WP_003401010.1.54260 WP_003401010.1.54275 WP_003401010.1.54280 WP_003401010.1.5429 WP_003401010.1.54294 WP_003401010.1.54314 WP_003401010.1.54347 WP_003401010.1.54351 WP_003401010.1.54370 WP_003401010.1.54428 WP_003401010.1.54449 WP_003401010.1.54494 WP_003401010.1.54514 WP_003401010.1.54519 WP_003401010.1.5452 WP_003401010.1.54531 WP_003401010.1.54537 WP_003401010.1.54553 WP_003401010.1.54555 WP_003401010.1.54575 WP_003401010.1.54633 WP_003401010.1.54686 WP_003401010.1.54687 WP_003401010.1.54705 WP_003401010.1.54730 WP_003401010.1.54732 WP_003401010.1.5475 WP_003401010.1.54797 WP_003401010.1.54807 WP_003401010.1.54836 WP_003401010.1.54838 WP_003401010.1.54860 WP_003401010.1.54888 WP_003401010.1.54897 WP_003401010.1.54905 WP_003401010.1.54909 WP_003401010.1.54937 WP_003401010.1.54939 WP_003401010.1.54944 WP_003401010.1.54945 WP_003401010.1.54953 WP_003401010.1.54964 WP_003401010.1.55015 WP_003401010.1.55022 WP_003401010.1.55023 WP_003401010.1.55051 WP_003401010.1.55072 WP_003401010.1.55088 WP_003401010.1.55106 WP_003401010.1.55126 WP_003401010.1.55128 WP_003401010.1.55140 WP_003401010.1.55150 WP_003401010.1.55210 WP_003401010.1.55227 WP_003401010.1.55248 WP_003401010.1.55257 WP_003401010.1.55258 WP_003401010.1.55267 WP_003401010.1.55279 WP_003401010.1.55307 WP_003401010.1.55326 WP_003401010.1.55328 WP_003401010.1.5533 WP_003401010.1.55345 WP_003401010.1.55396 WP_003401010.1.55398 WP_003401010.1.55441 WP_003401010.1.55459 WP_003401010.1.55501 WP_003401010.1.55504 WP_003401010.1.55578 WP_003401010.1.55626 WP_003401010.1.55641 WP_003401010.1.5569 WP_003401010.1.55723 WP_003401010.1.55735 WP_003401010.1.5574 WP_003401010.1.55772 WP_003401010.1.55802 WP_003401010.1.55807 WP_003401010.1.55819 WP_003401010.1.55821 WP_003401010.1.5583 WP_003401010.1.55849 WP_003401010.1.55856 WP_003401010.1.55860 WP_003401010.1.55882 WP_003401010.1.55883 WP_003401010.1.55894 WP_003401010.1.55902 WP_003401010.1.55908 WP_003401010.1.55909 WP_003401010.1.5591 WP_003401010.1.55961 WP_003401010.1.55977 WP_003401010.1.55983 WP_003401010.1.56028 WP_003401010.1.56057 WP_003401010.1.56060 WP_003401010.1.56107 WP_003401010.1.56132 WP_003401010.1.56163 WP_003401010.1.56167 WP_003401010.1.56178 WP_003401010.1.56287 WP_003401010.1.56292 WP_003401010.1.56327 WP_003401010.1.56341 WP_003401010.1.56359 WP_003401010.1.56365 WP_003401010.1.56394 WP_003401010.1.56443 WP_003401010.1.56473 WP_003401010.1.56478 WP_003401010.1.56500 WP_003401010.1.56517 WP_003401010.1.56534 WP_003401010.1.5656 WP_003401010.1.56577 WP_003401010.1.56593 WP_003401010.1.56625 WP_003401010.1.56637 WP_003401010.1.56670 WP_003401010.1.56697 WP_003401010.1.567 WP_003401010.1.56701 WP_003401010.1.56709 WP_003401010.1.56743 WP_003401010.1.56755 WP_003401010.1.56764 WP_003401010.1.56769 WP_003401010.1.56770 WP_003401010.1.56795 WP_003401010.1.5681 WP_003401010.1.56827 WP_003401010.1.56839 WP_003401010.1.56863 WP_003401010.1.56868 WP_003401010.1.56869 WP_003401010.1.56915 WP_003401010.1.56926 WP_003401010.1.56961 WP_003401010.1.56971 WP_003401010.1.56972 WP_003401010.1.57023 WP_003401010.1.57035 WP_003401010.1.57077 WP_003401010.1.57087 WP_003401010.1.57094 WP_003401010.1.57134 WP_003401010.1.57151 WP_003401010.1.57169 WP_003401010.1.57208 WP_003401010.1.57212 WP_003401010.1.57230 WP_003401010.1.5724 WP_003401010.1.5725 WP_003401010.1.5727 WP_003401010.1.57273 WP_003401010.1.573 WP_003401010.1.57314 WP_003401010.1.57326 WP_003401010.1.57328 WP_003401010.1.57331 WP_003401010.1.57340 WP_003401010.1.57351 WP_003401010.1.57352 WP_003401010.1.57380 WP_003401010.1.57430 WP_003401010.1.5744 WP_003401010.1.57440 WP_003401010.1.5745 WP_003401010.1.57461 WP_003401010.1.57469 WP_003401010.1.57489 WP_003401010.1.575 WP_003401010.1.57509 WP_003401010.1.57519 WP_003401010.1.57525 WP_003401010.1.57551 WP_003401010.1.5758 WP_003401010.1.57596 WP_003401010.1.57604 WP_003401010.1.57617 WP_003401010.1.57619 WP_003401010.1.57627 WP_003401010.1.57642 WP_003401010.1.57658 WP_003401010.1.57667 WP_003401010.1.57675 WP_003401010.1.57689 WP_003401010.1.57708 WP_003401010.1.57794 WP_003401010.1.57821 WP_003401010.1.57825 WP_003401010.1.57843 WP_003401010.1.57906 WP_003401010.1.57924 WP_003401010.1.57926 WP_003401010.1.57930 WP_003401010.1.57957 WP_003401010.1.57960 WP_003401010.1.57964 WP_003401010.1.57991 WP_003401010.1.58086 WP_003401010.1.58103 WP_003401010.1.58108 WP_003401010.1.5811 WP_003401010.1.58121 WP_003401010.1.58145 WP_003401010.1.58164 WP_003401010.1.58174 WP_003401010.1.582 WP_003401010.1.58202 WP_003401010.1.58209 WP_003401010.1.58215 WP_003401010.1.5824 WP_003401010.1.58250 WP_003401010.1.58259 WP_003401010.1.58283 WP_003401010.1.58288 WP_003401010.1.5830 WP_003401010.1.58303 WP_003401010.1.58311 WP_003401010.1.58330 WP_003401010.1.58359 WP_003401010.1.58386 WP_003401010.1.58393 WP_003401010.1.58431 WP_003401010.1.5844 WP_003401010.1.58457 WP_003401010.1.58488 WP_003401010.1.58518 WP_003401010.1.58534 WP_003401010.1.58559 WP_003401010.1.58567 WP_003401010.1.58573 WP_003401010.1.58602 WP_003401010.1.58612 WP_003401010.1.58619 WP_003401010.1.58630 WP_003401010.1.5865 WP_003401010.1.58671 WP_003401010.1.58690 WP_003401010.1.58743 WP_003401010.1.58754 WP_003401010.1.5879 WP_003401010.1.5881 WP_003401010.1.58824 WP_003401010.1.58848 WP_003401010.1.58857 WP_003401010.1.58891 WP_003401010.1.58892 WP_003401010.1.5890 WP_003401010.1.58904 WP_003401010.1.58921 WP_003401010.1.58930 WP_003401010.1.58941 WP_003401010.1.58953 WP_003401010.1.58961 WP_003401010.1.5898 WP_003401010.1.59025 WP_003401010.1.59029 WP_003401010.1.59037 WP_003401010.1.59044 WP_003401010.1.59085 WP_003401010.1.59088 WP_003401010.1.59112 WP_003401010.1.59130 WP_003401010.1.5914 WP_003401010.1.59147 WP_003401010.1.59166 WP_003401010.1.59205 WP_003401010.1.59209 WP_003401010.1.59237 WP_003401010.1.59240 WP_003401010.1.59253 WP_003401010.1.59254 WP_003401010.1.59262 WP_003401010.1.59270 WP_003401010.1.5928 WP_003401010.1.59304 WP_003401010.1.59305 WP_003401010.1.59309 WP_003401010.1.59316 WP_003401010.1.59326 WP_003401010.1.59328 WP_003401010.1.59333 WP_003401010.1.59338 WP_003401010.1.59388 WP_003401010.1.59428 WP_003401010.1.59487 WP_003401010.1.59537 WP_003401010.1.59561 WP_003401010.1.59677 WP_003401010.1.59722 WP_003401010.1.59727 WP_003401010.1.59732 WP_003401010.1.59738 WP_003401010.1.59750 WP_003401010.1.59757 WP_003401010.1.59808 WP_003401010.1.59850 WP_003401010.1.59856 WP_003401010.1.59860 WP_003401010.1.59861 WP_003401010.1.5987 WP_003401010.1.59878 WP_003401010.1.59888 WP_003401010.1.59952 WP_003401010.1.5996 WP_003401010.1.59961 WP_003401010.1.59974 WP_003401010.1.6000 WP_003401010.1.60007 WP_003401010.1.60016 WP_003401010.1.6003 WP_003401010.1.60047 WP_003401010.1.6007 WP_003401010.1.60121 WP_003401010.1.60125 WP_003401010.1.60135 WP_003401010.1.60139 WP_003401010.1.60152 WP_003401010.1.60171 WP_003401010.1.60197 WP_003401010.1.6020 WP_003401010.1.60205 WP_003401010.1.60207 WP_003401010.1.60215 WP_003401010.1.60217 WP_003401010.1.60267 