SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I6WY86 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I6WY86
Domain Number 1 Region: 6-174
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 3.25e-32
Family SCOPe 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I6WY86
Sequence length 197
Comment (tr|I6WY86|I6WY86_MYCTU) Uncharacterized protein {ECO:0000313|EMBL:CCP43101.1} KW=Complete proteome; Reference proteome OX=83332 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv). GN=Rv0371c OC=Mycobacterium; Mycobacterium tuberculosis complex.
Sequence
MTATQITGVVLAAGRSNRLGTPKQLLPYRDTTVLGATLDVARQAGFDQLILTLGGAASAV
RAAMALDGTDVVVVEDVERGCAASLRVALARVHPRATGIVLMLGDQPQVAPATLRRIIDV
GPATEIMVCRYADGVGHPFWFSRTVFGELARLHGDKGVWKLVHSGRHPVRELAVDGCVPL
DVDTWDDYRRLLESVPS
Download sequence
Identical sequences A0A045JTQ7 A0A083WH29 A0A0H3L9C0 A0A0H3M219 A0A0K2HRT5 A0A109SKD2 A0A109STL6 A0A197IXD6 A0A1R3XV43 A0A1S1BAY3 A5TZ98 F8M144 I6WY86 L0T3H0 M8CS85 O53706
gi|479313225|ref|YP_007853277.1| MbR185 gi|15839757|ref|NP_334794.1| gi|471336191|ref|YP_007608904.1| gi|383306292|ref|YP_005359103.1| gi|148660137|ref|YP_001281660.1| gi|378770117|ref|YP_005169850.1| gi|224988756|ref|YP_002643443.1| gi|506924773|ref|YP_008005223.1| gi|392385089|ref|YP_005306718.1| gi|392430789|ref|YP_006471833.1| gi|121636284|ref|YP_976507.1| gi|449062366|ref|YP_007429449.1| gi|479054309|ref|YP_007350115.1| 2we9_A 2we9_B 2wee_A 2wee_B 2yes_A 2yes_B gi|506924773|ref|YP_008005223.1| gi|385989878|ref|YP_005908176.1| gi|148821567|ref|YP_001286321.1| gi|494698743|ref|YP_007964225.1| gi|253797297|ref|YP_003030298.1| gi|386003428|ref|YP_005921707.1| gi|385997145|ref|YP_005915443.1| gi|31791548|ref|NP_854041.1| NP_214885.1.84033 WP_003401864.1.100021 WP_003401864.1.100069 WP_003401864.1.100087 WP_003401864.1.10015 WP_003401864.1.100208 WP_003401864.1.100216 WP_003401864.1.10022 WP_003401864.1.100255 WP_003401864.1.100260 WP_003401864.1.100270 WP_003401864.1.100279 WP_003401864.1.100286 WP_003401864.1.100308 WP_003401864.1.100309 WP_003401864.1.100318 WP_003401864.1.100337 WP_003401864.1.100338 WP_003401864.1.10037 WP_003401864.1.100383 WP_003401864.1.100395 WP_003401864.1.100396 WP_003401864.1.100401 WP_003401864.1.100459 WP_003401864.1.100460 WP_003401864.1.100552 WP_003401864.1.100581 WP_003401864.1.100600 WP_003401864.1.100625 WP_003401864.1.10064 WP_003401864.1.100666 WP_003401864.1.100671 WP_003401864.1.100677 WP_003401864.1.100682 WP_003401864.1.100697 WP_003401864.1.100703 WP_003401864.1.100716 WP_003401864.1.100722 WP_003401864.1.100754 WP_003401864.1.100772 WP_003401864.1.1008 WP_003401864.1.100812 WP_003401864.1.100845 WP_003401864.1.100866 WP_003401864.1.10088 WP_003401864.1.100889 WP_003401864.1.10090 WP_003401864.1.100910 WP_003401864.1.100915 WP_003401864.1.100918 WP_003401864.1.100935 WP_003401864.1.100984 WP_003401864.1.100992 WP_003401864.1.100998 WP_003401864.1.101 WP_003401864.1.101025 WP_003401864.1.101028 WP_003401864.1.10104 WP_003401864.1.101048 WP_003401864.1.101054 WP_003401864.1.101075 WP_003401864.1.101143 WP_003401864.1.101146 WP_003401864.1.10116 WP_003401864.1.10117 WP_003401864.1.101209 WP_003401864.1.10125 WP_003401864.1.101290 WP_003401864.1.101323 WP_003401864.1.101324 WP_003401864.1.101350 WP_003401864.1.101367 WP_003401864.1.101398 WP_003401864.1.101403 WP_003401864.1.101421 WP_003401864.1.10144 WP_003401864.1.101442 WP_003401864.1.101452 WP_003401864.1.101456 WP_003401864.1.101481 WP_003401864.1.101493 WP_003401864.1.101496 WP_003401864.1.101525 WP_003401864.1.101533 WP_003401864.1.101535 WP_003401864.1.101553 WP_003401864.1.101558 WP_003401864.1.10156 WP_003401864.1.101573 WP_003401864.1.101576 WP_003401864.1.10159 WP_003401864.1.101592 WP_003401864.1.101604 WP_003401864.1.101607 WP_003401864.1.101622 WP_003401864.1.101644 WP_003401864.1.101659 WP_003401864.1.101671 WP_003401864.1.101687 WP_003401864.1.101698 WP_003401864.1.10170 WP_003401864.1.101713 WP_003401864.1.101722 WP_003401864.1.101733 WP_003401864.1.101743 WP_003401864.1.101753 WP_003401864.1.101754 WP_003401864.1.101764 WP_003401864.1.101773 WP_003401864.1.101795 WP_003401864.1.101797 WP_003401864.1.101798 WP_003401864.1.101802 WP_003401864.1.101826 WP_003401864.1.101836 WP_003401864.1.101858 WP_003401864.1.101862 WP_003401864.1.101888 WP_003401864.1.101894 WP_003401864.1.101899 WP_003401864.1.1019 WP_003401864.1.101923 WP_003401864.1.101925 WP_003401864.1.10193 WP_003401864.1.101996 WP_003401864.1.102 WP_003401864.1.102017 WP_003401864.1.102053 WP_003401864.1.102055 WP_003401864.1.102063 WP_003401864.1.102099 WP_003401864.1.1021 WP_003401864.1.102119 WP_003401864.1.102121 WP_003401864.1.102143 WP_003401864.1.10216 WP_003401864.1.10224 WP_003401864.1.10253 WP_003401864.1.10262 WP_003401864.1.10272 WP_003401864.1.10277 WP_003401864.1.1033 WP_003401864.1.10350 WP_003401864.1.10362 WP_003401864.1.10366 WP_003401864.1.10376 WP_003401864.1.10396 WP_003401864.1.10410 WP_003401864.1.10421 WP_003401864.1.10430 WP_003401864.1.1044 WP_003401864.1.10440 WP_003401864.1.10445 WP_003401864.1.10471 WP_003401864.1.10472 WP_003401864.1.10489 WP_003401864.1.105 WP_003401864.1.10518 WP_003401864.1.10523 WP_003401864.1.10545 WP_003401864.1.1057 WP_003401864.1.10594 WP_003401864.1.10603 WP_003401864.1.10615 WP_003401864.1.10623 WP_003401864.1.10635 WP_003401864.1.10643 WP_003401864.1.10648 WP_003401864.1.10662 WP_003401864.1.10709 WP_003401864.1.10735 WP_003401864.1.10740 WP_003401864.1.10756 WP_003401864.1.1078 WP_003401864.1.10791 WP_003401864.1.10799 WP_003401864.1.10825 WP_003401864.1.10848 WP_003401864.1.10863 WP_003401864.1.10879 WP_003401864.1.10912 WP_003401864.1.10916 WP_003401864.1.10923 WP_003401864.1.10927 WP_003401864.1.1095 WP_003401864.1.10956 WP_003401864.1.10958 WP_003401864.1.10962 WP_003401864.1.10980 WP_003401864.1.10981 WP_003401864.1.10993 WP_003401864.1.1100 WP_003401864.1.11040 WP_003401864.1.11070 WP_003401864.1.11141 WP_003401864.1.11171 WP_003401864.1.11175 WP_003401864.1.11222 WP_003401864.1.11236 WP_003401864.1.11329 WP_003401864.1.1133 WP_003401864.1.11342 WP_003401864.1.11373 WP_003401864.1.11376 WP_003401864.1.11390 WP_003401864.1.11402 WP_003401864.1.11481 WP_003401864.1.11487 WP_003401864.1.11489 WP_003401864.1.11491 WP_003401864.1.11514 WP_003401864.1.11587 WP_003401864.1.11589 WP_003401864.1.11596 WP_003401864.1.11604 WP_003401864.1.11610 WP_003401864.1.11697 WP_003401864.1.11707 WP_003401864.1.11752 WP_003401864.1.11758 WP_003401864.1.11761 WP_003401864.1.11775 WP_003401864.1.11804 WP_003401864.1.11822 WP_003401864.1.11826 WP_003401864.1.11856 WP_003401864.1.11898 WP_003401864.1.11906 WP_003401864.1.11939 WP_003401864.1.11960 WP_003401864.1.11961 WP_003401864.1.11972 WP_003401864.1.11984 WP_003401864.1.120 WP_003401864.1.12001 WP_003401864.1.12049 WP_003401864.1.12052 WP_003401864.1.12100 WP_003401864.1.12116 WP_003401864.1.12130 WP_003401864.1.12133 WP_003401864.1.12161 WP_003401864.1.12165 WP_003401864.1.12187 WP_003401864.1.12190 WP_003401864.1.12216 WP_003401864.1.12265 WP_003401864.1.12275 WP_003401864.1.12293 WP_003401864.1.12294 WP_003401864.1.123 WP_003401864.1.1231 WP_003401864.1.12314 WP_003401864.1.12327 WP_003401864.1.12338 WP_003401864.1.1236 WP_003401864.1.12371 WP_003401864.1.12372 WP_003401864.1.12389 WP_003401864.1.1241 WP_003401864.1.12421 WP_003401864.1.12424 WP_003401864.1.12446 WP_003401864.1.12464 WP_003401864.1.12479 WP_003401864.1.12519 WP_003401864.1.12523 WP_003401864.1.12526 WP_003401864.1.1255 WP_003401864.1.12550 WP_003401864.1.12551 WP_003401864.1.12563 WP_003401864.1.12611 WP_003401864.1.12669 WP_003401864.1.1267 WP_003401864.1.12672 WP_003401864.1.12692 WP_003401864.1.1271 WP_003401864.1.12710 WP_003401864.1.12768 WP_003401864.1.1279 WP_003401864.1.12794 WP_003401864.1.12801 WP_003401864.1.12804 WP_003401864.1.12821 WP_003401864.1.12841 WP_003401864.1.12854 WP_003401864.1.12871 WP_003401864.1.12901 WP_003401864.1.12941 WP_003401864.1.12947 WP_003401864.1.12957 WP_003401864.1.12972 WP_003401864.1.13043 WP_003401864.1.13086 WP_003401864.1.13087 WP_003401864.1.13090 WP_003401864.1.13096 WP_003401864.1.13163 WP_003401864.1.13175 WP_003401864.1.13183 WP_003401864.1.132 WP_003401864.1.13249 WP_003401864.1.13282 WP_003401864.1.13284 WP_003401864.1.13298 WP_003401864.1.13302 WP_003401864.1.13306 WP_003401864.1.13312 WP_003401864.1.13313 WP_003401864.1.13321 WP_003401864.1.13345 WP_003401864.1.13358 WP_003401864.1.13370 WP_003401864.1.13375 WP_003401864.1.1338 WP_003401864.1.13420 WP_003401864.1.13433 WP_003401864.1.13435 WP_003401864.1.13438 WP_003401864.1.13461 WP_003401864.1.13466 WP_003401864.1.13489 WP_003401864.1.13526 WP_003401864.1.13551 WP_003401864.1.13561 WP_003401864.1.13564 WP_003401864.1.13579 WP_003401864.1.13647 WP_003401864.1.13687 WP_003401864.1.13697 WP_003401864.1.13719 WP_003401864.1.1377 WP_003401864.1.13774 WP_003401864.1.13786 WP_003401864.1.13793 WP_003401864.1.13794 WP_003401864.1.13817 WP_003401864.1.13834 WP_003401864.1.13866 WP_003401864.1.13880 WP_003401864.1.13899 WP_003401864.1.13909 WP_003401864.1.13910 WP_003401864.1.13919 WP_003401864.1.13920 WP_003401864.1.13952 WP_003401864.1.13953 WP_003401864.1.13962 WP_003401864.1.13988 WP_003401864.1.14027 WP_003401864.1.14046 WP_003401864.1.14115 WP_003401864.1.1415 WP_003401864.1.14152 WP_003401864.1.14158 WP_003401864.1.14162 WP_003401864.1.14178 WP_003401864.1.14194 WP_003401864.1.14195 WP_003401864.1.14208 WP_003401864.1.14238 WP_003401864.1.14266 WP_003401864.1.14273 WP_003401864.1.14303 WP_003401864.1.14306 WP_003401864.1.14307 WP_003401864.1.14310 WP_003401864.1.14341 WP_003401864.1.14382 WP_003401864.1.14416 WP_003401864.1.14428 WP_003401864.1.14469 WP_003401864.1.14477 WP_003401864.1.14504 WP_003401864.1.14514 WP_003401864.1.1452 WP_003401864.1.14527 WP_003401864.1.1454 