WP_003401010.1.60288 WP_003401010.1.60291 WP_003401010.1.60301 WP_003401010.1.60305 WP_003401010.1.60312 WP_003401010.1.60313 WP_003401010.1.60314 WP_003401010.1.60367 WP_003401010.1.60376 WP_003401010.1.60403 WP_003401010.1.60413 WP_003401010.1.60421 WP_003401010.1.60451 WP_003401010.1.60460 WP_003401010.1.60479 WP_003401010.1.60487 WP_003401010.1.60512 WP_003401010.1.60573 WP_003401010.1.60583 WP_003401010.1.60632 WP_003401010.1.60657 WP_003401010.1.60687 WP_003401010.1.60689 WP_003401010.1.60727 WP_003401010.1.60738 WP_003401010.1.60763 WP_003401010.1.6077 WP_003401010.1.60791 WP_003401010.1.60834 WP_003401010.1.60870 WP_003401010.1.60878 WP_003401010.1.60879 WP_003401010.1.60913 WP_003401010.1.60978 WP_003401010.1.61000 WP_003401010.1.61001 WP_003401010.1.61012 WP_003401010.1.61014 WP_003401010.1.61015 WP_003401010.1.61037 WP_003401010.1.61052 WP_003401010.1.61065 WP_003401010.1.61100 WP_003401010.1.61101 WP_003401010.1.61138 WP_003401010.1.61142 WP_003401010.1.61198 WP_003401010.1.612 WP_003401010.1.61234 WP_003401010.1.61281 WP_003401010.1.61314 WP_003401010.1.61321 WP_003401010.1.61326 WP_003401010.1.61328 WP_003401010.1.61368 WP_003401010.1.61391 WP_003401010.1.61406 WP_003401010.1.61409 WP_003401010.1.61420 WP_003401010.1.61422 WP_003401010.1.61425 WP_003401010.1.61428 WP_003401010.1.61469 WP_003401010.1.61494 WP_003401010.1.61522 WP_003401010.1.61552 WP_003401010.1.61557 WP_003401010.1.61567 WP_003401010.1.61571 WP_003401010.1.61573 WP_003401010.1.61584 WP_003401010.1.61586 WP_003401010.1.6159 WP_003401010.1.61592 WP_003401010.1.6160 WP_003401010.1.61614 WP_003401010.1.6163 WP_003401010.1.61655 WP_003401010.1.61665 WP_003401010.1.61669 WP_003401010.1.61682 WP_003401010.1.61692 WP_003401010.1.61719 WP_003401010.1.61728 WP_003401010.1.61750 WP_003401010.1.61754 WP_003401010.1.61755 WP_003401010.1.61757 WP_003401010.1.6179 WP_003401010.1.61793 WP_003401010.1.61816 WP_003401010.1.61842 WP_003401010.1.61850 WP_003401010.1.61862 WP_003401010.1.61865 WP_003401010.1.61868 WP_003401010.1.61911 WP_003401010.1.61925 WP_003401010.1.61941 WP_003401010.1.61953 WP_003401010.1.61979 WP_003401010.1.61986 WP_003401010.1.61987 WP_003401010.1.61998 WP_003401010.1.62021 WP_003401010.1.62087 WP_003401010.1.62089 WP_003401010.1.62101 WP_003401010.1.62104 WP_003401010.1.6211 WP_003401010.1.62132 WP_003401010.1.62162 WP_003401010.1.62225 WP_003401010.1.62230 WP_003401010.1.62238 WP_003401010.1.62249 WP_003401010.1.62270 WP_003401010.1.62281 WP_003401010.1.62307 WP_003401010.1.6231 WP_003401010.1.62359 WP_003401010.1.62371 WP_003401010.1.62379 WP_003401010.1.62395 WP_003401010.1.62408 WP_003401010.1.62449 WP_003401010.1.62468 WP_003401010.1.6248 WP_003401010.1.62508 WP_003401010.1.62565 WP_003401010.1.62594 WP_003401010.1.62606 WP_003401010.1.62616 WP_003401010.1.62666 WP_003401010.1.62687 WP_003401010.1.62715 WP_003401010.1.62730 WP_003401010.1.62738 WP_003401010.1.62761 WP_003401010.1.62766 WP_003401010.1.62786 WP_003401010.1.62813 WP_003401010.1.62839 WP_003401010.1.62841 WP_003401010.1.62909 WP_003401010.1.62936 WP_003401010.1.6294 WP_003401010.1.6295 WP_003401010.1.62962 WP_003401010.1.63007 WP_003401010.1.63019 WP_003401010.1.63032 WP_003401010.1.63037 WP_003401010.1.63064 WP_003401010.1.63066 WP_003401010.1.63072 WP_003401010.1.6308 WP_003401010.1.63081 WP_003401010.1.63096 WP_003401010.1.63106 WP_003401010.1.6314 WP_003401010.1.63144 WP_003401010.1.63154 WP_003401010.1.63160 WP_003401010.1.63161 WP_003401010.1.63166 WP_003401010.1.63175 WP_003401010.1.63194 WP_003401010.1.6322 WP_003401010.1.63222 WP_003401010.1.63247 WP_003401010.1.6328 WP_003401010.1.63291 WP_003401010.1.63312 WP_003401010.1.63317 WP_003401010.1.63331 WP_003401010.1.63373 WP_003401010.1.63384 WP_003401010.1.63403 WP_003401010.1.63424 WP_003401010.1.63428 WP_003401010.1.6345 WP_003401010.1.63464 WP_003401010.1.63483 WP_003401010.1.63502 WP_003401010.1.63504 WP_003401010.1.63522 WP_003401010.1.63530 WP_003401010.1.63538 WP_003401010.1.63564 WP_003401010.1.63567 WP_003401010.1.63596 WP_003401010.1.63600 WP_003401010.1.63623 WP_003401010.1.63624 WP_003401010.1.63625 WP_003401010.1.63627 WP_003401010.1.63654 WP_003401010.1.63662 WP_003401010.1.63711 WP_003401010.1.63734 WP_003401010.1.63807 WP_003401010.1.63819 WP_003401010.1.63844 WP_003401010.1.63888 WP_003401010.1.63913 WP_003401010.1.63915 WP_003401010.1.63918 WP_003401010.1.63961 WP_003401010.1.63970 WP_003401010.1.64000 WP_003401010.1.64027 WP_003401010.1.64058 WP_003401010.1.64065 WP_003401010.1.6407 WP_003401010.1.64082 WP_003401010.1.64091 WP_003401010.1.64102 WP_003401010.1.64104 WP_003401010.1.64119 WP_003401010.1.64169 WP_003401010.1.64219 WP_003401010.1.6422 WP_003401010.1.64222 WP_003401010.1.64223 WP_003401010.1.64228 WP_003401010.1.64235 WP_003401010.1.64249 WP_003401010.1.6427 WP_003401010.1.64278 WP_003401010.1.64287 WP_003401010.1.64414 WP_003401010.1.64419 WP_003401010.1.6443 WP_003401010.1.64463 WP_003401010.1.64480 WP_003401010.1.64497 WP_003401010.1.64506 WP_003401010.1.64511 WP_003401010.1.64513 WP_003401010.1.64514 WP_003401010.1.64515 WP_003401010.1.64522 WP_003401010.1.64526 WP_003401010.1.64543 WP_003401010.1.6456 WP_003401010.1.64567 WP_003401010.1.64588 WP_003401010.1.64589 WP_003401010.1.64594 WP_003401010.1.64595 WP_003401010.1.64608 WP_003401010.1.64619 WP_003401010.1.64629 WP_003401010.1.6464 WP_003401010.1.64664 WP_003401010.1.64669 WP_003401010.1.64672 WP_003401010.1.64680 WP_003401010.1.64682 WP_003401010.1.64727 WP_003401010.1.64729 WP_003401010.1.64774 WP_003401010.1.64776 WP_003401010.1.64802 WP_003401010.1.64832 WP_003401010.1.6486 WP_003401010.1.64870 WP_003401010.1.64898 WP_003401010.1.64922 WP_003401010.1.64924 WP_003401010.1.6493 WP_003401010.1.64937 WP_003401010.1.64941 WP_003401010.1.64973 WP_003401010.1.65001 WP_003401010.1.65026 WP_003401010.1.65053 WP_003401010.1.65070 WP_003401010.1.65079 WP_003401010.1.65102 WP_003401010.1.65157 WP_003401010.1.65181 WP_003401010.1.65212 WP_003401010.1.65229 WP_003401010.1.6523 WP_003401010.1.65253 WP_003401010.1.65289 WP_003401010.1.65291 WP_003401010.1.65315 WP_003401010.1.65329 WP_003401010.1.65359 WP_003401010.1.6536 WP_003401010.1.65374 WP_003401010.1.65414 WP_003401010.1.65416 WP_003401010.1.65433 WP_003401010.1.65455 WP_003401010.1.65467 WP_003401010.1.65488 WP_003401010.1.65529 WP_003401010.1.65539 WP_003401010.1.65583 WP_003401010.1.65612 WP_003401010.1.65623 WP_003401010.1.65635 WP_003401010.1.65637 WP_003401010.1.65648 WP_003401010.1.65683 WP_003401010.1.65686 WP_003401010.1.65688 WP_003401010.1.65707 WP_003401010.1.65733 WP_003401010.1.65746 WP_003401010.1.65747 WP_003401010.1.65759 WP_003401010.1.65816 WP_003401010.1.65830 WP_003401010.1.65858 WP_003401010.1.65862 WP_003401010.1.65869 WP_003401010.1.65893 WP_003401010.1.65929 WP_003401010.1.65932 WP_003401010.1.65958 WP_003401010.1.65974 WP_003401010.1.66004 WP_003401010.1.6606 WP_003401010.1.66089 WP_003401010.1.66149 WP_003401010.1.66229 WP_003401010.1.66276 WP_003401010.1.66293 WP_003401010.1.66297 WP_003401010.1.66323 WP_003401010.1.66325 WP_003401010.1.6633 WP_003401010.1.66334 WP_003401010.1.66355 WP_003401010.1.66367 WP_003401010.1.66394 WP_003401010.1.66396 WP_003401010.1.66451 WP_003401010.1.66455 WP_003401010.1.66457 WP_003401010.1.66464 WP_003401010.1.66466 WP_003401010.1.66487 WP_003401010.1.66504 WP_003401010.1.66544 WP_003401010.1.66558 WP_003401010.1.66580 WP_003401010.1.66582 WP_003401010.1.66612 WP_003401010.1.66615 WP_003401010.1.66617 WP_003401010.1.66635 WP_003401010.1.66656 WP_003401010.1.66663 WP_003401010.1.66675 WP_003401010.1.66715 WP_003401010.1.66718 WP_003401010.1.66762 WP_003401010.1.66776 WP_003401010.1.66808 WP_003401010.1.66817 WP_003401010.1.66819 WP_003401010.1.66826 WP_003401010.1.66830 WP_003401010.1.66842 WP_003401010.1.66868 WP_003401010.1.66878 WP_003401010.1.66880 WP_003401010.1.66893 WP_003401010.1.66961 WP_003401010.1.67005 WP_003401010.1.6704 WP_003401010.1.67044 WP_003401010.1.67061 WP_003401010.1.67089 WP_003401010.1.67098 WP_003401010.1.67146 WP_003401010.1.67170 WP_003401010.1.67197 WP_003401010.1.6720 WP_003401010.1.67207 WP_003401010.1.67218 WP_003401010.1.67220 WP_003401010.1.67225 WP_003401010.1.67231 WP_003401010.1.6724 WP_003401010.1.67257 WP_003401010.1.67298 WP_003401010.1.67324 WP_003401010.1.67332 WP_003401010.1.67346 WP_003401010.1.67354 WP_003401010.1.67360 WP_003401010.1.67381 WP_003401010.1.67396 WP_003401010.1.67417 WP_003401010.1.67422 WP_003401010.1.67453 WP_003401010.1.67459 WP_003401010.1.6746 WP_003401010.1.67473 WP_003401010.1.67481 WP_003401010.1.67482 WP_003401010.1.67496 WP_003401010.1.67499 WP_003401010.1.67516 WP_003401010.1.67523 WP_003401010.1.67536 WP_003401010.1.67575 WP_003401010.1.67587 WP_003401010.1.67598 WP_003401010.1.67600 WP_003401010.1.67602 WP_003401010.1.67630 WP_003401010.1.67679 WP_003401010.1.67692 WP_003401010.1.67744 WP_003401010.1.6775 WP_003401010.1.67750 WP_003401010.1.6777 WP_003401010.1.67809 WP_003401010.1.67816 WP_003401010.1.67844 WP_003401010.1.67848 WP_003401010.1.67870 WP_003401010.1.67888 WP_003401010.1.67915 WP_003401010.1.67945 WP_003401010.1.67949 WP_003401010.1.67980 WP_003401010.1.67982 WP_003401010.1.68022 WP_003401010.1.68029 WP_003401010.1.68037 WP_003401010.1.68038 WP_003401010.1.68045 WP_003401010.1.68057 WP_003401010.1.68083 WP_003401010.1.68088 WP_003401010.1.68106 WP_003401010.1.68110 WP_003401010.1.68153 WP_003401010.1.68164 WP_003401010.1.68169 WP_003401010.1.68193 WP_003401010.1.68212 WP_003401010.1.68227 WP_003401010.1.68243 WP_003401010.1.6825 WP_003401010.1.68297 WP_003401010.1.68309 WP_003401010.1.68325 WP_003401010.1.68329 WP_003401010.1.68340 WP_003401010.1.68384 WP_003401010.1.68388 WP_003401010.1.68429 WP_003401010.1.6843 WP_003401010.1.68433 WP_003401010.1.68444 WP_003401010.1.68465 WP_003401010.1.68484 WP_003401010.1.68518 WP_003401010.1.68569 WP_003401010.1.68576 WP_003401010.1.68580 WP_003401010.1.68586 WP_003401010.1.68623 WP_003401010.1.68624 WP_003401010.1.68637 WP_003401010.1.68646 WP_003401010.1.68667 WP_003401010.1.68672 WP_003401010.1.68684 WP_003401010.1.68704 WP_003401010.1.68708 WP_003401010.1.6872 WP_003401010.1.68730 WP_003401010.1.68734 WP_003401010.1.68748 WP_003401010.1.68754 WP_003401010.1.6876 WP_003401010.1.68761 WP_003401010.1.68763 WP_003401010.1.68766 WP_003401010.1.68774 WP_003401010.1.68796 WP_003401010.1.68824 WP_003401010.1.68832 WP_003401010.1.68833 WP_003401010.1.68841 WP_003401010.1.68859 WP_003401010.1.68876 WP_003401010.1.68906 WP_003401010.1.68916 WP_003401010.1.68923 WP_003401010.1.68945 WP_003401010.1.6896 WP_003401010.1.68981 WP_003401010.1.68984 WP_003401010.1.68997 WP_003401010.1.69008 WP_003401010.1.69076 WP_003401010.1.69079 WP_003401010.1.6908 WP_003401010.1.69082 WP_003401010.1.69178 WP_003401010.1.69208 WP_003401010.1.69231 WP_003401010.1.69256 WP_003401010.1.69311 WP_003401010.1.69315 WP_003401010.1.69322 WP_003401010.1.69342 WP_003401010.1.6935 WP_003401010.1.6936 WP_003401010.1.69369 WP_003401010.1.69374 WP_003401010.1.69398 WP_003401010.1.69401 WP_003401010.1.69426 WP_003401010.1.69427 WP_003401010.1.69429 WP_003401010.1.6949 WP_003401010.1.6951 WP_003401010.1.69511 WP_003401010.1.69526 WP_003401010.1.69528 WP_003401010.1.69547 WP_003401010.1.69573 WP_003401010.1.69581 WP_003401010.1.6960 WP_003401010.1.69617 WP_003401010.1.69634 WP_003401010.1.69647 WP_003401010.1.69659 WP_003401010.1.69673 WP_003401010.1.69682 WP_003401010.1.69684 WP_003401010.1.69686 WP_003401010.1.69707 WP_003401010.1.69709 WP_003401010.1.69723 WP_003401010.1.69736 WP_003401010.1.69778 WP_003401010.1.69800 WP_003401010.1.69802 WP_003401010.1.69845 WP_003401010.1.69870 WP_003401010.1.69873 WP_003401010.1.69898 WP_003401010.1.69913 WP_003401010.1.69925 WP_003401010.1.69931 WP_003401010.1.69938 WP_003401010.1.69955 WP_003401010.1.69957 WP_003401010.1.69981 WP_003401010.1.69990 WP_003401010.1.70 WP_003401010.1.70000 WP_003401010.1.70017 WP_003401010.1.70032 WP_003401010.1.70055 WP_003401010.1.70062 WP_003401010.1.70072 WP_003401010.1.70131 WP_003401010.1.70132 WP_003401010.1.7022 WP_003401010.1.70227 WP_003401010.1.70255 WP_003401010.1.70271 WP_003401010.1.70274 WP_003401010.1.7029 WP_003401010.1.70325 WP_003401010.1.70328 WP_003401010.1.70356 WP_003401010.1.70364 WP_003401010.1.70368 WP_003401010.1.70369 WP_003401010.1.70418 WP_003401010.1.70422 WP_003401010.1.70435 WP_003401010.1.70444 WP_003401010.1.70463 WP_003401010.1.70471 WP_003401010.1.70480 WP_003401010.1.70494 WP_003401010.1.70498 WP_003401010.1.70505 WP_003401010.1.70525 WP_003401010.1.70573 WP_003401010.1.70577 WP_003401010.1.70610 WP_003401010.1.70615 WP_003401010.1.70618 WP_003401010.1.70622 WP_003401010.1.70626 WP_003401010.1.70668 WP_003401010.1.70699 WP_003401010.1.70704 WP_003401010.1.70729 WP_003401010.1.70757 WP_003401010.1.70782 WP_003401010.1.70796 WP_003401010.1.70830 WP_003401010.1.70834 WP_003401010.1.7084 WP_003401010.1.70840 WP_003401010.1.70864 WP_003401010.1.70871 WP_003401010.1.70915 WP_003401010.1.70955 WP_003401010.1.70958 WP_003401010.1.70964 WP_003401010.1.70976 WP_003401010.1.71015 WP_003401010.1.71026 WP_003401010.1.71063 WP_003401010.1.71076 WP_003401010.1.71083 WP_003401010.1.7111 WP_003401010.1.71118 WP_003401010.1.71128 WP_003401010.1.7113 WP_003401010.1.71187 WP_003401010.1.71191 WP_003401010.1.71255 WP_003401010.1.71258 WP_003401010.1.71289 WP_003401010.1.71326 WP_003401010.1.71329 WP_003401010.1.71331 WP_003401010.1.71344 WP_003401010.1.71390 WP_003401010.1.71414 WP_003401010.1.71440 WP_003401010.1.71457 WP_003401010.1.7146 WP_003401010.1.71464 WP_003401010.1.71490 WP_003401010.1.71492 WP_003401010.1.71509 WP_003401010.1.71516 WP_003401010.1.71517 WP_003401010.1.71527 WP_003401010.1.71532 WP_003401010.1.71545 WP_003401010.1.71546 WP_003401010.1.71569 WP_003401010.1.71604 WP_003401010.1.71630 WP_003401010.1.71638 WP_003401010.1.71654 WP_003401010.1.71664 WP_003401010.1.71665 WP_003401010.1.71683 WP_003401010.1.71701 WP_003401010.1.71718 