WP_003401864.1.14544 WP_003401864.1.14548 WP_003401864.1.14551 WP_003401864.1.14561 WP_003401864.1.14573 WP_003401864.1.1462 WP_003401864.1.14658 WP_003401864.1.14667 WP_003401864.1.14675 WP_003401864.1.14694 WP_003401864.1.14695 WP_003401864.1.14709 WP_003401864.1.14766 WP_003401864.1.14783 WP_003401864.1.14865 WP_003401864.1.14872 WP_003401864.1.14926 WP_003401864.1.14951 WP_003401864.1.15003 WP_003401864.1.15009 WP_003401864.1.15028 WP_003401864.1.15040 WP_003401864.1.15052 WP_003401864.1.15065 WP_003401864.1.15072 WP_003401864.1.15089 WP_003401864.1.15131 WP_003401864.1.15168 WP_003401864.1.15172 WP_003401864.1.15174 WP_003401864.1.15187 WP_003401864.1.15196 WP_003401864.1.15210 WP_003401864.1.15216 WP_003401864.1.15217 WP_003401864.1.1523 WP_003401864.1.15232 WP_003401864.1.15238 WP_003401864.1.15240 WP_003401864.1.15253 WP_003401864.1.15267 WP_003401864.1.1527 WP_003401864.1.15292 WP_003401864.1.15299 WP_003401864.1.15302 WP_003401864.1.1534 WP_003401864.1.15345 WP_003401864.1.15365 WP_003401864.1.15372 WP_003401864.1.15387 WP_003401864.1.15442 WP_003401864.1.15447 WP_003401864.1.15449 WP_003401864.1.15477 WP_003401864.1.15481 WP_003401864.1.15492 WP_003401864.1.15512 WP_003401864.1.15558 WP_003401864.1.15559 WP_003401864.1.15566 WP_003401864.1.1560 WP_003401864.1.15611 WP_003401864.1.1563 WP_003401864.1.15643 WP_003401864.1.15688 WP_003401864.1.15755 WP_003401864.1.15763 WP_003401864.1.15774 WP_003401864.1.1578 WP_003401864.1.15780 WP_003401864.1.15827 WP_003401864.1.15834 WP_003401864.1.15842 WP_003401864.1.15848 WP_003401864.1.15853 WP_003401864.1.15870 WP_003401864.1.15877 WP_003401864.1.15893 WP_003401864.1.15896 WP_003401864.1.15926 WP_003401864.1.15933 WP_003401864.1.15946 WP_003401864.1.15958 WP_003401864.1.15987 WP_003401864.1.15993 WP_003401864.1.16009 WP_003401864.1.16025 WP_003401864.1.16043 WP_003401864.1.16055 WP_003401864.1.16066 WP_003401864.1.16069 WP_003401864.1.16106 WP_003401864.1.16108 WP_003401864.1.16110 WP_003401864.1.16130 WP_003401864.1.16136 WP_003401864.1.16139 WP_003401864.1.16141 WP_003401864.1.16143 WP_003401864.1.1630 WP_003401864.1.16318 WP_003401864.1.1632 WP_003401864.1.16334 WP_003401864.1.16341 WP_003401864.1.16345 WP_003401864.1.16384 WP_003401864.1.16386 WP_003401864.1.164 WP_003401864.1.1642 WP_003401864.1.16421 WP_003401864.1.16424 WP_003401864.1.16426 WP_003401864.1.16431 WP_003401864.1.16438 WP_003401864.1.1644 WP_003401864.1.16442 WP_003401864.1.16451 WP_003401864.1.16476 WP_003401864.1.16480 WP_003401864.1.16494 WP_003401864.1.1652 WP_003401864.1.16549 WP_003401864.1.16560 WP_003401864.1.16598 WP_003401864.1.16609 WP_003401864.1.16619 WP_003401864.1.16620 WP_003401864.1.16637 WP_003401864.1.1669 WP_003401864.1.16707 WP_003401864.1.16724 WP_003401864.1.16743 WP_003401864.1.1683 WP_003401864.1.16837 WP_003401864.1.16852 WP_003401864.1.16937 WP_003401864.1.16940 WP_003401864.1.16950 WP_003401864.1.16959 WP_003401864.1.16968 WP_003401864.1.1697 WP_003401864.1.16973 WP_003401864.1.16977 WP_003401864.1.16987 WP_003401864.1.17005 WP_003401864.1.17010 WP_003401864.1.17015 WP_003401864.1.17019 WP_003401864.1.17039 WP_003401864.1.17041 WP_003401864.1.17052 WP_003401864.1.17057 WP_003401864.1.17062 WP_003401864.1.1707 WP_003401864.1.17094 WP_003401864.1.17130 WP_003401864.1.17138 WP_003401864.1.17147 WP_003401864.1.17167 WP_003401864.1.17224 WP_003401864.1.17251 WP_003401864.1.17288 WP_003401864.1.17304 WP_003401864.1.17314 WP_003401864.1.17381 WP_003401864.1.17391 WP_003401864.1.17412 WP_003401864.1.1743 WP_003401864.1.17440 WP_003401864.1.17466 WP_003401864.1.17483 WP_003401864.1.17505 WP_003401864.1.17527 WP_003401864.1.17535 WP_003401864.1.17540 WP_003401864.1.17553 WP_003401864.1.17558 WP_003401864.1.17599 WP_003401864.1.17635 WP_003401864.1.17655 WP_003401864.1.17679 WP_003401864.1.1768 WP_003401864.1.17687 WP_003401864.1.17700 WP_003401864.1.17710 WP_003401864.1.17713 WP_003401864.1.17722 WP_003401864.1.17746 WP_003401864.1.17788 WP_003401864.1.17798 WP_003401864.1.17803 WP_003401864.1.17816 WP_003401864.1.17821 WP_003401864.1.17830 WP_003401864.1.17868 WP_003401864.1.17878 WP_003401864.1.1792 WP_003401864.1.17923 WP_003401864.1.1795 WP_003401864.1.17955 WP_003401864.1.17973 WP_003401864.1.18009 WP_003401864.1.18013 WP_003401864.1.18033 WP_003401864.1.18057 WP_003401864.1.18065 WP_003401864.1.18070 WP_003401864.1.18116 WP_003401864.1.18120 WP_003401864.1.18126 WP_003401864.1.1817 WP_003401864.1.18170 WP_003401864.1.18206 WP_003401864.1.18216 WP_003401864.1.18240 WP_003401864.1.18257 WP_003401864.1.18297 WP_003401864.1.18364 WP_003401864.1.18411 WP_003401864.1.18444 WP_003401864.1.18448 WP_003401864.1.18467 WP_003401864.1.18476 WP_003401864.1.18522 WP_003401864.1.18580 WP_003401864.1.18587 WP_003401864.1.186 WP_003401864.1.18601 WP_003401864.1.18639 WP_003401864.1.18646 WP_003401864.1.1868 WP_003401864.1.18694 WP_003401864.1.18751 WP_003401864.1.18781 WP_003401864.1.18793 WP_003401864.1.18804 WP_003401864.1.18816 WP_003401864.1.18823 WP_003401864.1.18827 WP_003401864.1.18838 WP_003401864.1.18849 WP_003401864.1.18856 WP_003401864.1.18945 WP_003401864.1.1898 WP_003401864.1.19005 WP_003401864.1.19056 WP_003401864.1.19063 WP_003401864.1.19066 WP_003401864.1.19071 WP_003401864.1.19085 WP_003401864.1.19144 WP_003401864.1.19159 WP_003401864.1.19193 WP_003401864.1.19231 WP_003401864.1.19243 WP_003401864.1.19264 WP_003401864.1.19295 WP_003401864.1.19307 WP_003401864.1.19326 WP_003401864.1.1933 WP_003401864.1.19382 WP_003401864.1.19400 WP_003401864.1.19426 WP_003401864.1.19464 WP_003401864.1.19480 WP_003401864.1.19512 WP_003401864.1.19553 WP_003401864.1.19562 WP_003401864.1.19564 WP_003401864.1.19568 WP_003401864.1.19572 WP_003401864.1.19595 WP_003401864.1.19596 WP_003401864.1.19600 WP_003401864.1.19630 WP_003401864.1.1967 WP_003401864.1.1970 WP_003401864.1.19707 WP_003401864.1.19742 WP_003401864.1.19785 WP_003401864.1.19820 WP_003401864.1.19868 WP_003401864.1.19874 WP_003401864.1.19890 WP_003401864.1.19900 WP_003401864.1.19922 WP_003401864.1.19936 WP_003401864.1.19946 WP_003401864.1.19949 WP_003401864.1.19960 WP_003401864.1.19964 WP_003401864.1.20007 WP_003401864.1.20016 WP_003401864.1.20028 WP_003401864.1.2003 WP_003401864.1.20085 WP_003401864.1.20097 WP_003401864.1.20130 WP_003401864.1.20140 WP_003401864.1.20141 WP_003401864.1.20142 WP_003401864.1.20158 WP_003401864.1.20239 WP_003401864.1.20243 WP_003401864.1.20259 WP_003401864.1.20262 WP_003401864.1.20268 WP_003401864.1.20272 WP_003401864.1.20273 WP_003401864.1.20280 WP_003401864.1.20294 WP_003401864.1.20300 WP_003401864.1.20309 WP_003401864.1.20322 WP_003401864.1.2037 WP_003401864.1.20372 WP_003401864.1.204 WP_003401864.1.20427 WP_003401864.1.20432 WP_003401864.1.20457 WP_003401864.1.20459 WP_003401864.1.20460 WP_003401864.1.20578 WP_003401864.1.20608 WP_003401864.1.20628 WP_003401864.1.2066 WP_003401864.1.20707 WP_003401864.1.20722 WP_003401864.1.20729 WP_003401864.1.20742 WP_003401864.1.20751 WP_003401864.1.20776 WP_003401864.1.20843 WP_003401864.1.20850 WP_003401864.1.2086 WP_003401864.1.20868 WP_003401864.1.20876 WP_003401864.1.20897 WP_003401864.1.20898 WP_003401864.1.2090 WP_003401864.1.20911 WP_003401864.1.20916 WP_003401864.1.20921 WP_003401864.1.20926 WP_003401864.1.20927 WP_003401864.1.20951 WP_003401864.1.20970 WP_003401864.1.2104 WP_003401864.1.21070 WP_003401864.1.21127 WP_003401864.1.21135 WP_003401864.1.21173 WP_003401864.1.212 WP_003401864.1.2120 WP_003401864.1.21218 WP_003401864.1.21219 WP_003401864.1.21231 WP_003401864.1.21234 WP_003401864.1.2126 WP_003401864.1.21292 WP_003401864.1.21307 WP_003401864.1.2131 WP_003401864.1.21311 WP_003401864.1.21321 WP_003401864.1.21365 WP_003401864.1.2137 WP_003401864.1.21392 WP_003401864.1.21397 WP_003401864.1.21403 WP_003401864.1.21415 WP_003401864.1.21418 WP_003401864.1.21430 WP_003401864.1.21434 WP_003401864.1.21444 WP_003401864.1.21468 WP_003401864.1.21498 WP_003401864.1.21513 WP_003401864.1.21560 WP_003401864.1.21565 WP_003401864.1.21586 WP_003401864.1.21591 WP_003401864.1.21594 WP_003401864.1.21602 WP_003401864.1.21615 WP_003401864.1.21638 WP_003401864.1.21639 WP_003401864.1.21658 WP_003401864.1.21741 WP_003401864.1.21742 WP_003401864.1.21777 WP_003401864.1.21795 WP_003401864.1.218 WP_003401864.1.21826 WP_003401864.1.21829 WP_003401864.1.21843 WP_003401864.1.21872 WP_003401864.1.21873 WP_003401864.1.2188 WP_003401864.1.21882 WP_003401864.1.21906 WP_003401864.1.21912 WP_003401864.1.2194 WP_003401864.1.21941 WP_003401864.1.21956 WP_003401864.1.21958 WP_003401864.1.21960 WP_003401864.1.21971 WP_003401864.1.21973 WP_003401864.1.21983 WP_003401864.1.22003 WP_003401864.1.22013 WP_003401864.1.22025 WP_003401864.1.22036 WP_003401864.1.22075 WP_003401864.1.22092 WP_003401864.1.2212 WP_003401864.1.22127 WP_003401864.1.22140 WP_003401864.1.22233 WP_003401864.1.22255 WP_003401864.1.22277 WP_003401864.1.22305 WP_003401864.1.22348 WP_003401864.1.22356 WP_003401864.1.22366 WP_003401864.1.2238 WP_003401864.1.22380 WP_003401864.1.22437 WP_003401864.1.22438 WP_003401864.1.22445 WP_003401864.1.22490 WP_003401864.1.22511 WP_003401864.1.22524 WP_003401864.1.2253 WP_003401864.1.22585 WP_003401864.1.22589 WP_003401864.1.22606 WP_003401864.1.22608 WP_003401864.1.22609 WP_003401864.1.22618 WP_003401864.1.2262 WP_003401864.1.22624 WP_003401864.1.22629 WP_003401864.1.22647 WP_003401864.1.22664 WP_003401864.1.22665 WP_003401864.1.22670 WP_003401864.1.22674 WP_003401864.1.22680 WP_003401864.1.22725 WP_003401864.1.22728 WP_003401864.1.22737 WP_003401864.1.2275 WP_003401864.1.22754 WP_003401864.1.22797 WP_003401864.1.22800 WP_003401864.1.22804 WP_003401864.1.22829 WP_003401864.1.22840 WP_003401864.1.22844 WP_003401864.1.22963 WP_003401864.1.22970 WP_003401864.1.22996 WP_003401864.1.22997 WP_003401864.1.23032 WP_003401864.1.23101 WP_003401864.1.2312 WP_003401864.1.23140 WP_003401864.1.23153 WP_003401864.1.23199 WP_003401864.1.2320 WP_003401864.1.23204 WP_003401864.1.23216 WP_003401864.1.23229 WP_003401864.1.23233 WP_003401864.1.2326 WP_003401864.1.23261 WP_003401864.1.23272 WP_003401864.1.23289 WP_003401864.1.2329 WP_003401864.1.23308 WP_003401864.1.23325 WP_003401864.1.2339 WP_003401864.1.23406 WP_003401864.1.23438 WP_003401864.1.23445 WP_003401864.1.23447 WP_003401864.1.23452 WP_003401864.1.23461 WP_003401864.1.2349 WP_003401864.1.23496 WP_003401864.1.23497 WP_003401864.1.23506 WP_003401864.1.23530 WP_003401864.1.23539 WP_003401864.1.23546 WP_003401864.1.23551 WP_003401864.1.23583 WP_003401864.1.23588 WP_003401864.1.23628 WP_003401864.1.23677 WP_003401864.1.23683 WP_003401864.1.23692 WP_003401864.1.23694 WP_003401864.1.23699 WP_003401864.1.2371 WP_003401864.1.23803 WP_003401864.1.23807 WP_003401864.1.23825 WP_003401864.1.23832 WP_003401864.1.2384 WP_003401864.1.23843 WP_003401864.1.23863 WP_003401864.1.2387 WP_003401864.1.23894 WP_003401864.1.23993 WP_003401864.1.2400 WP_003401864.1.24007 WP_003401864.1.24008 WP_003401864.1.24057 WP_003401864.1.24062 WP_003401864.1.24113 WP_003401864.1.24119 WP_003401864.1.24128 WP_003401864.1.24140 WP_003401864.1.24176 WP_003401864.1.24190 WP_003401864.1.24202 WP_003401864.1.24244 WP_003401864.1.24261 WP_003401864.1.24294 WP_003401864.1.24357 WP_003401864.1.24396 WP_003401864.1.24414 WP_003401864.1.24423 WP_003401864.1.2443 WP_003401864.1.24446 WP_003401864.1.24461 WP_003401864.1.24500 WP_003401864.1.24507 WP_003401864.1.24509 WP_003401864.1.24529 WP_003401864.1.24553 WP_003401864.1.24599 WP_003401864.1.24629 WP_003401864.1.24638 WP_003401864.1.24648 WP_003401864.1.2466 WP_003401864.1.24767 WP_003401864.1.24824 WP_003401864.1.24831 WP_003401864.1.24840 WP_003401864.1.24848 WP_003401864.1.24857 WP_003401864.1.2487 WP_003401864.1.24893 WP_003401864.1.24907 WP_003401864.1.24933 WP_003401864.1.24985 WP_003401864.1.2499 WP_003401864.1.25004 WP_003401864.1.2505 WP_003401864.1.25051 WP_003401864.1.2507 WP_003401864.1.25096 WP_003401864.1.25103 WP_003401864.1.25171 WP_003401864.1.25184 WP_003401864.1.25247 WP_003401864.1.25252 WP_003401864.1.25283 WP_003401864.1.25309 WP_003401864.1.25313 WP_003401864.1.25338 WP_003401864.1.25342 WP_003401864.1.25343 WP_003401864.1.25367 WP_003401864.1.25393 WP_003401864.1.25406 WP_003401864.1.25435 WP_003401864.1.25437 WP_003401864.1.25445 WP_003401864.1.25455 WP_003401864.1.25504 WP_003401864.1.25513 WP_003401864.1.25542 WP_003401864.1.25579 WP_003401864.1.25594 WP_003401864.1.25606 WP_003401864.1.25645 WP_003401864.1.2566 WP_003401864.1.25673 WP_003401864.1.25674 WP_003401864.1.25693 WP_003401864.1.25699 WP_003401864.1.25727 WP_003401864.1.25736 WP_003401864.1.25738 WP_003401864.1.25756 WP_003401864.1.25759 WP_003401864.1.2580 WP_003401864.1.25813 WP_003401864.1.25853 WP_003401864.1.25854 WP_003401864.1.25874 WP_003401864.1.25892 WP_003401864.1.25906 WP_003401864.1.25914 WP_003401864.1.25916 WP_003401864.1.2594 WP_003401864.1.25954 WP_003401864.1.25965 WP_003401864.1.25972 WP_003401864.1.26017 WP_003401864.1.26032 WP_003401864.1.26038 WP_003401864.1.26072 WP_003401864.1.26089 WP_003401864.1.26097 WP_003401864.1.26098 WP_003401864.1.26108 WP_003401864.1.26109 WP_003401864.1.26118 WP_003401864.1.2614 WP_003401864.1.26168 WP_003401864.1.26182 WP_003401864.1.26190 WP_003401864.1.2620 WP_003401864.1.26234 WP_003401864.1.26243 WP_003401864.1.26265 WP_003401864.1.26267 WP_003401864.1.26292 WP_003401864.1.26310 WP_003401864.1.26328 WP_003401864.1.26349 WP_003401864.1.26366 WP_003401864.1.26407 WP_003401864.1.26412 WP_003401864.1.26454 WP_003401864.1.26464 WP_003401864.1.2653 WP_003401864.1.26560 WP_003401864.1.26571 WP_003401864.1.2659 WP_003401864.1.26597 WP_003401864.1.26603 WP_003401864.1.26629 WP_003401864.1.26651 WP_003401864.1.26702 WP_003401864.1.26707 WP_003401864.1.26710 WP_003401864.1.26719 WP_003401864.1.26737 WP_003401864.1.26738 WP_003401864.1.26745 WP_003401864.1.26756 WP_003401864.1.2676 WP_003401864.1.2677 WP_003401864.1.26779 WP_003401864.1.26780 WP_003401864.1.26798 WP_003401864.1.26854 WP_003401864.1.26868 WP_003401864.1.26876 WP_003401864.1.26888 WP_003401864.1.26914 WP_003401864.1.26945 WP_003401864.1.26959 WP_003401864.1.26969 WP_003401864.1.26984 WP_003401864.1.26992 WP_003401864.1.27004 WP_003401864.1.27017 WP_003401864.1.27045 WP_003401864.1.27074 WP_003401864.1.27075 WP_003401864.1.27128 WP_003401864.1.27130 WP_003401864.1.27139 WP_003401864.1.27152 WP_003401864.1.27162 WP_003401864.1.27164 WP_003401864.1.27193 WP_003401864.1.27235 WP_003401864.1.27254 WP_003401864.1.27278 WP_003401864.1.27343 WP_003401864.1.27352 WP_003401864.1.27391 WP_003401864.1.27398 WP_003401864.1.27402 WP_003401864.1.27460 WP_003401864.1.27463 WP_003401864.1.2749 WP_003401864.1.27492 WP_003401864.1.27528 WP_003401864.1.27541 WP_003401864.1.27576 WP_003401864.1.27582 WP_003401864.1.27596 WP_003401864.1.27607 WP_003401864.1.2766 WP_003401864.1.277 WP_003401864.1.27724 WP_003401864.1.27730 WP_003401864.1.27736 WP_003401864.1.27750 WP_003401864.1.27771 WP_003401864.1.27779 WP_003401864.1.27795 WP_003401864.1.27803 WP_003401864.1.27819 WP_003401864.1.27835 WP_003401864.1.27962 WP_003401864.1.28053 WP_003401864.1.28092 WP_003401864.1.28106 WP_003401864.1.28131 WP_003401864.1.28142 WP_003401864.1.28159 WP_003401864.1.2816 WP_003401864.1.28161 WP_003401864.1.28192 WP_003401864.1.28202 WP_003401864.1.28241 WP_003401864.1.28242 WP_003401864.1.28251 WP_003401864.1.28255 WP_003401864.1.28269 WP_003401864.1.28276 WP_003401864.1.28331 WP_003401864.1.28367 WP_003401864.1.28378 WP_003401864.1.28391 WP_003401864.1.2842 WP_003401864.1.28448 WP_003401864.1.2847 WP_003401864.1.28471 WP_003401864.1.28473 WP_003401864.1.28493 WP_003401864.1.28497 WP_003401864.1.28530 WP_003401864.1.28545 WP_003401864.1.28561 WP_003401864.1.28567 WP_003401864.1.28585 WP_003401864.1.286 WP_003401864.1.28610 WP_003401864.1.28617 WP_003401864.1.28634 WP_003401864.1.28642 WP_003401864.1.28671 WP_003401864.1.28682 WP_003401864.1.28698 WP_003401864.1.28703 WP_003401864.1.28739 WP_003401864.1.28758 WP_003401864.1.28787 WP_003401864.1.28827 WP_003401864.1.28839 WP_003401864.1.28847 WP_003401864.1.28850 WP_003401864.1.28851 WP_003401864.1.28865 WP_003401864.1.28897 WP_003401864.1.28935 WP_003401864.1.28936 WP_003401864.1.28939 WP_003401864.1.28943 WP_003401864.1.28952 WP_003401864.1.28975 WP_003401864.1.2899 WP_003401864.1.28993 WP_003401864.1.29000 WP_003401864.1.2901 WP_003401864.1.29028 WP_003401864.1.29033 WP_003401864.1.29058 WP_003401864.1.29078 WP_003401864.1.29102 WP_003401864.1.29115 WP_003401864.1.2916 WP_003401864.1.29217 WP_003401864.1.29223 WP_003401864.1.29234 WP_003401864.1.29275 WP_003401864.1.29306 WP_003401864.1.29339 WP_003401864.1.29348 WP_003401864.1.29364 WP_003401864.1.29367 WP_003401864.1.2938 WP_003401864.1.29399 WP_003401864.1.2944 WP_003401864.1.29449 WP_003401864.1.29450 WP_003401864.1.29452 WP_003401864.1.2949 WP_003401864.1.29510 WP_003401864.1.29515 WP_003401864.1.29525 WP_003401864.1.2953 WP_003401864.1.29559 WP_003401864.1.29587 WP_003401864.1.2959 WP_003401864.1.29599 WP_003401864.1.29611 WP_003401864.1.29632 WP_003401864.1.29649 WP_003401864.1.2965 WP_003401864.1.29659 WP_003401864.1.2969 WP_003401864.1.29696 WP_003401864.1.29698 WP_003401864.1.29718 WP_003401864.1.29742 WP_003401864.1.29745 WP_003401864.1.29747 WP_003401864.1.29769 WP_003401864.1.29825 WP_003401864.1.29830 WP_003401864.1.29847 WP_003401864.1.29861 WP_003401864.1.29869 WP_003401864.1.29883 WP_003401864.1.29890 WP_003401864.1.299 WP_003401864.1.29931 WP_003401864.1.29960 WP_003401864.1.30014 WP_003401864.1.3004 WP_003401864.1.30040 WP_003401864.1.30074 WP_003401864.1.30097 WP_003401864.1.30101 WP_003401864.1.30106 WP_003401864.1.30114 WP_003401864.1.30126 WP_003401864.1.30131 WP_003401864.1.30138 WP_003401864.1.30139 WP_003401864.1.30145 WP_003401864.1.30211 WP_003401864.1.30224 WP_003401864.1.30235 WP_003401864.1.30237 WP_003401864.1.3027 WP_003401864.1.30279 WP_003401864.1.30282 WP_003401864.1.30283 WP_003401864.1.30288 WP_003401864.1.30291 WP_003401864.1.30363 WP_003401864.1.30374 WP_003401864.1.3043 WP_003401864.1.30433 WP_003401864.1.30438 WP_003401864.1.30462 WP_003401864.1.30464 WP_003401864.1.30468 WP_003401864.1.3057 WP_003401864.1.30574 WP_003401864.1.30628 WP_003401864.1.30641 WP_003401864.1.30642 WP_003401864.1.30661 WP_003401864.1.30669 WP_003401864.1.30683 WP_003401864.1.30699 WP_003401864.1.30709 WP_003401864.1.30713 WP_003401864.1.30716 WP_003401864.1.30719 WP_003401864.1.30730 WP_003401864.1.30732 WP_003401864.1.30736 WP_003401864.1.30745 WP_003401864.1.30760 WP_003401864.1.30791 WP_003401864.1.308 WP_003401864.1.30807 WP_003401864.1.30818 WP_003401864.1.30824 WP_003401864.1.30848 WP_003401864.1.30877 WP_003401864.1.30888 WP_003401864.1.30901 WP_003401864.1.30903 WP_003401864.1.30912 WP_003401864.1.30913 WP_003401864.1.30914 WP_003401864.1.30919 WP_003401864.1.30977 WP_003401864.1.3100 WP_003401864.1.31002 WP_003401864.1.3101 WP_003401864.1.31034 WP_003401864.1.31047 WP_003401864.1.31070 WP_003401864.1.31074 WP_003401864.1.31102 WP_003401864.1.31127 WP_003401864.1.31184 WP_003401864.1.31199 WP_003401864.1.31226 WP_003401864.1.31230 WP_003401864.1.31263 WP_003401864.1.31264 WP_003401864.1.31270 WP_003401864.1.31287 WP_003401864.1.31290 WP_003401864.1.31304 WP_003401864.1.31346 WP_003401864.1.31348 WP_003401864.1.31354 WP_003401864.1.31390 WP_003401864.1.31414 WP_003401864.1.31417 WP_003401864.1.31428 WP_003401864.1.3143 WP_003401864.1.31458 WP_003401864.1.31483 WP_003401864.1.3149 WP_003401864.1.31498 WP_003401864.1.31507 WP_003401864.1.31537 WP_003401864.1.31548 WP_003401864.1.31569 WP_003401864.1.31573 WP_003401864.1.316 