WP_003401010.1.71731 WP_003401010.1.71778 WP_003401010.1.71781 WP_003401010.1.71803 WP_003401010.1.71847 WP_003401010.1.7185 WP_003401010.1.71851 WP_003401010.1.71871 WP_003401010.1.71909 WP_003401010.1.71957 WP_003401010.1.71970 WP_003401010.1.72047 WP_003401010.1.72061 WP_003401010.1.72062 WP_003401010.1.72072 WP_003401010.1.72111 WP_003401010.1.72122 WP_003401010.1.72128 WP_003401010.1.72143 WP_003401010.1.7216 WP_003401010.1.72168 WP_003401010.1.72179 WP_003401010.1.72209 WP_003401010.1.72227 WP_003401010.1.7224 WP_003401010.1.72268 WP_003401010.1.72332 WP_003401010.1.72380 WP_003401010.1.72401 WP_003401010.1.72405 WP_003401010.1.72420 WP_003401010.1.72441 WP_003401010.1.72451 WP_003401010.1.72452 WP_003401010.1.72457 WP_003401010.1.72459 WP_003401010.1.72460 WP_003401010.1.72466 WP_003401010.1.72487 WP_003401010.1.72488 WP_003401010.1.72492 WP_003401010.1.72506 WP_003401010.1.72543 WP_003401010.1.7256 WP_003401010.1.72576 WP_003401010.1.72578 WP_003401010.1.72585 WP_003401010.1.72591 WP_003401010.1.72592 WP_003401010.1.72640 WP_003401010.1.72661 WP_003401010.1.72684 WP_003401010.1.72739 WP_003401010.1.72744 WP_003401010.1.72755 WP_003401010.1.72759 WP_003401010.1.72784 WP_003401010.1.72792 WP_003401010.1.72826 WP_003401010.1.72831 WP_003401010.1.72852 WP_003401010.1.72853 WP_003401010.1.72879 WP_003401010.1.72880 WP_003401010.1.72938 WP_003401010.1.72954 WP_003401010.1.72957 WP_003401010.1.72959 WP_003401010.1.72973 WP_003401010.1.7298 WP_003401010.1.72982 WP_003401010.1.72988 WP_003401010.1.72993 WP_003401010.1.73006 WP_003401010.1.73013 WP_003401010.1.73025 WP_003401010.1.73028 WP_003401010.1.73042 WP_003401010.1.73045 WP_003401010.1.73092 WP_003401010.1.73118 WP_003401010.1.7312 WP_003401010.1.73127 WP_003401010.1.73134 WP_003401010.1.73150 WP_003401010.1.73154 WP_003401010.1.73163 WP_003401010.1.73182 WP_003401010.1.73205 WP_003401010.1.7321 WP_003401010.1.73310 WP_003401010.1.73365 WP_003401010.1.73391 WP_003401010.1.73404 WP_003401010.1.73424 WP_003401010.1.73436 WP_003401010.1.73445 WP_003401010.1.73453 WP_003401010.1.73465 WP_003401010.1.73466 WP_003401010.1.73470 WP_003401010.1.73471 WP_003401010.1.73478 WP_003401010.1.73482 WP_003401010.1.73507 WP_003401010.1.73532 WP_003401010.1.73550 WP_003401010.1.73564 WP_003401010.1.73623 WP_003401010.1.73629 WP_003401010.1.73644 WP_003401010.1.7366 WP_003401010.1.73661 WP_003401010.1.7368 WP_003401010.1.73688 WP_003401010.1.73723 WP_003401010.1.73744 WP_003401010.1.73750 WP_003401010.1.73760 WP_003401010.1.73774 WP_003401010.1.7379 WP_003401010.1.73813 WP_003401010.1.73840 WP_003401010.1.73876 WP_003401010.1.7389 WP_003401010.1.73986 WP_003401010.1.74016 WP_003401010.1.74039 WP_003401010.1.74083 WP_003401010.1.74101 WP_003401010.1.74107 WP_003401010.1.74120 WP_003401010.1.74129 WP_003401010.1.74144 WP_003401010.1.7417 WP_003401010.1.74190 WP_003401010.1.74210 WP_003401010.1.7423 WP_003401010.1.74259 WP_003401010.1.74262 WP_003401010.1.74269 WP_003401010.1.74282 WP_003401010.1.74291 WP_003401010.1.74296 WP_003401010.1.74304 WP_003401010.1.7432 WP_003401010.1.74347 WP_003401010.1.7436 WP_003401010.1.74378 WP_003401010.1.74382 WP_003401010.1.74395 WP_003401010.1.74400 WP_003401010.1.74401 WP_003401010.1.74432 WP_003401010.1.74442 WP_003401010.1.74487 WP_003401010.1.74499 WP_003401010.1.74504 WP_003401010.1.74511 WP_003401010.1.74523 WP_003401010.1.74525 WP_003401010.1.74551 WP_003401010.1.74555 WP_003401010.1.74628 WP_003401010.1.74641 WP_003401010.1.74653 WP_003401010.1.74660 WP_003401010.1.74683 WP_003401010.1.7469 WP_003401010.1.74725 WP_003401010.1.74760 WP_003401010.1.74786 WP_003401010.1.74809 WP_003401010.1.74820 WP_003401010.1.74870 WP_003401010.1.74881 WP_003401010.1.74888 WP_003401010.1.74952 WP_003401010.1.7496 WP_003401010.1.74988 WP_003401010.1.75043 WP_003401010.1.75045 WP_003401010.1.75055 WP_003401010.1.75078 WP_003401010.1.75081 WP_003401010.1.75120 WP_003401010.1.75163 WP_003401010.1.75200 WP_003401010.1.75202 WP_003401010.1.75234 WP_003401010.1.75239 WP_003401010.1.75250 WP_003401010.1.75263 WP_003401010.1.75281 WP_003401010.1.75342 WP_003401010.1.7535 WP_003401010.1.75376 WP_003401010.1.75391 WP_003401010.1.75395 WP_003401010.1.75441 WP_003401010.1.75510 WP_003401010.1.75581 WP_003401010.1.75598 WP_003401010.1.75635 WP_003401010.1.75645 WP_003401010.1.75665 WP_003401010.1.75671 WP_003401010.1.75741 WP_003401010.1.75749 WP_003401010.1.75772 WP_003401010.1.75774 WP_003401010.1.75811 WP_003401010.1.75833 WP_003401010.1.7585 WP_003401010.1.75864 WP_003401010.1.75868 WP_003401010.1.75878 WP_003401010.1.75927 WP_003401010.1.75946 WP_003401010.1.75968 WP_003401010.1.75974 WP_003401010.1.76007 WP_003401010.1.76016 WP_003401010.1.76032 WP_003401010.1.76037 WP_003401010.1.7604 WP_003401010.1.76045 WP_003401010.1.76052 WP_003401010.1.76058 WP_003401010.1.76064 WP_003401010.1.76110 WP_003401010.1.76126 WP_003401010.1.76133 WP_003401010.1.76138 WP_003401010.1.76157 WP_003401010.1.76172 WP_003401010.1.76177 WP_003401010.1.76183 WP_003401010.1.76209 WP_003401010.1.76239 WP_003401010.1.76272 WP_003401010.1.76277 WP_003401010.1.76280 WP_003401010.1.76281 WP_003401010.1.76291 WP_003401010.1.76297 WP_003401010.1.76360 WP_003401010.1.76379 WP_003401010.1.76403 WP_003401010.1.76413 WP_003401010.1.76414 WP_003401010.1.76427 WP_003401010.1.76436 WP_003401010.1.76442 WP_003401010.1.76443 WP_003401010.1.76456 WP_003401010.1.76521 WP_003401010.1.76533 WP_003401010.1.76616 WP_003401010.1.76625 WP_003401010.1.76629 WP_003401010.1.76638 WP_003401010.1.76639 WP_003401010.1.76640 WP_003401010.1.76644 WP_003401010.1.76677 WP_003401010.1.76678 WP_003401010.1.76734 WP_003401010.1.76744 WP_003401010.1.76750 WP_003401010.1.76754 WP_003401010.1.76757 WP_003401010.1.76781 WP_003401010.1.76818 WP_003401010.1.76824 WP_003401010.1.76835 WP_003401010.1.76873 WP_003401010.1.76881 WP_003401010.1.76888 WP_003401010.1.76900 WP_003401010.1.7691 WP_003401010.1.76947 WP_003401010.1.76954 WP_003401010.1.76955 WP_003401010.1.76963 WP_003401010.1.770 WP_003401010.1.77000 WP_003401010.1.77008 WP_003401010.1.77021 WP_003401010.1.77056 WP_003401010.1.77065 WP_003401010.1.77075 WP_003401010.1.77107 WP_003401010.1.77115 WP_003401010.1.77118 WP_003401010.1.77125 WP_003401010.1.77141 WP_003401010.1.77142 WP_003401010.1.77250 WP_003401010.1.77252 WP_003401010.1.77260 WP_003401010.1.77266 WP_003401010.1.77280 WP_003401010.1.77285 WP_003401010.1.77312 WP_003401010.1.77348 WP_003401010.1.77351 WP_003401010.1.77352 WP_003401010.1.77361 WP_003401010.1.774 WP_003401010.1.7740 WP_003401010.1.77404 WP_003401010.1.77425 WP_003401010.1.77463 WP_003401010.1.77474 WP_003401010.1.7748 WP_003401010.1.77484 WP_003401010.1.77491 WP_003401010.1.77499 WP_003401010.1.77510 WP_003401010.1.77530 WP_003401010.1.77554 WP_003401010.1.77559 WP_003401010.1.77599 WP_003401010.1.77605 WP_003401010.1.7762 WP_003401010.1.77627 WP_003401010.1.77649 WP_003401010.1.77654 WP_003401010.1.7766 WP_003401010.1.77667 WP_003401010.1.77704 