WP_003401864.1.31629 WP_003401864.1.31666 WP_003401864.1.31693 WP_003401864.1.31703 WP_003401864.1.31744 WP_003401864.1.31745 WP_003401864.1.31770 WP_003401864.1.31776 WP_003401864.1.31783 WP_003401864.1.318 WP_003401864.1.3184 WP_003401864.1.31840 WP_003401864.1.31880 WP_003401864.1.31911 WP_003401864.1.31930 WP_003401864.1.31932 WP_003401864.1.31955 WP_003401864.1.31985 WP_003401864.1.31995 WP_003401864.1.32004 WP_003401864.1.32039 WP_003401864.1.3204 WP_003401864.1.32045 WP_003401864.1.32071 WP_003401864.1.32098 WP_003401864.1.32132 WP_003401864.1.32157 WP_003401864.1.32164 WP_003401864.1.32179 WP_003401864.1.32198 WP_003401864.1.32297 WP_003401864.1.32317 WP_003401864.1.32383 WP_003401864.1.32400 WP_003401864.1.32403 WP_003401864.1.32421 WP_003401864.1.32433 WP_003401864.1.32482 WP_003401864.1.32503 WP_003401864.1.32556 WP_003401864.1.32562 WP_003401864.1.32569 WP_003401864.1.32592 WP_003401864.1.32620 WP_003401864.1.32647 WP_003401864.1.32653 WP_003401864.1.32654 WP_003401864.1.3268 WP_003401864.1.32695 WP_003401864.1.32706 WP_003401864.1.32716 WP_003401864.1.32738 WP_003401864.1.32752 WP_003401864.1.32780 WP_003401864.1.32781 WP_003401864.1.32799 WP_003401864.1.32822 WP_003401864.1.32833 WP_003401864.1.32862 WP_003401864.1.32880 WP_003401864.1.32897 WP_003401864.1.32935 WP_003401864.1.32974 WP_003401864.1.33007 WP_003401864.1.3302 WP_003401864.1.33028 WP_003401864.1.33035 WP_003401864.1.33044 WP_003401864.1.33054 WP_003401864.1.33082 WP_003401864.1.33141 WP_003401864.1.33148 WP_003401864.1.33155 WP_003401864.1.33168 WP_003401864.1.3321 WP_003401864.1.3325 WP_003401864.1.3327 WP_003401864.1.33278 WP_003401864.1.33288 WP_003401864.1.33305 WP_003401864.1.3331 WP_003401864.1.33319 WP_003401864.1.3333 WP_003401864.1.33393 WP_003401864.1.33403 WP_003401864.1.33452 WP_003401864.1.33467 WP_003401864.1.33477 WP_003401864.1.3349 WP_003401864.1.33519 WP_003401864.1.33542 WP_003401864.1.33601 WP_003401864.1.33602 WP_003401864.1.33633 WP_003401864.1.33646 WP_003401864.1.33673 WP_003401864.1.3369 WP_003401864.1.33705 WP_003401864.1.33762 WP_003401864.1.33783 WP_003401864.1.33789 WP_003401864.1.3383 WP_003401864.1.33839 WP_003401864.1.33848 WP_003401864.1.3387 WP_003401864.1.33886 WP_003401864.1.33895 WP_003401864.1.33906 WP_003401864.1.33912 WP_003401864.1.33954 WP_003401864.1.3399 WP_003401864.1.34042 WP_003401864.1.3405 WP_003401864.1.34055 WP_003401864.1.34056 WP_003401864.1.34065 WP_003401864.1.3408 WP_003401864.1.34090 WP_003401864.1.34109 WP_003401864.1.34111 WP_003401864.1.34131 WP_003401864.1.34152 WP_003401864.1.34153 WP_003401864.1.34163 WP_003401864.1.34181 WP_003401864.1.34197 WP_003401864.1.34198 WP_003401864.1.34215 WP_003401864.1.34219 WP_003401864.1.34255 WP_003401864.1.34260 WP_003401864.1.34275 WP_003401864.1.343 WP_003401864.1.34347 WP_003401864.1.34358 WP_003401864.1.34392 WP_003401864.1.344 WP_003401864.1.34428 WP_003401864.1.3443 WP_003401864.1.34435 WP_003401864.1.34446 WP_003401864.1.34499 WP_003401864.1.34505 WP_003401864.1.34516 WP_003401864.1.34529 WP_003401864.1.34551 WP_003401864.1.34563 WP_003401864.1.34576 WP_003401864.1.34581 WP_003401864.1.34588 WP_003401864.1.34596 WP_003401864.1.34599 WP_003401864.1.34639 WP_003401864.1.34673 WP_003401864.1.34724 WP_003401864.1.34740 WP_003401864.1.34755 WP_003401864.1.34777 WP_003401864.1.34783 WP_003401864.1.34841 WP_003401864.1.34908 WP_003401864.1.34919 WP_003401864.1.3492 WP_003401864.1.34933 WP_003401864.1.34945 WP_003401864.1.34946 WP_003401864.1.34954 WP_003401864.1.34960 WP_003401864.1.34961 WP_003401864.1.34963 WP_003401864.1.34965 WP_003401864.1.34968 WP_003401864.1.35023 WP_003401864.1.35069 WP_003401864.1.35078 WP_003401864.1.35100 WP_003401864.1.35146 WP_003401864.1.35156 WP_003401864.1.35160 WP_003401864.1.35162 WP_003401864.1.35173 WP_003401864.1.35176 WP_003401864.1.3520 WP_003401864.1.35213 WP_003401864.1.35221 WP_003401864.1.35246 WP_003401864.1.35278 WP_003401864.1.35301 WP_003401864.1.35311 WP_003401864.1.35317 WP_003401864.1.35319 WP_003401864.1.35347 WP_003401864.1.35363 WP_003401864.1.35382 WP_003401864.1.35385 WP_003401864.1.35396 WP_003401864.1.35397 WP_003401864.1.35426 WP_003401864.1.35439 WP_003401864.1.35455 WP_003401864.1.3548 WP_003401864.1.35484 WP_003401864.1.3553 WP_003401864.1.35553 WP_003401864.1.35555 WP_003401864.1.35561 WP_003401864.1.35602 WP_003401864.1.35610 WP_003401864.1.35635 WP_003401864.1.35657 WP_003401864.1.35680 WP_003401864.1.35687 WP_003401864.1.35689 WP_003401864.1.35707 WP_003401864.1.35732 WP_003401864.1.35754 WP_003401864.1.35767 WP_003401864.1.35771 WP_003401864.1.35780 WP_003401864.1.35805 WP_003401864.1.35811 WP_003401864.1.35821 WP_003401864.1.3584 WP_003401864.1.35848 WP_003401864.1.35864 WP_003401864.1.35874 WP_003401864.1.35876 WP_003401864.1.35897 WP_003401864.1.35899 WP_003401864.1.35923 WP_003401864.1.3593 WP_003401864.1.35954 WP_003401864.1.36005 WP_003401864.1.36014 WP_003401864.1.36023 WP_003401864.1.36051 WP_003401864.1.36053 WP_003401864.1.36075 WP_003401864.1.36097 WP_003401864.1.36098 WP_003401864.1.36116 WP_003401864.1.36145 WP_003401864.1.36156 WP_003401864.1.36205 WP_003401864.1.36228 WP_003401864.1.36246 WP_003401864.1.36252 WP_003401864.1.36260 WP_003401864.1.36270 WP_003401864.1.36271 WP_003401864.1.36309 WP_003401864.1.36315 WP_003401864.1.36319 WP_003401864.1.36321 WP_003401864.1.36326 WP_003401864.1.36356 WP_003401864.1.36357 WP_003401864.1.3636 WP_003401864.1.36385 WP_003401864.1.36399 WP_003401864.1.36436 WP_003401864.1.36465 WP_003401864.1.36469 WP_003401864.1.36473 WP_003401864.1.36485 WP_003401864.1.36508 WP_003401864.1.36540 WP_003401864.1.36561 WP_003401864.1.36571 WP_003401864.1.36578 WP_003401864.1.36585 WP_003401864.1.36597 WP_003401864.1.36614 WP_003401864.1.36657 WP_003401864.1.36674 WP_003401864.1.36720 WP_003401864.1.36727 WP_003401864.1.36733 WP_003401864.1.36785 WP_003401864.1.36810 WP_003401864.1.36844 WP_003401864.1.36851 WP_003401864.1.36862 WP_003401864.1.36893 WP_003401864.1.36901 WP_003401864.1.36921 WP_003401864.1.36935 WP_003401864.1.36941 WP_003401864.1.3695 WP_003401864.1.36951 WP_003401864.1.36968 WP_003401864.1.3700 WP_003401864.1.37012 WP_003401864.1.37071 WP_003401864.1.37088 WP_003401864.1.37131 WP_003401864.1.37157 WP_003401864.1.37175 WP_003401864.1.37188 WP_003401864.1.37213 WP_003401864.1.37229 WP_003401864.1.3724 WP_003401864.1.37305 WP_003401864.1.37330 WP_003401864.1.37389 WP_003401864.1.37400 WP_003401864.1.37440 WP_003401864.1.37459 WP_003401864.1.37468 WP_003401864.1.37475 WP_003401864.1.37484 WP_003401864.1.37601 WP_003401864.1.37612 WP_003401864.1.37632 WP_003401864.1.37643 WP_003401864.1.37655 WP_003401864.1.37660 WP_003401864.1.37674 WP_003401864.1.37700 WP_003401864.1.37701 WP_003401864.1.37709 WP_003401864.1.37711 WP_003401864.1.37721 WP_003401864.1.37722 WP_003401864.1.37747 WP_003401864.1.37804 WP_003401864.1.37809 WP_003401864.1.37859 WP_003401864.1.37877 WP_003401864.1.37912 WP_003401864.1.37913 WP_003401864.1.37943 WP_003401864.1.37973 WP_003401864.1.37975 WP_003401864.1.37983 WP_003401864.1.38 WP_003401864.1.38002 WP_003401864.1.3802 WP_003401864.1.38039 WP_003401864.1.38040 WP_003401864.1.38067 WP_003401864.1.38068 WP_003401864.1.38135 WP_003401864.1.38138 WP_003401864.1.38144 WP_003401864.1.38158 WP_003401864.1.38159 WP_003401864.1.38210 WP_003401864.1.38233 WP_003401864.1.38240 WP_003401864.1.38299 WP_003401864.1.38332 WP_003401864.1.38347 WP_003401864.1.38354 WP_003401864.1.38380 WP_003401864.1.38384 WP_003401864.1.38389 WP_003401864.1.38398 WP_003401864.1.38402 WP_003401864.1.38418 WP_003401864.1.38421 WP_003401864.1.38466 WP_003401864.1.38477 WP_003401864.1.38483 WP_003401864.1.3849 WP_003401864.1.385 WP_003401864.1.38530 WP_003401864.1.38535 WP_003401864.1.38539 WP_003401864.1.38594 WP_003401864.1.38601 WP_003401864.1.38611 WP_003401864.1.38638 WP_003401864.1.38639 WP_003401864.1.38646 WP_003401864.1.38648 WP_003401864.1.38654 WP_003401864.1.38659 WP_003401864.1.38660 WP_003401864.1.38666 WP_003401864.1.38671 WP_003401864.1.38672 WP_003401864.1.38677 WP_003401864.1.38750 WP_003401864.1.38772 WP_003401864.1.38812 WP_003401864.1.38821 WP_003401864.1.38844 WP_003401864.1.38863 WP_003401864.1.38865 WP_003401864.1.38873 WP_003401864.1.3889 WP_003401864.1.38894 WP_003401864.1.38909 WP_003401864.1.38939 WP_003401864.1.38974 WP_003401864.1.38975 WP_003401864.1.38991 WP_003401864.1.39025 WP_003401864.1.39070 WP_003401864.1.39072 WP_003401864.1.39095 WP_003401864.1.39106 WP_003401864.1.39165 WP_003401864.1.39174 WP_003401864.1.39176 WP_003401864.1.39178 WP_003401864.1.39190 WP_003401864.1.39201 WP_003401864.1.39211 WP_003401864.1.39236 WP_003401864.1.39239 WP_003401864.1.39252 WP_003401864.1.39288 WP_003401864.1.39295 WP_003401864.1.39306 WP_003401864.1.39359 WP_003401864.1.39364 WP_003401864.1.39400 WP_003401864.1.39447 WP_003401864.1.3945 WP_003401864.1.39450 WP_003401864.1.39455 WP_003401864.1.3949 WP_003401864.1.39521 WP_003401864.1.39560 WP_003401864.1.39592 WP_003401864.1.39593 WP_003401864.1.396 WP_003401864.1.3960 WP_003401864.1.39616 WP_003401864.1.39654 WP_003401864.1.39657 WP_003401864.1.39661 WP_003401864.1.39674 WP_003401864.1.39678 WP_003401864.1.3968 WP_003401864.1.39694 WP_003401864.1.3971 WP_003401864.1.39718 WP_003401864.1.39728 WP_003401864.1.39739 WP_003401864.1.39751 WP_003401864.1.39759 WP_003401864.1.39801 WP_003401864.1.39804 WP_003401864.1.39848 WP_003401864.1.39877 WP_003401864.1.39925 WP_003401864.1.3994 WP_003401864.1.39959 WP_003401864.1.3996 WP_003401864.1.39960 WP_003401864.1.3997 WP_003401864.1.40000 WP_003401864.1.40029 WP_003401864.1.4003 WP_003401864.1.40094 WP_003401864.1.40096 WP_003401864.1.40150 WP_003401864.1.40156 WP_003401864.1.40174 WP_003401864.1.40186 WP_003401864.1.40276 WP_003401864.1.40277 WP_003401864.1.40323 WP_003401864.1.40336 WP_003401864.1.40353 WP_003401864.1.4036 WP_003401864.1.40372 WP_003401864.1.40402 WP_003401864.1.40413 WP_003401864.1.40440 WP_003401864.1.40446 WP_003401864.1.40451 WP_003401864.1.40455 WP_003401864.1.40523 WP_003401864.1.40543 WP_003401864.1.40641 WP_003401864.1.40646 WP_003401864.1.40651 WP_003401864.1.40653 WP_003401864.1.4067 WP_003401864.1.40705 WP_003401864.1.40723 WP_003401864.1.40731 WP_003401864.1.40735 WP_003401864.1.40795 WP_003401864.1.40799 WP_003401864.1.40852 WP_003401864.1.40876 WP_003401864.1.40881 WP_003401864.1.40922 WP_003401864.1.40948 WP_003401864.1.4095 WP_003401864.1.40956 WP_003401864.1.40957 WP_003401864.1.40964 WP_003401864.1.4097 WP_003401864.1.410 WP_003401864.1.41000 WP_003401864.1.41055 WP_003401864.1.41108 WP_003401864.1.41123 WP_003401864.1.41177 WP_003401864.1.41202 WP_003401864.1.41219 WP_003401864.1.41231 WP_003401864.1.41249 WP_003401864.1.4127 WP_003401864.1.41296 WP_003401864.1.41355 WP_003401864.1.41376 WP_003401864.1.41430 WP_003401864.1.41447 WP_003401864.1.41469 WP_003401864.1.41504 WP_003401864.1.41553 WP_003401864.1.41564 WP_003401864.1.41583 WP_003401864.1.41616 WP_003401864.1.41632 WP_003401864.1.41635 WP_003401864.1.41636 WP_003401864.1.41660 WP_003401864.1.41685 WP_003401864.1.41695 WP_003401864.1.41704 WP_003401864.1.4171 WP_003401864.1.41719 WP_003401864.1.41733 WP_003401864.1.41744 WP_003401864.1.41774 WP_003401864.1.41791 WP_003401864.1.41803 WP_003401864.1.41820 WP_003401864.1.41828 WP_003401864.1.41829 WP_003401864.1.41860 WP_003401864.1.41912 WP_003401864.1.41921 WP_003401864.1.41933 WP_003401864.1.41944 WP_003401864.1.42043 WP_003401864.1.42075 WP_003401864.1.42078 WP_003401864.1.42094 WP_003401864.1.42112 WP_003401864.1.42122 WP_003401864.1.42134 WP_003401864.1.42183 WP_003401864.1.42188 WP_003401864.1.42201 WP_003401864.1.42202 WP_003401864.1.42208 WP_003401864.1.42247 WP_003401864.1.42255 WP_003401864.1.42273 WP_003401864.1.42278 WP_003401864.1.42304 WP_003401864.1.42309 WP_003401864.1.42370 WP_003401864.1.42385 WP_003401864.1.42400 WP_003401864.1.42409 WP_003401864.1.42417 WP_003401864.1.42430 WP_003401864.1.42461 WP_003401864.1.42467 WP_003401864.1.42473 WP_003401864.1.42474 WP_003401864.1.4248 WP_003401864.1.42494 WP_003401864.1.42519 WP_003401864.1.42524 WP_003401864.1.42534 WP_003401864.1.4255 WP_003401864.1.42562 WP_003401864.1.42568 WP_003401864.1.42570 WP_003401864.1.42618 WP_003401864.1.42660 WP_003401864.1.42695 WP_003401864.1.42704 WP_003401864.1.42705 WP_003401864.1.42722 WP_003401864.1.42777 WP_003401864.1.42782 WP_003401864.1.42835 WP_003401864.1.42839 WP_003401864.1.42842 WP_003401864.1.42905 WP_003401864.1.42916 WP_003401864.1.42930 WP_003401864.1.42971 WP_003401864.1.43005 WP_003401864.1.43009 WP_003401864.1.43053 WP_003401864.1.43082 WP_003401864.1.43087 WP_003401864.1.43208 WP_003401864.1.43236 WP_003401864.1.43246 WP_003401864.1.43255 WP_003401864.1.43266 WP_003401864.1.43269 WP_003401864.1.43273 WP_003401864.1.43296 WP_003401864.1.43306 WP_003401864.1.4335 WP_003401864.1.43368 WP_003401864.1.43395 WP_003401864.1.43457 WP_003401864.1.43462 WP_003401864.1.43475 WP_003401864.1.43478 WP_003401864.1.43484 WP_003401864.1.43557 WP_003401864.1.43578 WP_003401864.1.43588 WP_003401864.1.43643 WP_003401864.1.43664 WP_003401864.1.43684 WP_003401864.1.43686 WP_003401864.1.43706 WP_003401864.1.43716 WP_003401864.1.4377 WP_003401864.1.43781 WP_003401864.1.43815 WP_003401864.1.43861 WP_003401864.1.43863 WP_003401864.1.43866 WP_003401864.1.43872 WP_003401864.1.43885 WP_003401864.1.43897 WP_003401864.1.4390 WP_003401864.1.43902 WP_003401864.1.43921 WP_003401864.1.43936 WP_003401864.1.43937 WP_003401864.1.43960 WP_003401864.1.43965 WP_003401864.1.4399 WP_003401864.1.43993 WP_003401864.1.43996 WP_003401864.1.44 WP_003401864.1.44001 WP_003401864.1.44008 WP_003401864.1.44016 WP_003401864.1.44033 WP_003401864.1.44037 WP_003401864.1.44041 WP_003401864.1.44070 WP_003401864.1.44071 WP_003401864.1.44076 WP_003401864.1.44104 WP_003401864.1.44111 WP_003401864.1.44124 WP_003401864.1.44169 WP_003401864.1.44219 WP_003401864.1.44277 WP_003401864.1.44279 WP_003401864.1.44336 WP_003401864.1.44355 WP_003401864.1.44358 WP_003401864.1.4438 WP_003401864.1.44390 WP_003401864.1.44392 WP_003401864.1.4441 WP_003401864.1.44415 WP_003401864.1.44464 WP_003401864.1.44466 WP_003401864.1.44489 WP_003401864.1.44492 WP_003401864.1.44494 WP_003401864.1.44500 WP_003401864.1.44519 WP_003401864.1.44526 WP_003401864.1.44532 WP_003401864.1.44534 WP_003401864.1.44562 WP_003401864.1.44589 WP_003401864.1.44597 WP_003401864.1.44600 WP_003401864.1.44602 WP_003401864.1.44615 WP_003401864.1.4464 WP_003401864.1.44651 WP_003401864.1.44659 WP_003401864.1.44665 WP_003401864.1.44694 WP_003401864.1.44700 WP_003401864.1.44713 WP_003401864.1.44735 WP_003401864.1.44740 WP_003401864.1.44757 WP_003401864.1.4476 WP_003401864.1.44761 WP_003401864.1.44767 WP_003401864.1.44776 WP_003401864.1.44779 WP_003401864.1.44786 WP_003401864.1.44808 WP_003401864.1.44864 WP_003401864.1.44901 WP_003401864.1.44908 WP_003401864.1.44913 WP_003401864.1.4492 WP_003401864.1.44939 WP_003401864.1.44979 WP_003401864.1.44981 WP_003401864.1.45002 WP_003401864.1.45011 WP_003401864.1.4504 WP_003401864.1.45066 WP_003401864.1.45081 WP_003401864.1.45113 WP_003401864.1.45129 WP_003401864.1.45147 WP_003401864.1.45168 WP_003401864.1.4517 WP_003401864.1.45181 WP_003401864.1.45185 WP_003401864.1.45200 WP_003401864.1.45205 WP_003401864.1.45211 WP_003401864.1.45249 WP_003401864.1.4526 WP_003401864.1.45286 WP_003401864.1.45326 WP_003401864.1.45347 WP_003401864.1.45374 WP_003401864.1.45390 WP_003401864.1.454 WP_003401864.1.45407 WP_003401864.1.45451 WP_003401864.1.45453 WP_003401864.1.45460 WP_003401864.1.45463 WP_003401864.1.45470 WP_003401864.1.45474 WP_003401864.1.45491 WP_003401864.1.45510 WP_003401864.1.45563 WP_003401864.1.45584 WP_003401864.1.45590 WP_003401864.1.45619 WP_003401864.1.45626 WP_003401864.1.45631 WP_003401864.1.45666 WP_003401864.1.45697 WP_003401864.1.4571 WP_003401864.1.45731 WP_003401864.1.45743 WP_003401864.1.45765 WP_003401864.1.45776 WP_003401864.1.45783 WP_003401864.1.45805 WP_003401864.1.45815 WP_003401864.1.45849 WP_003401864.1.45867 WP_003401864.1.45884 WP_003401864.1.4590 WP_003401864.1.45923 WP_003401864.1.45926 WP_003401864.1.45963 WP_003401864.1.45989 WP_003401864.1.45992 WP_003401864.1.46025 WP_003401864.1.46083 WP_003401864.1.46090 WP_003401864.1.46092 WP_003401864.1.46100 WP_003401864.1.46101 WP_003401864.1.46103 WP_003401864.1.46107 WP_003401864.1.46127 WP_003401864.1.46128 WP_003401864.1.46129 WP_003401864.1.46141 WP_003401864.1.46201 WP_003401864.1.46226 WP_003401864.1.4624 WP_003401864.1.46253 WP_003401864.1.46268 WP_003401864.1.46285 WP_003401864.1.46300 WP_003401864.1.46313 WP_003401864.1.46336 WP_003401864.1.46370 WP_003401864.1.46381 WP_003401864.1.46402 WP_003401864.1.46411 WP_003401864.1.4644 WP_003401864.1.46442 WP_003401864.1.46453 WP_003401864.1.46463 WP_003401864.1.46478 WP_003401864.1.46492 WP_003401864.1.46521 WP_003401864.1.46532 WP_003401864.1.46568 WP_003401864.1.46585 WP_003401864.1.46609 WP_003401864.1.46613 WP_003401864.1.46625 WP_003401864.1.46642 WP_003401864.1.46647 WP_003401864.1.46674 WP_003401864.1.46724 WP_003401864.1.46758 WP_003401864.1.46773 WP_003401864.1.46777 WP_003401864.1.46786 WP_003401864.1.46792 WP_003401864.1.46847 WP_003401864.1.46851 WP_003401864.1.4687 WP_003401864.1.46897 WP_003401864.1.46936 WP_003401864.1.46980 WP_003401864.1.47011 WP_003401864.1.47012 WP_003401864.1.47066 WP_003401864.1.47077 WP_003401864.1.47083 WP_003401864.1.47106 WP_003401864.1.47142 WP_003401864.1.47147 WP_003401864.1.47166 WP_003401864.1.47178 WP_003401864.1.47179 WP_003401864.1.47194 WP_003401864.1.47207 WP_003401864.1.47210 WP_003401864.1.47261 WP_003401864.1.47262 WP_003401864.1.47402 WP_003401864.1.47423 WP_003401864.1.47467 WP_003401864.1.4751 WP_003401864.1.47511 WP_003401864.1.47537 WP_003401864.1.47540 WP_003401864.1.47568 WP_003401864.1.47572 WP_003401864.1.47588 WP_003401864.1.47636 WP_003401864.1.4764 WP_003401864.1.47653 WP_003401864.1.47679 WP_003401864.1.47681 WP_003401864.1.47690 WP_003401864.1.4771 WP_003401864.1.47717 WP_003401864.1.47754 WP_003401864.1.47773 WP_003401864.1.47776 WP_003401864.1.47780 WP_003401864.1.47805 WP_003401864.1.47832 WP_003401864.1.47847 WP_003401864.1.47858 WP_003401864.1.47861 WP_003401864.1.47868 WP_003401864.1.47893 WP_003401864.1.47899 WP_003401864.1.479 WP_003401864.1.47912 WP_003401864.1.47913 WP_003401864.1.47926 WP_003401864.1.4794 WP_003401864.1.47943 WP_003401864.1.47944 WP_003401864.1.47959 WP_003401864.1.47974 WP_003401864.1.47993 WP_003401864.1.48004 WP_003401864.1.48039 WP_003401864.1.48050 WP_003401864.1.48084 WP_003401864.1.48097 WP_003401864.1.48101 WP_003401864.1.48109 WP_003401864.1.4813 WP_003401864.1.48130 WP_003401864.1.48135 WP_003401864.1.48143 WP_003401864.1.48152 WP_003401864.1.48155 WP_003401864.1.48170 WP_003401864.1.48173 WP_003401864.1.48177 WP_003401864.1.48185 WP_003401864.1.48219 WP_003401864.1.4823 WP_003401864.1.48240 WP_003401864.1.48256 WP_003401864.1.48264 WP_003401864.1.48287 WP_003401864.1.48330 WP_003401864.1.48333 WP_003401864.1.48348 WP_003401864.1.48354 WP_003401864.1.48372 WP_003401864.1.48383 WP_003401864.1.48419 WP_003401864.1.48423 WP_003401864.1.48443 WP_003401864.1.48450 WP_003401864.1.48462 WP_003401864.1.48543 WP_003401864.1.48550 WP_003401864.1.48605 WP_003401864.1.48618 WP_003401864.1.4863 WP_003401864.1.48648 WP_003401864.1.48658 WP_003401864.1.48666 WP_003401864.1.48687 WP_003401864.1.48779 WP_003401864.1.4878 WP_003401864.1.48802 WP_003401864.1.48826 WP_003401864.1.48831 WP_003401864.1.48843 WP_003401864.1.48857 WP_003401864.1.4890 WP_003401864.1.48946 WP_003401864.1.49048 WP_003401864.1.49059 