WP_003401010.1.77706 WP_003401010.1.77726 WP_003401010.1.77774 WP_003401010.1.7778 WP_003401010.1.77790 WP_003401010.1.77809 WP_003401010.1.77820 WP_003401010.1.77843 WP_003401010.1.77855 WP_003401010.1.77865 WP_003401010.1.77868 WP_003401010.1.77890 WP_003401010.1.77909 WP_003401010.1.77911 WP_003401010.1.77931 WP_003401010.1.77984 WP_003401010.1.78020 WP_003401010.1.78024 WP_003401010.1.78075 WP_003401010.1.78084 WP_003401010.1.78086 WP_003401010.1.7809 WP_003401010.1.78098 WP_003401010.1.78105 WP_003401010.1.78113 WP_003401010.1.78136 WP_003401010.1.78162 WP_003401010.1.7817 WP_003401010.1.78200 WP_003401010.1.78216 WP_003401010.1.78236 WP_003401010.1.78238 WP_003401010.1.78322 WP_003401010.1.78338 WP_003401010.1.7836 WP_003401010.1.78360 WP_003401010.1.78386 WP_003401010.1.78435 WP_003401010.1.7844 WP_003401010.1.78459 WP_003401010.1.78488 WP_003401010.1.7849 WP_003401010.1.78499 WP_003401010.1.785 WP_003401010.1.78516 WP_003401010.1.78524 WP_003401010.1.78526 WP_003401010.1.78538 WP_003401010.1.78545 WP_003401010.1.78547 WP_003401010.1.78574 WP_003401010.1.78580 WP_003401010.1.7860 WP_003401010.1.78620 WP_003401010.1.78646 WP_003401010.1.78648 WP_003401010.1.78649 WP_003401010.1.78655 WP_003401010.1.78657 WP_003401010.1.78659 WP_003401010.1.7869 WP_003401010.1.78692 WP_003401010.1.78760 WP_003401010.1.78766 WP_003401010.1.78776 WP_003401010.1.78778 WP_003401010.1.78784 WP_003401010.1.78788 WP_003401010.1.78790 WP_003401010.1.78793 WP_003401010.1.78860 WP_003401010.1.7887 WP_003401010.1.78884 WP_003401010.1.78932 WP_003401010.1.78969 WP_003401010.1.78977 WP_003401010.1.78980 WP_003401010.1.79005 WP_003401010.1.79016 WP_003401010.1.79033 WP_003401010.1.79064 WP_003401010.1.79066 WP_003401010.1.79068 WP_003401010.1.79077 WP_003401010.1.79095 WP_003401010.1.79112 WP_003401010.1.79122 WP_003401010.1.79145 WP_003401010.1.79152 WP_003401010.1.79163 WP_003401010.1.79182 WP_003401010.1.79198 WP_003401010.1.79213 WP_003401010.1.79218 WP_003401010.1.79268 WP_003401010.1.79273 WP_003401010.1.79278 WP_003401010.1.79290 WP_003401010.1.79319 WP_003401010.1.79325 WP_003401010.1.79326 WP_003401010.1.7933 WP_003401010.1.79330 WP_003401010.1.79339 WP_003401010.1.79394 WP_003401010.1.79399 WP_003401010.1.79413 WP_003401010.1.79422 WP_003401010.1.79445 WP_003401010.1.79447 WP_003401010.1.79455 WP_003401010.1.79471 WP_003401010.1.79480 WP_003401010.1.79482 WP_003401010.1.79488 WP_003401010.1.79500 WP_003401010.1.79502 WP_003401010.1.79508 WP_003401010.1.79514 WP_003401010.1.79561 WP_003401010.1.79565 WP_003401010.1.79578 WP_003401010.1.79588 WP_003401010.1.79598 WP_003401010.1.79615 WP_003401010.1.79684 WP_003401010.1.79698 WP_003401010.1.797 WP_003401010.1.79744 WP_003401010.1.79784 WP_003401010.1.79802 WP_003401010.1.79806 WP_003401010.1.79819 WP_003401010.1.79826 WP_003401010.1.79828 WP_003401010.1.79851 WP_003401010.1.79853 WP_003401010.1.79863 WP_003401010.1.79881 WP_003401010.1.79885 WP_003401010.1.79898 WP_003401010.1.7990 WP_003401010.1.79900 WP_003401010.1.79913 WP_003401010.1.79918 WP_003401010.1.79947 WP_003401010.1.79948 WP_003401010.1.7995 WP_003401010.1.7997 WP_003401010.1.80004 WP_003401010.1.80015 WP_003401010.1.80022 WP_003401010.1.80030 WP_003401010.1.80054 WP_003401010.1.80084 WP_003401010.1.80099 WP_003401010.1.80129 WP_003401010.1.80177 WP_003401010.1.80234 WP_003401010.1.8026 WP_003401010.1.80275 WP_003401010.1.8029 WP_003401010.1.80299 WP_003401010.1.80300 WP_003401010.1.80304 WP_003401010.1.80326 WP_003401010.1.80351 WP_003401010.1.8037 WP_003401010.1.80370 WP_003401010.1.80399 WP_003401010.1.8044 WP_003401010.1.80451 WP_003401010.1.80458 WP_003401010.1.80461 WP_003401010.1.80490 WP_003401010.1.80503 WP_003401010.1.80507 WP_003401010.1.80552 WP_003401010.1.80576 WP_003401010.1.80588 WP_003401010.1.80599 WP_003401010.1.8060 WP_003401010.1.80624 WP_003401010.1.80636 WP_003401010.1.80673 WP_003401010.1.80711 WP_003401010.1.80714 WP_003401010.1.80743 WP_003401010.1.80784 WP_003401010.1.80815 WP_003401010.1.80853 WP_003401010.1.80918 WP_003401010.1.8093 WP_003401010.1.80967 WP_003401010.1.8097 WP_003401010.1.80988 WP_003401010.1.81007 WP_003401010.1.81013 WP_003401010.1.8105 WP_003401010.1.81059 WP_003401010.1.81063 WP_003401010.1.81066 WP_003401010.1.81075 WP_003401010.1.81091 WP_003401010.1.81119 WP_003401010.1.81125 WP_003401010.1.81136 WP_003401010.1.8114 WP_003401010.1.81189 WP_003401010.1.81192 WP_003401010.1.812 WP_003401010.1.81230 WP_003401010.1.81249 WP_003401010.1.81250 WP_003401010.1.81264 WP_003401010.1.8128 WP_003401010.1.81297 WP_003401010.1.8138 WP_003401010.1.81407 WP_003401010.1.8143 WP_003401010.1.81439 WP_003401010.1.81465 WP_003401010.1.81505 WP_003401010.1.81529 WP_003401010.1.81538 WP_003401010.1.81541 WP_003401010.1.81560 WP_003401010.1.81561 WP_003401010.1.81567 WP_003401010.1.81583 WP_003401010.1.81686 WP_003401010.1.81712 WP_003401010.1.81720 WP_003401010.1.81731 WP_003401010.1.81774 WP_003401010.1.81788 WP_003401010.1.81809 WP_003401010.1.81820 WP_003401010.1.81850 WP_003401010.1.81883 WP_003401010.1.81891 WP_003401010.1.81911 WP_003401010.1.81918 WP_003401010.1.82011 WP_003401010.1.82048 WP_003401010.1.82069 WP_003401010.1.82071 WP_003401010.1.82108 WP_003401010.1.82136 WP_003401010.1.82142 WP_003401010.1.8215 WP_003401010.1.82158 WP_003401010.1.8217 WP_003401010.1.82209 WP_003401010.1.82210 WP_003401010.1.82228 WP_003401010.1.82236 WP_003401010.1.82251 WP_003401010.1.82271 WP_003401010.1.82305 WP_003401010.1.82307 WP_003401010.1.82309 WP_003401010.1.82317 WP_003401010.1.8232 WP_003401010.1.82346 WP_003401010.1.82374 WP_003401010.1.82385 WP_003401010.1.82429 WP_003401010.1.82460 WP_003401010.1.82462 WP_003401010.1.82483 WP_003401010.1.82494 WP_003401010.1.82531 WP_003401010.1.82546 WP_003401010.1.82547 WP_003401010.1.82549 WP_003401010.1.82577 WP_003401010.1.82592 WP_003401010.1.82597 WP_003401010.1.82598 WP_003401010.1.82625 WP_003401010.1.82642 WP_003401010.1.82651 WP_003401010.1.82653 WP_003401010.1.82681 WP_003401010.1.82685 WP_003401010.1.8271 WP_003401010.1.82712 WP_003401010.1.8273 WP_003401010.1.82743 WP_003401010.1.82757 WP_003401010.1.82774 WP_003401010.1.82803 WP_003401010.1.82836 WP_003401010.1.82860 WP_003401010.1.82871 WP_003401010.1.82892 WP_003401010.1.82935 WP_003401010.1.82957 WP_003401010.1.82973 WP_003401010.1.82981 WP_003401010.1.82983 WP_003401010.1.83004 WP_003401010.1.83009 WP_003401010.1.83044 WP_003401010.1.83065 WP_003401010.1.83074 WP_003401010.1.83110 WP_003401010.1.83146 WP_003401010.1.83149 WP_003401010.1.83159 WP_003401010.1.8317 WP_003401010.1.83173 WP_003401010.1.83181 WP_003401010.1.83182 WP_003401010.1.83191 WP_003401010.1.83197 WP_003401010.1.83212 WP_003401010.1.8326 WP_003401010.1.83262 WP_003401010.1.83273 WP_003401010.1.83309 WP_003401010.1.83332 WP_003401010.1.83334 WP_003401010.1.83341 WP_003401010.1.83349 WP_003401010.1.8335 WP_003401010.1.83353 WP_003401010.1.83367 WP_003401010.1.83380 WP_003401010.1.83381 WP_003401010.1.83389 