WP_003401864.1.4906 WP_003401864.1.4907 WP_003401864.1.49103 WP_003401864.1.49110 WP_003401864.1.49111 WP_003401864.1.49112 WP_003401864.1.4919 WP_003401864.1.49251 WP_003401864.1.49254 WP_003401864.1.49263 WP_003401864.1.49291 WP_003401864.1.49296 WP_003401864.1.49335 WP_003401864.1.49337 WP_003401864.1.49419 WP_003401864.1.49426 WP_003401864.1.49437 WP_003401864.1.49439 WP_003401864.1.49474 WP_003401864.1.49506 WP_003401864.1.49516 WP_003401864.1.49523 WP_003401864.1.49526 WP_003401864.1.49532 WP_003401864.1.49588 WP_003401864.1.4959 WP_003401864.1.49678 WP_003401864.1.49687 WP_003401864.1.49699 WP_003401864.1.49709 WP_003401864.1.4971 WP_003401864.1.49736 WP_003401864.1.49746 WP_003401864.1.49764 WP_003401864.1.49773 WP_003401864.1.49796 WP_003401864.1.49814 WP_003401864.1.49815 WP_003401864.1.49816 WP_003401864.1.49839 WP_003401864.1.49857 WP_003401864.1.49878 WP_003401864.1.49880 WP_003401864.1.4999 WP_003401864.1.49990 WP_003401864.1.50068 WP_003401864.1.5008 WP_003401864.1.50081 WP_003401864.1.50122 WP_003401864.1.50126 WP_003401864.1.50162 WP_003401864.1.5018 WP_003401864.1.50194 WP_003401864.1.50218 WP_003401864.1.50235 WP_003401864.1.50249 WP_003401864.1.50265 WP_003401864.1.50271 WP_003401864.1.50324 WP_003401864.1.50347 WP_003401864.1.50372 WP_003401864.1.50398 WP_003401864.1.50407 WP_003401864.1.50444 WP_003401864.1.50466 WP_003401864.1.50472 WP_003401864.1.5048 WP_003401864.1.50498 WP_003401864.1.5050 WP_003401864.1.50540 WP_003401864.1.50554 WP_003401864.1.50557 WP_003401864.1.50601 WP_003401864.1.50610 WP_003401864.1.50632 WP_003401864.1.50642 WP_003401864.1.50655 WP_003401864.1.50659 WP_003401864.1.50683 WP_003401864.1.50689 WP_003401864.1.50692 WP_003401864.1.50714 WP_003401864.1.50756 WP_003401864.1.50784 WP_003401864.1.50794 WP_003401864.1.50841 WP_003401864.1.50860 WP_003401864.1.50868 WP_003401864.1.50877 WP_003401864.1.5096 WP_003401864.1.51003 WP_003401864.1.51009 WP_003401864.1.51037 WP_003401864.1.51074 WP_003401864.1.51101 WP_003401864.1.51116 WP_003401864.1.51149 WP_003401864.1.51156 WP_003401864.1.51157 WP_003401864.1.51213 WP_003401864.1.51232 WP_003401864.1.51239 WP_003401864.1.51247 WP_003401864.1.51279 WP_003401864.1.51294 WP_003401864.1.51301 WP_003401864.1.51329 WP_003401864.1.51391 WP_003401864.1.51422 WP_003401864.1.51445 WP_003401864.1.51455 WP_003401864.1.51466 WP_003401864.1.51468 WP_003401864.1.51478 WP_003401864.1.51497 WP_003401864.1.51520 WP_003401864.1.51593 WP_003401864.1.5164 WP_003401864.1.51647 WP_003401864.1.51660 WP_003401864.1.51696 WP_003401864.1.51721 WP_003401864.1.51788 WP_003401864.1.51795 WP_003401864.1.51801 WP_003401864.1.51817 WP_003401864.1.51819 WP_003401864.1.51854 WP_003401864.1.51923 WP_003401864.1.51942 WP_003401864.1.51948 WP_003401864.1.51963 WP_003401864.1.51969 WP_003401864.1.52000 WP_003401864.1.52001 WP_003401864.1.52003 WP_003401864.1.52006 WP_003401864.1.52038 WP_003401864.1.52046 WP_003401864.1.52059 WP_003401864.1.52069 WP_003401864.1.52082 WP_003401864.1.52102 WP_003401864.1.52106 WP_003401864.1.52166 WP_003401864.1.52168 WP_003401864.1.52173 WP_003401864.1.52178 WP_003401864.1.52206 WP_003401864.1.52216 WP_003401864.1.52241 WP_003401864.1.52280 WP_003401864.1.52314 WP_003401864.1.52385 WP_003401864.1.52390 WP_003401864.1.524 WP_003401864.1.52460 WP_003401864.1.52485 WP_003401864.1.52486 WP_003401864.1.52495 WP_003401864.1.52504 WP_003401864.1.52522 WP_003401864.1.52531 WP_003401864.1.52533 WP_003401864.1.52545 WP_003401864.1.52553 WP_003401864.1.52563 WP_003401864.1.52564 WP_003401864.1.52574 WP_003401864.1.52641 WP_003401864.1.52673 WP_003401864.1.52674 WP_003401864.1.52708 WP_003401864.1.52713 WP_003401864.1.52761 WP_003401864.1.52778 WP_003401864.1.52791 WP_003401864.1.52797 WP_003401864.1.52818 WP_003401864.1.52872 WP_003401864.1.52873 WP_003401864.1.52891 WP_003401864.1.52892 WP_003401864.1.52909 WP_003401864.1.52970 WP_003401864.1.52998 WP_003401864.1.53053 WP_003401864.1.53056 WP_003401864.1.5306 WP_003401864.1.53088 WP_003401864.1.5309 WP_003401864.1.531 WP_003401864.1.53117 WP_003401864.1.53142 WP_003401864.1.53143 WP_003401864.1.53157 WP_003401864.1.53167 WP_003401864.1.53200 WP_003401864.1.53204 WP_003401864.1.53213 WP_003401864.1.53217 WP_003401864.1.53226 WP_003401864.1.53229 WP_003401864.1.53230 WP_003401864.1.53237 WP_003401864.1.53254 WP_003401864.1.53257 WP_003401864.1.5327 WP_003401864.1.53276 WP_003401864.1.53278 WP_003401864.1.533 WP_003401864.1.53302 WP_003401864.1.53306 WP_003401864.1.5334 WP_003401864.1.53353 WP_003401864.1.53381 WP_003401864.1.53460 WP_003401864.1.53480 WP_003401864.1.53517 WP_003401864.1.53522 WP_003401864.1.53525 WP_003401864.1.53526 WP_003401864.1.53553 WP_003401864.1.53606 WP_003401864.1.53609 WP_003401864.1.53628 WP_003401864.1.53643 WP_003401864.1.53667 WP_003401864.1.53679 WP_003401864.1.53715 WP_003401864.1.53730 WP_003401864.1.53743 WP_003401864.1.53754 WP_003401864.1.53775 WP_003401864.1.53787 WP_003401864.1.53803 WP_003401864.1.53818 WP_003401864.1.53822 WP_003401864.1.53853 WP_003401864.1.53865 WP_003401864.1.53888 WP_003401864.1.53900 WP_003401864.1.53912 WP_003401864.1.53914 WP_003401864.1.53952 WP_003401864.1.5398 WP_003401864.1.5408 WP_003401864.1.54089 WP_003401864.1.54093 WP_003401864.1.54099 WP_003401864.1.54112 WP_003401864.1.54125 WP_003401864.1.54141 WP_003401864.1.54162 WP_003401864.1.54179 WP_003401864.1.54206 WP_003401864.1.54218 WP_003401864.1.54225 WP_003401864.1.54227 WP_003401864.1.54232 WP_003401864.1.54241 WP_003401864.1.54245 WP_003401864.1.54247 WP_003401864.1.54260 WP_003401864.1.54275 WP_003401864.1.5429 WP_003401864.1.54294 WP_003401864.1.54314 WP_003401864.1.54347 WP_003401864.1.54351 WP_003401864.1.54370 WP_003401864.1.54428 WP_003401864.1.54449 WP_003401864.1.54494 WP_003401864.1.54502 WP_003401864.1.54514 WP_003401864.1.54519 WP_003401864.1.5452 WP_003401864.1.54531 WP_003401864.1.54537 WP_003401864.1.54553 WP_003401864.1.54555 WP_003401864.1.54575 WP_003401864.1.54633 WP_003401864.1.54686 WP_003401864.1.54687 WP_003401864.1.54705 WP_003401864.1.54730 WP_003401864.1.54732 WP_003401864.1.5475 WP_003401864.1.54797 WP_003401864.1.54807 WP_003401864.1.54836 WP_003401864.1.54838 WP_003401864.1.54860 WP_003401864.1.54888 WP_003401864.1.54905 WP_003401864.1.54909 WP_003401864.1.54937 WP_003401864.1.54939 WP_003401864.1.54944 WP_003401864.1.54945 WP_003401864.1.54953 WP_003401864.1.54964 WP_003401864.1.55015 WP_003401864.1.55022 WP_003401864.1.55023 WP_003401864.1.55051 WP_003401864.1.55072 WP_003401864.1.55088 WP_003401864.1.55106 WP_003401864.1.55126 WP_003401864.1.55128 WP_003401864.1.55140 WP_003401864.1.55150 WP_003401864.1.55210 WP_003401864.1.55227 WP_003401864.1.55248 WP_003401864.1.55257 WP_003401864.1.55258 WP_003401864.1.55267 WP_003401864.1.55279 WP_003401864.1.55307 WP_003401864.1.55326 WP_003401864.1.55328 WP_003401864.1.5533 WP_003401864.1.55345 WP_003401864.1.55396 WP_003401864.1.55398 WP_003401864.1.55441 WP_003401864.1.55501 WP_003401864.1.55504 WP_003401864.1.55578 WP_003401864.1.55626 WP_003401864.1.5569 WP_003401864.1.55723 WP_003401864.1.55735 WP_003401864.1.5574 WP_003401864.1.55772 WP_003401864.1.55807 WP_003401864.1.55819 WP_003401864.1.55821 WP_003401864.1.5583 WP_003401864.1.55849 WP_003401864.1.55856 WP_003401864.1.55860 WP_003401864.1.55882 WP_003401864.1.55883 WP_003401864.1.55894 WP_003401864.1.55902 WP_003401864.1.55908 WP_003401864.1.55909 WP_003401864.1.5591 WP_003401864.1.55961 WP_003401864.1.55977 WP_003401864.1.56028 WP_003401864.1.56057 WP_003401864.1.56060 WP_003401864.1.56107 WP_003401864.1.56132 WP_003401864.1.56163 WP_003401864.1.56167 WP_003401864.1.56287 WP_003401864.1.56292 WP_003401864.1.56341 WP_003401864.1.56359 WP_003401864.1.56365 WP_003401864.1.56394 WP_003401864.1.56443 WP_003401864.1.56473 WP_003401864.1.56478 WP_003401864.1.56500 WP_003401864.1.56534 WP_003401864.1.5656 WP_003401864.1.56577 WP_003401864.1.56625 WP_003401864.1.56670 WP_003401864.1.56697 WP_003401864.1.567 WP_003401864.1.56701 WP_003401864.1.56709 WP_003401864.1.56729 WP_003401864.1.56743 WP_003401864.1.56755 WP_003401864.1.56764 WP_003401864.1.56769 WP_003401864.1.56770 WP_003401864.1.56795 WP_003401864.1.5681 WP_003401864.1.56827 WP_003401864.1.56839 WP_003401864.1.56863 WP_003401864.1.56868 WP_003401864.1.56869 WP_003401864.1.56926 WP_003401864.1.56961 WP_003401864.1.56971 WP_003401864.1.56972 WP_003401864.1.57023 WP_003401864.1.57035 WP_003401864.1.57077 WP_003401864.1.57087 WP_003401864.1.57094 WP_003401864.1.57134 WP_003401864.1.57151 WP_003401864.1.57169 WP_003401864.1.57208 WP_003401864.1.57212 WP_003401864.1.57230 WP_003401864.1.5724 WP_003401864.1.5725 WP_003401864.1.5727 WP_003401864.1.57273 WP_003401864.1.573 WP_003401864.1.57314 WP_003401864.1.57326 WP_003401864.1.57328 WP_003401864.1.57331 WP_003401864.1.57340 WP_003401864.1.57351 WP_003401864.1.57352 WP_003401864.1.57380 WP_003401864.1.57430 WP_003401864.1.5744 WP_003401864.1.57440 WP_003401864.1.5745 WP_003401864.1.57461 WP_003401864.1.57489 WP_003401864.1.575 WP_003401864.1.57519 WP_003401864.1.57525 WP_003401864.1.57551 WP_003401864.1.5758 WP_003401864.1.57596 WP_003401864.1.57604 WP_003401864.1.57616 WP_003401864.1.57617 WP_003401864.1.57619 WP_003401864.1.57627 WP_003401864.1.57642 WP_003401864.1.57658 WP_003401864.1.57667 WP_003401864.1.57675 WP_003401864.1.57689 WP_003401864.1.57708 WP_003401864.1.57794 WP_003401864.1.57821 WP_003401864.1.57825 WP_003401864.1.57906 WP_003401864.1.57924 WP_003401864.1.57926 WP_003401864.1.57930 WP_003401864.1.57957 WP_003401864.1.57960 WP_003401864.1.57964 WP_003401864.1.57991 WP_003401864.1.58000 WP_003401864.1.58086 WP_003401864.1.58101 WP_003401864.1.58103 WP_003401864.1.5811 WP_003401864.1.58121 WP_003401864.1.58145 WP_003401864.1.58174 WP_003401864.1.582 WP_003401864.1.58202 WP_003401864.1.58209 WP_003401864.1.58215 WP_003401864.1.5824 WP_003401864.1.58250 WP_003401864.1.58259 WP_003401864.1.58283 WP_003401864.1.58288 WP_003401864.1.5830 WP_003401864.1.58303 WP_003401864.1.58311 WP_003401864.1.58330 WP_003401864.1.58359 WP_003401864.1.58386 WP_003401864.1.58393 WP_003401864.1.58431 WP_003401864.1.5844 WP_003401864.1.58457 WP_003401864.1.58488 WP_003401864.1.58518 WP_003401864.1.58534 WP_003401864.1.58559 WP_003401864.1.58567 WP_003401864.1.58573 WP_003401864.1.58602 WP_003401864.1.58612 WP_003401864.1.58619 WP_003401864.1.58630 WP_003401864.1.5865 WP_003401864.1.58671 WP_003401864.1.58690 WP_003401864.1.58702 WP_003401864.1.58743 WP_003401864.1.58754 WP_003401864.1.5879 WP_003401864.1.5881 WP_003401864.1.58824 WP_003401864.1.58848 WP_003401864.1.58857 WP_003401864.1.5890 WP_003401864.1.58904 WP_003401864.1.58921 WP_003401864.1.58930 WP_003401864.1.58939 WP_003401864.1.58941 WP_003401864.1.58953 WP_003401864.1.58961 WP_003401864.1.5898 WP_003401864.1.59025 WP_003401864.1.59029 WP_003401864.1.59037 WP_003401864.1.59044 WP_003401864.1.59112 WP_003401864.1.59130 WP_003401864.1.5914 WP_003401864.1.59147 WP_003401864.1.59166 WP_003401864.1.59205 WP_003401864.1.59209 WP_003401864.1.59237 WP_003401864.1.59240 WP_003401864.1.59253 WP_003401864.1.59254 WP_003401864.1.59262 WP_003401864.1.59270 WP_003401864.1.5928 WP_003401864.1.59305 WP_003401864.1.59309 WP_003401864.1.59316 WP_003401864.1.59326 WP_003401864.1.59328 WP_003401864.1.59333 WP_003401864.1.59338 WP_003401864.1.59388 WP_003401864.1.59428 WP_003401864.1.59487 WP_003401864.1.59537 WP_003401864.1.59561 WP_003401864.1.59677 WP_003401864.1.59722 WP_003401864.1.59727 WP_003401864.1.59732 WP_003401864.1.59750 WP_003401864.1.59757 WP_003401864.1.59761 WP_003401864.1.59808 WP_003401864.1.59856 WP_003401864.1.59860 WP_003401864.1.59861 WP_003401864.1.5987 WP_003401864.1.59878 WP_003401864.1.59888 WP_003401864.1.59952 WP_003401864.1.5996 WP_003401864.1.59961 WP_003401864.1.59974 WP_003401864.1.6000 WP_003401864.1.60007 WP_003401864.1.60016 WP_003401864.1.60047 WP_003401864.1.6007 WP_003401864.1.60121 WP_003401864.1.60125 WP_003401864.1.60135 WP_003401864.1.60139 WP_003401864.1.60152 WP_003401864.1.60171 WP_003401864.1.60197 WP_003401864.1.6020 WP_003401864.1.60207 WP_003401864.1.60215 WP_003401864.1.60217 WP_003401864.1.60267 WP_003401864.1.60291 WP_003401864.1.60301 WP_003401864.1.60305 WP_003401864.1.60312 WP_003401864.1.60313 WP_003401864.1.60314 WP_003401864.1.60367 WP_003401864.1.60376 WP_003401864.1.60403 WP_003401864.1.60413 WP_003401864.1.60421 WP_003401864.1.60479 WP_003401864.1.60487 WP_003401864.1.60512 WP_003401864.1.60573 WP_003401864.1.60632 WP_003401864.1.60657 WP_003401864.1.60687 WP_003401864.1.60689 WP_003401864.1.60727 WP_003401864.1.60738 WP_003401864.1.60763 WP_003401864.1.6077 WP_003401864.1.60791 WP_003401864.1.60834 WP_003401864.1.60870 WP_003401864.1.60878 WP_003401864.1.60879 WP_003401864.1.60913 WP_003401864.1.60978 WP_003401864.1.61000 WP_003401864.1.61001 WP_003401864.1.61012 WP_003401864.1.61014 WP_003401864.1.61015 WP_003401864.1.61037 WP_003401864.1.61052 WP_003401864.1.61065 WP_003401864.1.61100 WP_003401864.1.61101 WP_003401864.1.61138 WP_003401864.1.61142 WP_003401864.1.61198 WP_003401864.1.612 WP_003401864.1.61234 WP_003401864.1.61256 WP_003401864.1.61281 WP_003401864.1.61314 WP_003401864.1.61321 WP_003401864.1.61326 WP_003401864.1.61328 WP_003401864.1.61368 WP_003401864.1.61391 WP_003401864.1.61406 WP_003401864.1.61409 WP_003401864.1.61420 WP_003401864.1.61422 WP_003401864.1.61425 WP_003401864.1.61428 WP_003401864.1.61469 WP_003401864.1.61494 WP_003401864.1.61522 WP_003401864.1.61552 WP_003401864.1.61557 WP_003401864.1.61567 WP_003401864.1.61571 WP_003401864.1.61573 WP_003401864.1.61584 WP_003401864.1.61586 WP_003401864.1.6159 WP_003401864.1.61592 WP_003401864.1.6163 WP_003401864.1.61655 WP_003401864.1.61665 WP_003401864.1.61669 WP_003401864.1.61682 WP_003401864.1.61719 WP_003401864.1.61728 WP_003401864.1.61750 WP_003401864.1.61754 WP_003401864.1.61755 WP_003401864.1.61757 WP_003401864.1.61778 WP_003401864.1.6179 WP_003401864.1.61793 WP_003401864.1.61816 WP_003401864.1.61842 WP_003401864.1.61850 WP_003401864.1.61862 WP_003401864.1.61865 WP_003401864.1.61868 WP_003401864.1.61911 WP_003401864.1.61925 WP_003401864.1.61941 WP_003401864.1.61953 WP_003401864.1.61979 WP_003401864.1.61986 WP_003401864.1.61987 WP_003401864.1.61998 WP_003401864.1.62021 WP_003401864.1.62087 WP_003401864.1.62089 WP_003401864.1.62101 WP_003401864.1.62104 WP_003401864.1.6211 WP_003401864.1.62132 WP_003401864.1.62162 WP_003401864.1.62225 WP_003401864.1.62230 WP_003401864.1.62238 WP_003401864.1.62249 WP_003401864.1.62270 WP_003401864.1.62281 WP_003401864.1.62307 WP_003401864.1.6231 WP_003401864.1.62359 WP_003401864.1.62360 WP_003401864.1.62371 WP_003401864.1.62379 WP_003401864.1.62395 WP_003401864.1.62408 WP_003401864.1.62449 WP_003401864.1.62468 WP_003401864.1.6248 WP_003401864.1.62508 WP_003401864.1.62565 WP_003401864.1.62594 WP_003401864.1.62606 WP_003401864.1.62616 WP_003401864.1.62666 WP_003401864.1.62687 WP_003401864.1.62715 WP_003401864.1.62730 WP_003401864.1.62761 WP_003401864.1.62766 WP_003401864.1.62786 WP_003401864.1.62813 WP_003401864.1.62839 WP_003401864.1.62841 WP_003401864.1.62909 WP_003401864.1.62936 WP_003401864.1.6294 WP_003401864.1.6295 WP_003401864.1.62962 WP_003401864.1.63007 WP_003401864.1.63019 WP_003401864.1.63032 WP_003401864.1.63037 WP_003401864.1.63064 WP_003401864.1.63066 WP_003401864.1.63072 WP_003401864.1.6308 WP_003401864.1.63081 WP_003401864.1.63096 WP_003401864.1.63106 WP_003401864.1.6314 WP_003401864.1.63144 WP_003401864.1.63154 WP_003401864.1.63160 WP_003401864.1.63161 WP_003401864.1.63166 WP_003401864.1.63175 WP_003401864.1.63194 WP_003401864.1.6322 WP_003401864.1.63222 WP_003401864.1.63247 WP_003401864.1.6328 WP_003401864.1.63291 WP_003401864.1.63312 WP_003401864.1.63317 WP_003401864.1.63331 WP_003401864.1.63373 WP_003401864.1.63384 WP_003401864.1.63403 WP_003401864.1.63424 WP_003401864.1.63428 WP_003401864.1.6345 WP_003401864.1.63464 WP_003401864.1.63483 WP_003401864.1.63502 WP_003401864.1.63504 WP_003401864.1.63522 WP_003401864.1.63530 WP_003401864.1.63538 WP_003401864.1.63564 WP_003401864.1.63567 WP_003401864.1.63596 WP_003401864.1.63600 WP_003401864.1.63623 WP_003401864.1.63624 WP_003401864.1.63625 WP_003401864.1.63627 WP_003401864.1.63654 WP_003401864.1.63662 WP_003401864.1.63711 WP_003401864.1.63734 WP_003401864.1.63807 WP_003401864.1.63819 WP_003401864.1.63844 WP_003401864.1.63888 WP_003401864.1.63913 WP_003401864.1.63915 WP_003401864.1.63918 WP_003401864.1.63961 WP_003401864.1.63970 WP_003401864.1.64000 WP_003401864.1.64027 WP_003401864.1.64058 WP_003401864.1.64065 WP_003401864.1.6407 WP_003401864.1.64082 WP_003401864.1.64091 WP_003401864.1.64102 WP_003401864.1.64104 WP_003401864.1.64119 WP_003401864.1.64169 WP_003401864.1.64219 WP_003401864.1.6422 WP_003401864.1.64223 WP_003401864.1.64228 WP_003401864.1.64235 WP_003401864.1.64249 WP_003401864.1.6427 WP_003401864.1.64278 WP_003401864.1.64287 WP_003401864.1.64414 WP_003401864.1.64419 WP_003401864.1.6443 WP_003401864.1.64480 WP_003401864.1.64497 WP_003401864.1.64511 WP_003401864.1.64513 WP_003401864.1.64514 WP_003401864.1.64515 WP_003401864.1.64522 WP_003401864.1.64526 WP_003401864.1.64543 WP_003401864.1.6456 WP_003401864.1.64567 WP_003401864.1.64588 WP_003401864.1.64589 WP_003401864.1.64594 WP_003401864.1.64595 WP_003401864.1.64608 WP_003401864.1.64619 WP_003401864.1.64629 WP_003401864.1.6464 WP_003401864.1.64664 WP_003401864.1.64672 WP_003401864.1.64680 WP_003401864.1.64682 WP_003401864.1.64727 WP_003401864.1.64729 WP_003401864.1.64774 WP_003401864.1.64776 WP_003401864.1.64802 WP_003401864.1.64832 WP_003401864.1.6486 WP_003401864.1.64870 WP_003401864.1.64898 WP_003401864.1.64922 WP_003401864.1.64924 WP_003401864.1.6493 WP_003401864.1.64937 WP_003401864.1.64941 WP_003401864.1.64966 WP_003401864.1.64973 WP_003401864.1.65001 WP_003401864.1.65026 WP_003401864.1.65053 WP_003401864.1.65070 WP_003401864.1.65079 WP_003401864.1.65102 WP_003401864.1.65157 WP_003401864.1.65181 WP_003401864.1.65212 WP_003401864.1.65229 WP_003401864.1.6523 WP_003401864.1.65253 WP_003401864.1.65289 WP_003401864.1.65291 WP_003401864.1.65315 WP_003401864.1.65329 WP_003401864.1.65359 WP_003401864.1.6536 WP_003401864.1.65374 WP_003401864.1.65386 WP_003401864.1.65414 WP_003401864.1.65416 WP_003401864.1.65433 WP_003401864.1.65455 WP_003401864.1.65467 WP_003401864.1.65488 WP_003401864.1.65529 WP_003401864.1.65539 WP_003401864.1.65583 WP_003401864.1.65612 WP_003401864.1.65623 WP_003401864.1.65635 WP_003401864.1.65637 WP_003401864.1.65648 WP_003401864.1.65686 WP_003401864.1.65688 WP_003401864.1.65707 WP_003401864.1.65733 WP_003401864.1.65746 WP_003401864.1.65747 WP_003401864.1.65759 WP_003401864.1.65816 WP_003401864.1.65830 WP_003401864.1.65858 WP_003401864.1.65862 WP_003401864.1.65869 WP_003401864.1.65893 WP_003401864.1.65929 WP_003401864.1.65932 WP_003401864.1.65958 WP_003401864.1.65974 WP_003401864.1.66004 WP_003401864.1.66013 WP_003401864.1.6606 WP_003401864.1.66089 WP_003401864.1.66149 WP_003401864.1.66151 WP_003401864.1.66229 WP_003401864.1.66276 WP_003401864.1.66293 WP_003401864.1.66297 WP_003401864.1.66323 WP_003401864.1.66325 WP_003401864.1.6633 WP_003401864.1.66334 WP_003401864.1.66367 WP_003401864.1.66394 WP_003401864.1.66396 WP_003401864.1.66451 WP_003401864.1.66455 WP_003401864.1.66457 WP_003401864.1.66460 WP_003401864.1.66464 WP_003401864.1.66466 WP_003401864.1.66504 WP_003401864.1.66544 WP_003401864.1.66558 WP_003401864.1.66580 WP_003401864.1.66582 WP_003401864.1.66612 WP_003401864.1.66615 WP_003401864.1.66617 WP_003401864.1.66635 WP_003401864.1.66656 WP_003401864.1.66663 