WP_003401010.1.83408 WP_003401010.1.83409 WP_003401010.1.83435 WP_003401010.1.83470 WP_003401010.1.83524 WP_003401010.1.83526 WP_003401010.1.8358 WP_003401010.1.83589 WP_003401010.1.83601 WP_003401010.1.83611 WP_003401010.1.83638 WP_003401010.1.83648 WP_003401010.1.83656 WP_003401010.1.83667 WP_003401010.1.83692 WP_003401010.1.83705 WP_003401010.1.83766 WP_003401010.1.83793 WP_003401010.1.83794 WP_003401010.1.83802 WP_003401010.1.83805 WP_003401010.1.83839 WP_003401010.1.83842 WP_003401010.1.83850 WP_003401010.1.83861 WP_003401010.1.83884 WP_003401010.1.83920 WP_003401010.1.83929 WP_003401010.1.83930 WP_003401010.1.83975 WP_003401010.1.83991 WP_003401010.1.8400 WP_003401010.1.84027 WP_003401010.1.8404 WP_003401010.1.84057 WP_003401010.1.84070 WP_003401010.1.8409 WP_003401010.1.84112 WP_003401010.1.84146 WP_003401010.1.8415 WP_003401010.1.84176 WP_003401010.1.84186 WP_003401010.1.84192 WP_003401010.1.8424 WP_003401010.1.84244 WP_003401010.1.84259 WP_003401010.1.8426 WP_003401010.1.84277 WP_003401010.1.84287 WP_003401010.1.8434 WP_003401010.1.84388 WP_003401010.1.84408 WP_003401010.1.84409 WP_003401010.1.84438 WP_003401010.1.84460 WP_003401010.1.84488 WP_003401010.1.84504 WP_003401010.1.84620 WP_003401010.1.84623 WP_003401010.1.84641 WP_003401010.1.84655 WP_003401010.1.84666 WP_003401010.1.84670 WP_003401010.1.84739 WP_003401010.1.84748 WP_003401010.1.84766 WP_003401010.1.84772 WP_003401010.1.84774 WP_003401010.1.848 WP_003401010.1.84812 WP_003401010.1.84836 WP_003401010.1.84839 WP_003401010.1.84846 WP_003401010.1.84873 WP_003401010.1.84938 WP_003401010.1.84968 WP_003401010.1.84973 WP_003401010.1.84981 WP_003401010.1.84985 WP_003401010.1.8503 WP_003401010.1.85038 WP_003401010.1.85041 WP_003401010.1.85043 WP_003401010.1.8505 WP_003401010.1.85074 WP_003401010.1.8509 WP_003401010.1.8512 WP_003401010.1.85148 WP_003401010.1.8518 WP_003401010.1.8522 WP_003401010.1.85242 WP_003401010.1.85276 WP_003401010.1.85281 WP_003401010.1.85284 WP_003401010.1.85314 WP_003401010.1.85319 WP_003401010.1.85330 WP_003401010.1.85341 WP_003401010.1.85346 WP_003401010.1.8535 WP_003401010.1.85363 WP_003401010.1.85371 WP_003401010.1.85377 WP_003401010.1.85387 WP_003401010.1.85399 WP_003401010.1.85458 WP_003401010.1.8546 WP_003401010.1.85464 WP_003401010.1.85478 WP_003401010.1.85480 WP_003401010.1.85488 WP_003401010.1.85495 WP_003401010.1.85551 WP_003401010.1.85557 WP_003401010.1.85577 WP_003401010.1.85597 WP_003401010.1.85599 WP_003401010.1.85610 WP_003401010.1.8563 WP_003401010.1.85648 WP_003401010.1.85679 WP_003401010.1.85704 WP_003401010.1.85717 WP_003401010.1.85727 WP_003401010.1.85737 WP_003401010.1.85763 WP_003401010.1.85808 WP_003401010.1.85819 WP_003401010.1.85820 WP_003401010.1.85823 WP_003401010.1.85832 WP_003401010.1.8586 WP_003401010.1.85872 WP_003401010.1.85894 WP_003401010.1.85913 WP_003401010.1.85986 WP_003401010.1.86000 WP_003401010.1.86024 WP_003401010.1.86025 WP_003401010.1.86032 WP_003401010.1.86048 WP_003401010.1.86052 WP_003401010.1.86067 WP_003401010.1.86103 WP_003401010.1.86122 WP_003401010.1.86124 WP_003401010.1.86160 WP_003401010.1.86164 WP_003401010.1.86168 WP_003401010.1.86190 WP_003401010.1.86204 WP_003401010.1.86208 WP_003401010.1.86235 WP_003401010.1.86249 WP_003401010.1.86260 WP_003401010.1.86290 WP_003401010.1.863 WP_003401010.1.86327 WP_003401010.1.86334 WP_003401010.1.86337 WP_003401010.1.86368 WP_003401010.1.86377 WP_003401010.1.86425 WP_003401010.1.86459 WP_003401010.1.8649 WP_003401010.1.86499 WP_003401010.1.86520 WP_003401010.1.86561 WP_003401010.1.86568 WP_003401010.1.86575 WP_003401010.1.86584 WP_003401010.1.86605 WP_003401010.1.86626 WP_003401010.1.86648 WP_003401010.1.8666 WP_003401010.1.86684 WP_003401010.1.86696 WP_003401010.1.86705 WP_003401010.1.86718 WP_003401010.1.86725 WP_003401010.1.86757 WP_003401010.1.86766 WP_003401010.1.86801 WP_003401010.1.86814 WP_003401010.1.86820 WP_003401010.1.86825 WP_003401010.1.86834 WP_003401010.1.8685 WP_003401010.1.86851 WP_003401010.1.86855 WP_003401010.1.86867 WP_003401010.1.86877 WP_003401010.1.86883 WP_003401010.1.8689 WP_003401010.1.86892 WP_003401010.1.86933 WP_003401010.1.86941 WP_003401010.1.86950 WP_003401010.1.86962 WP_003401010.1.86963 WP_003401010.1.86979 WP_003401010.1.8700 WP_003401010.1.87001 WP_003401010.1.87002 WP_003401010.1.87031 WP_003401010.1.87116 WP_003401010.1.87117 WP_003401010.1.8714 WP_003401010.1.87162 WP_003401010.1.87178 WP_003401010.1.87191 WP_003401010.1.87201 WP_003401010.1.87209 WP_003401010.1.87240 WP_003401010.1.87266 WP_003401010.1.87275 WP_003401010.1.8733 WP_003401010.1.87345 WP_003401010.1.87369 WP_003401010.1.8737 WP_003401010.1.87401 WP_003401010.1.87404 WP_003401010.1.87406 WP_003401010.1.87409 WP_003401010.1.87444 WP_003401010.1.87446 WP_003401010.1.87459 WP_003401010.1.87472 WP_003401010.1.87489 WP_003401010.1.87494 WP_003401010.1.87496 WP_003401010.1.87582 WP_003401010.1.87588 WP_003401010.1.87617 WP_003401010.1.87619 WP_003401010.1.87620 WP_003401010.1.87634 WP_003401010.1.87643 WP_003401010.1.8765 WP_003401010.1.87650 WP_003401010.1.87654 WP_003401010.1.87658 WP_003401010.1.87665 WP_003401010.1.87676 WP_003401010.1.87677 WP_003401010.1.87684 WP_003401010.1.87692 WP_003401010.1.87707 WP_003401010.1.87732 WP_003401010.1.87784 WP_003401010.1.87796 WP_003401010.1.87809 WP_003401010.1.87817 WP_003401010.1.87827 WP_003401010.1.87831 WP_003401010.1.87835 WP_003401010.1.87837 WP_003401010.1.87866 WP_003401010.1.8789 WP_003401010.1.87911 WP_003401010.1.87924 WP_003401010.1.87951 WP_003401010.1.87955 WP_003401010.1.87991 WP_003401010.1.88 WP_003401010.1.88002 WP_003401010.1.88037 WP_003401010.1.88039 WP_003401010.1.88072 WP_003401010.1.88077 WP_003401010.1.88121 WP_003401010.1.88180 WP_003401010.1.88191 WP_003401010.1.88205 WP_003401010.1.88217 WP_003401010.1.88219 WP_003401010.1.88245 WP_003401010.1.88253 WP_003401010.1.88294 WP_003401010.1.88315 WP_003401010.1.88316 WP_003401010.1.88320 WP_003401010.1.88338 WP_003401010.1.8840 WP_003401010.1.88437 WP_003401010.1.88453 WP_003401010.1.88469 WP_003401010.1.88489 WP_003401010.1.88507 WP_003401010.1.88521 WP_003401010.1.88530 WP_003401010.1.88537 WP_003401010.1.88541 WP_003401010.1.88592 WP_003401010.1.88616 WP_003401010.1.88618 WP_003401010.1.8862 WP_003401010.1.88625 WP_003401010.1.88632 WP_003401010.1.88634 WP_003401010.1.88649 WP_003401010.1.8870 WP_003401010.1.88737 WP_003401010.1.88756 WP_003401010.1.888 WP_003401010.1.88824 WP_003401010.1.88886 WP_003401010.1.88965 WP_003401010.1.88985 WP_003401010.1.8902 WP_003401010.1.89025 WP_003401010.1.89041 WP_003401010.1.89046 WP_003401010.1.89082 WP_003401010.1.89162 WP_003401010.1.89168 WP_003401010.1.8917 WP_003401010.1.89193 WP_003401010.1.89205 WP_003401010.1.89207 WP_003401010.1.89225 WP_003401010.1.8925 WP_003401010.1.89277 WP_003401010.1.89286 WP_003401010.1.89293 WP_003401010.1.89320 WP_003401010.1.8935 WP_003401010.1.89371 WP_003401010.1.89378 WP_003401010.1.89392 WP_003401010.1.89406 WP_003401010.1.89451 WP_003401010.1.89453 WP_003401010.1.89473 WP_003401010.1.89475 WP_003401010.1.89483 WP_003401010.1.895 WP_003401010.1.89513 WP_003401010.1.89517 WP_003401010.1.89522 WP_003401010.1.8954 WP_003401010.1.89543 WP_003401010.1.89567 WP_003401010.1.8957 WP_003401010.1.89572 WP_003401010.1.89589 WP_003401010.1.89607 WP_003401010.1.89613 WP_003401010.1.89625 WP_003401010.1.89648 WP_003401010.1.8967 WP_003401010.1.89670 WP_003401010.1.89676 WP_003401010.1.89729 WP_003401010.1.89739 WP_003401010.1.89762 WP_003401010.1.8977 WP_003401010.1.89808 WP_003401010.1.8982 WP_003401010.1.89829 WP_003401010.1.89831 WP_003401010.1.89844 WP_003401010.1.89849 WP_003401010.1.8989 WP_003401010.1.89901 WP_003401010.1.89903 WP_003401010.1.89909 WP_003401010.1.89922 WP_003401010.1.89926 WP_003401010.1.89963 WP_003401010.1.89971 WP_003401010.1.8998 WP_003401010.1.89987 WP_003401010.1.900 WP_003401010.1.90048 WP_003401010.1.9007 WP_003401010.1.90080 WP_003401010.1.90130 WP_003401010.1.90134 WP_003401010.1.90137 WP_003401010.1.90157 WP_003401010.1.90184 WP_003401010.1.90199 WP_003401010.1.90231 WP_003401010.1.90245 WP_003401010.1.90308 WP_003401010.1.90322 WP_003401010.1.90328 WP_003401010.1.90372 WP_003401010.1.90439 WP_003401010.1.90481 WP_003401010.1.90499 WP_003401010.1.9050 WP_003401010.1.90527 WP_003401010.1.90550 WP_003401010.1.90560 WP_003401010.1.90612 WP_003401010.1.90640 WP_003401010.1.90672 WP_003401010.1.90687 WP_003401010.1.90691 WP_003401010.1.90711 WP_003401010.1.90722 WP_003401010.1.90744 WP_003401010.1.9075 WP_003401010.1.90756 WP_003401010.1.90767 WP_003401010.1.90771 WP_003401010.1.90785 WP_003401010.1.90788 WP_003401010.1.90800 WP_003401010.1.90810 WP_003401010.1.90816 WP_003401010.1.90819 WP_003401010.1.9082 WP_003401010.1.90831 WP_003401010.1.90884 WP_003401010.1.90899 WP_003401010.1.90906 WP_003401010.1.90958 WP_003401010.1.90976 WP_003401010.1.90977 WP_003401010.1.90987 WP_003401010.1.9102 WP_003401010.1.91026 WP_003401010.1.91032 WP_003401010.1.91043 WP_003401010.1.91053 WP_003401010.1.91082 WP_003401010.1.91106 WP_003401010.1.91112 WP_003401010.1.91144 WP_003401010.1.91151 WP_003401010.1.91157 WP_003401010.1.91167 WP_003401010.1.91169 WP_003401010.1.91192 WP_003401010.1.91201 WP_003401010.1.91207 WP_003401010.1.91208 WP_003401010.1.91211 WP_003401010.1.91214 WP_003401010.1.91230 WP_003401010.1.91244 WP_003401010.1.91251 WP_003401010.1.91260 WP_003401010.1.91265 WP_003401010.1.91284 WP_003401010.1.91294 WP_003401010.1.91303 WP_003401010.1.91322 WP_003401010.1.91352 WP_003401010.1.91386 WP_003401010.1.9139 WP_003401010.1.91398 WP_003401010.1.91430 WP_003401010.1.91436 WP_003401010.1.91483 WP_003401010.1.91496 WP_003401010.1.91507 WP_003401010.1.91576 WP_003401010.1.91589 WP_003401010.1.91694 WP_003401010.1.91695 WP_003401010.1.91713 WP_003401010.1.91716 WP_003401010.1.91717 WP_003401010.1.91728 WP_003401010.1.91743 WP_003401010.1.91759 WP_003401010.1.91784 WP_003401010.1.91785 WP_003401010.1.91786 WP_003401010.1.91802 WP_003401010.1.91822 WP_003401010.1.91828 WP_003401010.1.9189 WP_003401010.1.91896 WP_003401010.1.9190 WP_003401010.1.91915 WP_003401010.1.91931 WP_003401010.1.91937 WP_003401010.1.91944 WP_003401010.1.91953 WP_003401010.1.91957 WP_003401010.1.91976 WP_003401010.1.91978 WP_003401010.1.92021 WP_003401010.1.92083 WP_003401010.1.92127 WP_003401010.1.92144 WP_003401010.1.92150 WP_003401010.1.92153 WP_003401010.1.92190 WP_003401010.1.92192 WP_003401010.1.92200 WP_003401010.1.92220 WP_003401010.1.92221 WP_003401010.1.92222 WP_003401010.1.92273 WP_003401010.1.92289 WP_003401010.1.9229 WP_003401010.1.92294 WP_003401010.1.92300 WP_003401010.1.92317 WP_003401010.1.92334 WP_003401010.1.92338 WP_003401010.1.92345 WP_003401010.1.92356 WP_003401010.1.92364 WP_003401010.1.92380 WP_003401010.1.92416 WP_003401010.1.92428 WP_003401010.1.92447 WP_003401010.1.92456 WP_003401010.1.92467 WP_003401010.1.92471 WP_003401010.1.92490 WP_003401010.1.92508 WP_003401010.1.9251 WP_003401010.1.92511 WP_003401010.1.92523 WP_003401010.1.92527 WP_003401010.1.92536 WP_003401010.1.92592 WP_003401010.1.92597 WP_003401010.1.92603 WP_003401010.1.92606 WP_003401010.1.92610 WP_003401010.1.92613 WP_003401010.1.9263 WP_003401010.1.9265 WP_003401010.1.92650 WP_003401010.1.92660 WP_003401010.1.92677 WP_003401010.1.92685 WP_003401010.1.92689 WP_003401010.1.92690 WP_003401010.1.92706 WP_003401010.1.92714 WP_003401010.1.92736 WP_003401010.1.9274 WP_003401010.1.92752 WP_003401010.1.92760 WP_003401010.1.92777 WP_003401010.1.92803 WP_003401010.1.92833 WP_003401010.1.92856 WP_003401010.1.92881 WP_003401010.1.92892 WP_003401010.1.92907 WP_003401010.1.92908 WP_003401010.1.9291 WP_003401010.1.92917 WP_003401010.1.92996 WP_003401010.1.93006 WP_003401010.1.93009 WP_003401010.1.93015 WP_003401010.1.93043 WP_003401010.1.9307 WP_003401010.1.93083 WP_003401010.1.93097 WP_003401010.1.93137 WP_003401010.1.93192 WP_003401010.1.93199 WP_003401010.1.93203 WP_003401010.1.93212 WP_003401010.1.93234 WP_003401010.1.93245 WP_003401010.1.93257 WP_003401010.1.93265 WP_003401010.1.93297 WP_003401010.1.93320 WP_003401010.1.93328 WP_003401010.1.93337 WP_003401010.1.93343 WP_003401010.1.93349 WP_003401010.1.93363 WP_003401010.1.93377 WP_003401010.1.9338 WP_003401010.1.93407 WP_003401010.1.93417 WP_003401010.1.93419 WP_003401010.1.93426 WP_003401010.1.9344 WP_003401010.1.93443 WP_003401010.1.93447 WP_003401010.1.93470 WP_003401010.1.93483 WP_003401010.1.93487 WP_003401010.1.93495 WP_003401010.1.93499 WP_003401010.1.93516 WP_003401010.1.93536 WP_003401010.1.93544 WP_003401010.1.93555 WP_003401010.1.93560 WP_003401010.1.93564 WP_003401010.1.9357 WP_003401010.1.93573 WP_003401010.1.93576 WP_003401010.1.93588 WP_003401010.1.9363 WP_003401010.1.93645 WP_003401010.1.93649 WP_003401010.1.93659 WP_003401010.1.93677 WP_003401010.1.9368 WP_003401010.1.93689 WP_003401010.1.93693 WP_003401010.1.93698 WP_003401010.1.93706 WP_003401010.1.9371 WP_003401010.1.93792 WP_003401010.1.93823 WP_003401010.1.93871 WP_003401010.1.9388 WP_003401010.1.93894 WP_003401010.1.93903 WP_003401010.1.93907 WP_003401010.1.93913 WP_003401010.1.93946 WP_003401010.1.93950 WP_003401010.1.93953 WP_003401010.1.93954 WP_003401010.1.93988 WP_003401010.1.9407 WP_003401010.1.94143 WP_003401010.1.94154 WP_003401010.1.94204 WP_003401010.1.94205 WP_003401010.1.94226 WP_003401010.1.94231 WP_003401010.1.94256 WP_003401010.1.94261 WP_003401010.1.94281 WP_003401010.1.94292 WP_003401010.1.94297 WP_003401010.1.9431 WP_003401010.1.94326 WP_003401010.1.94339 WP_003401010.1.94392 WP_003401010.1.94416 WP_003401010.1.94421 WP_003401010.1.94456 WP_003401010.1.94470 WP_003401010.1.94480 WP_003401010.1.94495 WP_003401010.1.94511 WP_003401010.1.94512 WP_003401010.1.94525 WP_003401010.1.94528 WP_003401010.1.94564 WP_003401010.1.946 WP_003401010.1.94602 WP_003401010.1.94623 WP_003401010.1.94629 WP_003401010.1.9465 WP_003401010.1.94673 WP_003401010.1.94714 WP_003401010.1.94730 WP_003401010.1.94736 WP_003401010.1.94776 WP_003401010.1.9478 WP_003401010.1.94834 WP_003401010.1.94852 WP_003401010.1.94872 WP_003401010.1.94902 WP_003401010.1.94916 WP_003401010.1.94979 WP_003401010.1.94994 WP_003401010.1.94996 WP_003401010.1.94998 WP_003401010.1.95007 WP_003401010.1.95010 WP_003401010.1.95015 WP_003401010.1.95034 WP_003401010.1.95068 WP_003401010.1.95081 WP_003401010.1.95082 WP_003401010.1.9509 WP_003401010.1.95112 WP_003401010.1.95138 WP_003401010.1.9514 WP_003401010.1.95179 WP_003401010.1.95188 WP_003401010.1.95190 WP_003401010.1.95234 WP_003401010.1.95241 WP_003401010.1.95245 WP_003401010.1.95257 WP_003401010.1.95279 WP_003401010.1.9531 WP_003401010.1.95335 WP_003401010.1.95344 WP_003401010.1.9535 WP_003401010.1.95370 WP_003401010.1.95392 WP_003401010.1.95416 WP_003401010.1.95417 WP_003401010.1.95454 WP_003401010.1.95455 WP_003401010.1.95491 WP_003401010.1.95497 WP_003401010.1.95508 WP_003401010.1.95509 WP_003401010.1.95529 WP_003401010.1.95556 WP_003401010.1.95557 WP_003401010.1.95565 WP_003401010.1.95578 WP_003401010.1.95580 WP_003401010.1.95585 WP_003401010.1.95643 WP_003401010.1.95679 WP_003401010.1.95685 WP_003401010.1.957 WP_003401010.1.95724 WP_003401010.1.95727 WP_003401010.1.95730 WP_003401010.1.95735 WP_003401010.1.95758 WP_003401010.1.95772 WP_003401010.1.95797 WP_003401010.1.95839 WP_003401010.1.9585 WP_003401010.1.9590 WP_003401010.1.95902 WP_003401010.1.95924 WP_003401010.1.95926 WP_003401010.1.95953 WP_003401010.1.95958 WP_003401010.1.95964 WP_003401010.1.95973 WP_003401010.1.96006 WP_003401010.1.9602 WP_003401010.1.96036 WP_003401010.1.96062 WP_003401010.1.96065 WP_003401010.1.96098 WP_003401010.1.96146 WP_003401010.1.96166 WP_003401010.1.96171 WP_003401010.1.96182 WP_003401010.1.96230 WP_003401010.1.96235 WP_003401010.1.96242 WP_003401010.1.96245 WP_003401010.1.96254 WP_003401010.1.96259 WP_003401010.1.96286 WP_003401010.1.96313 WP_003401010.1.96345 WP_003401010.1.96360 WP_003401010.1.96373 WP_003401010.1.96456 WP_003401010.1.96486 WP_003401010.1.96560 WP_003401010.1.96569 WP_003401010.1.96573 WP_003401010.1.96575 WP_003401010.1.96576 WP_003401010.1.96611 WP_003401010.1.96621 WP_003401010.1.9667 WP_003401010.1.96681 WP_003401010.1.96726 WP_003401010.1.96733 WP_003401010.1.96742 WP_003401010.1.96754 WP_003401010.1.9678 WP_003401010.1.96832 WP_003401010.1.9685 WP_003401010.1.97008 WP_003401010.1.97009 WP_003401010.1.97056 WP_003401010.1.97084 WP_003401010.1.97087 WP_003401010.1.97094 WP_003401010.1.97096 WP_003401010.1.97099 WP_003401010.1.97108 WP_003401010.1.97113 WP_003401010.1.97122 WP_003401010.1.97127 WP_003401010.1.97129 WP_003401010.1.97136 WP_003401010.1.9716 WP_003401010.1.97176 WP_003401010.1.97222 WP_003401010.1.97223 WP_003401010.1.97237 WP_003401010.1.97242 WP_003401010.1.97270 WP_003401010.1.97283 WP_003401010.1.97296 WP_003401010.1.97321 WP_003401010.1.97325 WP_003401010.1.97366 WP_003401010.1.97376 WP_003401010.1.97380 WP_003401010.1.9739 WP_003401010.1.97462 WP_003401010.1.97517 WP_003401010.1.97519 WP_003401010.1.97535 WP_003401010.1.97540 WP_003401010.1.97545 WP_003401010.1.97546 WP_003401010.1.97550 WP_003401010.1.97577 WP_003401010.1.97584 WP_003401010.1.9759 WP_003401010.1.97591 WP_003401010.1.97609 WP_003401010.1.97618 WP_003401010.1.9763 WP_003401010.1.97669 WP_003401010.1.97673 WP_003401010.1.97700 WP_003401010.1.97701 WP_003401010.1.9773 WP_003401010.1.97730 WP_003401010.1.97740 WP_003401010.1.97751 WP_003401010.1.97754 WP_003401010.1.97797 WP_003401010.1.9782 WP_003401010.1.9784 WP_003401010.1.97888 WP_003401010.1.9795 WP_003401010.1.97951 WP_003401010.1.97958 WP_003401010.1.97966 WP_003401010.1.97977 WP_003401010.1.97979 WP_003401010.1.97995 WP_003401010.1.98018 WP_003401010.1.98034 WP_003401010.1.98052 WP_003401010.1.98071 WP_003401010.1.98072 WP_003401010.1.98113 WP_003401010.1.98114 WP_003401010.1.98128 WP_003401010.1.98181 WP_003401010.1.98188 WP_003401010.1.98189 WP_003401010.1.98213 WP_003401010.1.98225 WP_003401010.1.98291 WP_003401010.1.98335 WP_003401010.1.98350 WP_003401010.1.98395 WP_003401010.1.98412 WP_003401010.1.98441 WP_003401010.1.98443 WP_003401010.1.98462 WP_003401010.1.9848 WP_003401010.1.98482 WP_003401010.1.98486 WP_003401010.1.98488 WP_003401010.1.98503 WP_003401010.1.98516 WP_003401010.1.98524 WP_003401010.1.98536 WP_003401010.1.98541 WP_003401010.1.98566 WP_003401010.1.98576 WP_003401010.1.98590 WP_003401010.1.98594 WP_003401010.1.98599 WP_003401010.1.98629 WP_003401010.1.98645 WP_003401010.1.98646 WP_003401010.1.98649 WP_003401010.1.98656 WP_003401010.1.9867 WP_003401010.1.98674 WP_003401010.1.98697 WP_003401010.1.98701 WP_003401010.1.98739 WP_003401010.1.98749 WP_003401010.1.98765 WP_003401010.1.98770 WP_003401010.1.98777 WP_003401010.1.98778 WP_003401010.1.98802 WP_003401010.1.98838 WP_003401010.1.98850 WP_003401010.1.98906 WP_003401010.1.98935 WP_003401010.1.98948 WP_003401010.1.98953 WP_003401010.1.98984 WP_003401010.1.99000 WP_003401010.1.99023 WP_003401010.1.99030 WP_003401010.1.99055 WP_003401010.1.99062 WP_003401010.1.99086 WP_003401010.1.99115 WP_003401010.1.99117 WP_003401010.1.99161 WP_003401010.1.99176 WP_003401010.1.99205 WP_003401010.1.99211 WP_003401010.1.99216 WP_003401010.1.99222 WP_003401010.1.99251 WP_003401010.1.99294 WP_003401010.1.99312 WP_003401010.1.99315 WP_003401010.1.99316 WP_003401010.1.99322 WP_003401010.1.99328 WP_003401010.1.99365 WP_003401010.1.99368 WP_003401010.1.99379 WP_003401010.1.99396 WP_003401010.1.99402 WP_003401010.1.99404 WP_003401010.1.99419 WP_003401010.1.99438 WP_003401010.1.99460 WP_003401010.1.99468 WP_003401010.1.99473 WP_003401010.1.99513 WP_003401010.1.99529 WP_003401010.1.99548 WP_003401010.1.99572 WP_003401010.1.99575 WP_003401010.1.99578 WP_003401010.1.99605 WP_003401010.1.99609 WP_003401010.1.99617 WP_003401010.1.99635 WP_003401010.1.99650 WP_003401010.1.99672 WP_003401010.1.99701 WP_003401010.1.99711 WP_003401010.1.99716 WP_003401010.1.99740 WP_003401010.1.99745 WP_003401010.1.99749 WP_003401010.1.9976 WP_003401010.1.99798 WP_003401010.1.99817 WP_003401010.1.99832 WP_003401010.1.99847 WP_003401010.1.99852 WP_003401010.1.99886 WP_003401010.1.99897 WP_003401010.1.99899 WP_003401010.1.99915 WP_003401010.1.9993 WP_003401010.1.99982 WP_003401010.1.99991 gi|375294357|ref|YP_005098624.1| gi|197738133|ref|YP_002159449.1| gi|15607295|ref|NP_214667.1| gi|148659917|ref|YP_001281440.1| gi|253797073|ref|YP_003030074.1| gi|15839535|ref|NP_334572.1| IPRv0153cPALZ NYSGXRC-T519 Rv0153c rv0153c gi|339630235|ref|YP_004721877.1| gi|385989671|ref|YP_005907969.1| gi|494698531|ref|YP_007964013.1| gi|385996926|ref|YP_005915224.1| gi|383306088|ref|YP_005358899.1| gi|525673011|ref|YP_008224253.1| gi|392384873|ref|YP_005306502.1| gi|479054087|ref|YP_007349893.1| gi|15607295|ref|NP_214667.1| gi|471335958|ref|YP_007608671.1| gi|506924552|ref|YP_008005002.1| gi|148821345|ref|YP_001286099.1| 336982.TBFG_10154 419947.MRA_0161 478434.TBMG_00154 83331.MT0162 83332.Rv0153c gi|506924552|ref|YP_008005002.1| gi|479313002|ref|YP_007853054.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]