WP_003401864.1.66675 WP_003401864.1.66715 WP_003401864.1.66762 WP_003401864.1.66776 WP_003401864.1.66808 WP_003401864.1.66817 WP_003401864.1.66819 WP_003401864.1.66826 WP_003401864.1.66830 WP_003401864.1.66842 WP_003401864.1.66868 WP_003401864.1.66878 WP_003401864.1.66880 WP_003401864.1.66893 WP_003401864.1.66961 WP_003401864.1.67005 WP_003401864.1.67044 WP_003401864.1.67089 WP_003401864.1.67098 WP_003401864.1.67146 WP_003401864.1.67170 WP_003401864.1.67197 WP_003401864.1.67198 WP_003401864.1.6720 WP_003401864.1.67207 WP_003401864.1.67218 WP_003401864.1.67225 WP_003401864.1.67231 WP_003401864.1.6724 WP_003401864.1.67257 WP_003401864.1.67298 WP_003401864.1.67307 WP_003401864.1.67324 WP_003401864.1.67332 WP_003401864.1.67346 WP_003401864.1.67354 WP_003401864.1.67360 WP_003401864.1.67381 WP_003401864.1.67396 WP_003401864.1.67417 WP_003401864.1.67422 WP_003401864.1.67453 WP_003401864.1.67459 WP_003401864.1.6746 WP_003401864.1.67481 WP_003401864.1.67482 WP_003401864.1.67496 WP_003401864.1.67499 WP_003401864.1.67516 WP_003401864.1.67523 WP_003401864.1.67536 WP_003401864.1.67575 WP_003401864.1.67587 WP_003401864.1.67598 WP_003401864.1.67600 WP_003401864.1.67602 WP_003401864.1.67630 WP_003401864.1.67679 WP_003401864.1.67692 WP_003401864.1.67744 WP_003401864.1.6775 WP_003401864.1.67750 WP_003401864.1.6777 WP_003401864.1.67809 WP_003401864.1.67816 WP_003401864.1.67844 WP_003401864.1.67848 WP_003401864.1.67870 WP_003401864.1.67888 WP_003401864.1.67915 WP_003401864.1.67945 WP_003401864.1.67949 WP_003401864.1.67980 WP_003401864.1.67982 WP_003401864.1.68022 WP_003401864.1.68029 WP_003401864.1.68037 WP_003401864.1.68038 WP_003401864.1.68045 WP_003401864.1.68057 WP_003401864.1.68083 WP_003401864.1.68088 WP_003401864.1.68106 WP_003401864.1.68110 WP_003401864.1.68153 WP_003401864.1.68164 WP_003401864.1.68169 WP_003401864.1.68193 WP_003401864.1.68212 WP_003401864.1.68227 WP_003401864.1.68243 WP_003401864.1.6825 WP_003401864.1.68297 WP_003401864.1.68309 WP_003401864.1.68325 WP_003401864.1.68329 WP_003401864.1.68340 WP_003401864.1.68384 WP_003401864.1.68388 WP_003401864.1.68429 WP_003401864.1.6843 WP_003401864.1.68433 WP_003401864.1.68444 WP_003401864.1.68484 WP_003401864.1.68518 WP_003401864.1.68569 WP_003401864.1.68576 WP_003401864.1.68580 WP_003401864.1.68586 WP_003401864.1.68623 WP_003401864.1.68624 WP_003401864.1.68637 WP_003401864.1.68646 WP_003401864.1.68667 WP_003401864.1.68669 WP_003401864.1.68672 WP_003401864.1.68684 WP_003401864.1.68704 WP_003401864.1.6872 WP_003401864.1.68730 WP_003401864.1.68734 WP_003401864.1.68748 WP_003401864.1.68754 WP_003401864.1.6876 WP_003401864.1.68761 WP_003401864.1.68763 WP_003401864.1.68766 WP_003401864.1.68774 WP_003401864.1.68796 WP_003401864.1.68824 WP_003401864.1.68833 WP_003401864.1.68841 WP_003401864.1.68859 WP_003401864.1.68876 WP_003401864.1.68906 WP_003401864.1.68916 WP_003401864.1.68945 WP_003401864.1.6896 WP_003401864.1.68981 WP_003401864.1.68984 WP_003401864.1.68997 WP_003401864.1.69008 WP_003401864.1.69076 WP_003401864.1.69079 WP_003401864.1.6908 WP_003401864.1.69082 WP_003401864.1.69178 WP_003401864.1.69181 WP_003401864.1.69208 WP_003401864.1.69231 WP_003401864.1.69256 WP_003401864.1.69342 WP_003401864.1.6935 WP_003401864.1.69369 WP_003401864.1.69374 WP_003401864.1.69398 WP_003401864.1.69401 WP_003401864.1.69426 WP_003401864.1.69427 WP_003401864.1.69429 WP_003401864.1.6949 WP_003401864.1.6951 WP_003401864.1.69511 WP_003401864.1.69526 WP_003401864.1.69528 WP_003401864.1.69547 WP_003401864.1.69581 WP_003401864.1.6960 WP_003401864.1.69617 WP_003401864.1.69634 WP_003401864.1.69647 WP_003401864.1.69659 WP_003401864.1.69682 WP_003401864.1.69684 WP_003401864.1.69686 WP_003401864.1.69707 WP_003401864.1.69723 WP_003401864.1.69736 WP_003401864.1.69778 WP_003401864.1.69800 WP_003401864.1.69802 WP_003401864.1.69845 WP_003401864.1.69873 WP_003401864.1.69898 WP_003401864.1.69913 WP_003401864.1.69925 WP_003401864.1.69931 WP_003401864.1.69938 WP_003401864.1.69955 WP_003401864.1.69957 WP_003401864.1.69981 WP_003401864.1.69990 WP_003401864.1.70 WP_003401864.1.70000 WP_003401864.1.70017 WP_003401864.1.70032 WP_003401864.1.70055 WP_003401864.1.70062 WP_003401864.1.70072 WP_003401864.1.70131 WP_003401864.1.70132 WP_003401864.1.7022 WP_003401864.1.70227 WP_003401864.1.70255 WP_003401864.1.70271 WP_003401864.1.70274 WP_003401864.1.7029 WP_003401864.1.70325 WP_003401864.1.70328 WP_003401864.1.70356 WP_003401864.1.70364 WP_003401864.1.70368 WP_003401864.1.70369 WP_003401864.1.70418 WP_003401864.1.70422 WP_003401864.1.70435 WP_003401864.1.70444 WP_003401864.1.70471 WP_003401864.1.70494 WP_003401864.1.70505 WP_003401864.1.70525 WP_003401864.1.70573 WP_003401864.1.70577 WP_003401864.1.70610 WP_003401864.1.70615 WP_003401864.1.70618 WP_003401864.1.70626 WP_003401864.1.70668 WP_003401864.1.70699 WP_003401864.1.70704 WP_003401864.1.70729 WP_003401864.1.70757 WP_003401864.1.70782 WP_003401864.1.70796 WP_003401864.1.70830 WP_003401864.1.70834 WP_003401864.1.7084 WP_003401864.1.70840 WP_003401864.1.70864 WP_003401864.1.70871 WP_003401864.1.70915 WP_003401864.1.70955 WP_003401864.1.70958 WP_003401864.1.70964 WP_003401864.1.71015 WP_003401864.1.71026 WP_003401864.1.71063 WP_003401864.1.71076 WP_003401864.1.71083 WP_003401864.1.7111 WP_003401864.1.71118 WP_003401864.1.71128 WP_003401864.1.7113 WP_003401864.1.71187 WP_003401864.1.71191 WP_003401864.1.71255 WP_003401864.1.71258 WP_003401864.1.71259 WP_003401864.1.71289 WP_003401864.1.71329 WP_003401864.1.71331 WP_003401864.1.71344 WP_003401864.1.71390 WP_003401864.1.71414 WP_003401864.1.71440 WP_003401864.1.71457 WP_003401864.1.7146 WP_003401864.1.71464 WP_003401864.1.71490 WP_003401864.1.71492 WP_003401864.1.71516 WP_003401864.1.71517 WP_003401864.1.71527 WP_003401864.1.71532 WP_003401864.1.71545 WP_003401864.1.71546 WP_003401864.1.71604 WP_003401864.1.71621 WP_003401864.1.71630 WP_003401864.1.71638 WP_003401864.1.71654 WP_003401864.1.71664 WP_003401864.1.71665 WP_003401864.1.71683 WP_003401864.1.71701 WP_003401864.1.71718 WP_003401864.1.71731 WP_003401864.1.71778 WP_003401864.1.71781 WP_003401864.1.71803 WP_003401864.1.71820 WP_003401864.1.71847 WP_003401864.1.7185 WP_003401864.1.71851 WP_003401864.1.71871 WP_003401864.1.71909 WP_003401864.1.71957 WP_003401864.1.71970 WP_003401864.1.72047 WP_003401864.1.72061 WP_003401864.1.72062 WP_003401864.1.72072 WP_003401864.1.72122 WP_003401864.1.72128 WP_003401864.1.72143 WP_003401864.1.7216 WP_003401864.1.72168 WP_003401864.1.72179 WP_003401864.1.72209 WP_003401864.1.72218 WP_003401864.1.72219 WP_003401864.1.72227 WP_003401864.1.7224 WP_003401864.1.72268 WP_003401864.1.72332 WP_003401864.1.72380 WP_003401864.1.72401 WP_003401864.1.72405 WP_003401864.1.72420 WP_003401864.1.72441 WP_003401864.1.72451 WP_003401864.1.72452 WP_003401864.1.72457 WP_003401864.1.72460 WP_003401864.1.72466 WP_003401864.1.72487 WP_003401864.1.72488 WP_003401864.1.72492 WP_003401864.1.72506 WP_003401864.1.72543 WP_003401864.1.7256 WP_003401864.1.72576 WP_003401864.1.72578 WP_003401864.1.72585 WP_003401864.1.72591 WP_003401864.1.72592 WP_003401864.1.72640 WP_003401864.1.7266 WP_003401864.1.72661 WP_003401864.1.72684 WP_003401864.1.72739 WP_003401864.1.72744 WP_003401864.1.72755 WP_003401864.1.72759 WP_003401864.1.72784 WP_003401864.1.72792 WP_003401864.1.72826 WP_003401864.1.72831 WP_003401864.1.72852 WP_003401864.1.72853 WP_003401864.1.72879 WP_003401864.1.72880 WP_003401864.1.72938 WP_003401864.1.72954 WP_003401864.1.72957 WP_003401864.1.72959 WP_003401864.1.72973 WP_003401864.1.7298 WP_003401864.1.72982 WP_003401864.1.72988 WP_003401864.1.73006 WP_003401864.1.73013 WP_003401864.1.73025 WP_003401864.1.73028 WP_003401864.1.73042 WP_003401864.1.73045 WP_003401864.1.73092 WP_003401864.1.73118 WP_003401864.1.7312 WP_003401864.1.73127 WP_003401864.1.73134 WP_003401864.1.73150 WP_003401864.1.73154 WP_003401864.1.73163 WP_003401864.1.73182 WP_003401864.1.73205 WP_003401864.1.7321 WP_003401864.1.73310 WP_003401864.1.73365 WP_003401864.1.73391 WP_003401864.1.73404 WP_003401864.1.73424 WP_003401864.1.73436 WP_003401864.1.73445 WP_003401864.1.73453 WP_003401864.1.73465 WP_003401864.1.73466 WP_003401864.1.73470 WP_003401864.1.73471 WP_003401864.1.73478 WP_003401864.1.73482 WP_003401864.1.73507 WP_003401864.1.73532 WP_003401864.1.73550 WP_003401864.1.73564 WP_003401864.1.73623 WP_003401864.1.73629 WP_003401864.1.73644 WP_003401864.1.7366 WP_003401864.1.73661 WP_003401864.1.7368 WP_003401864.1.73688 WP_003401864.1.73723 WP_003401864.1.73744 WP_003401864.1.73750 WP_003401864.1.73760 WP_003401864.1.73774 WP_003401864.1.7379 WP_003401864.1.73840 WP_003401864.1.73876 WP_003401864.1.7389 WP_003401864.1.73986 WP_003401864.1.74016 WP_003401864.1.74039 WP_003401864.1.74083 WP_003401864.1.74101 WP_003401864.1.74107 WP_003401864.1.74120 WP_003401864.1.74129 WP_003401864.1.74144 WP_003401864.1.74190 WP_003401864.1.74210 WP_003401864.1.7423 WP_003401864.1.74259 WP_003401864.1.74269 WP_003401864.1.74282 WP_003401864.1.74291 WP_003401864.1.74296 WP_003401864.1.74304 WP_003401864.1.7432 WP_003401864.1.74347 WP_003401864.1.7436 WP_003401864.1.74378 WP_003401864.1.74382 WP_003401864.1.74395 WP_003401864.1.74400 WP_003401864.1.74401 WP_003401864.1.74432 WP_003401864.1.74442 WP_003401864.1.74477 WP_003401864.1.74487 WP_003401864.1.74499 WP_003401864.1.74504 WP_003401864.1.74511 WP_003401864.1.74523 WP_003401864.1.74525 WP_003401864.1.74551 WP_003401864.1.74641 WP_003401864.1.74653 WP_003401864.1.74683 WP_003401864.1.7469 WP_003401864.1.74725 WP_003401864.1.74760 WP_003401864.1.74786 WP_003401864.1.74809 WP_003401864.1.74820 WP_003401864.1.74870 WP_003401864.1.74881 WP_003401864.1.74888 WP_003401864.1.74952 WP_003401864.1.7496 WP_003401864.1.74988 WP_003401864.1.75043 WP_003401864.1.75045 WP_003401864.1.75055 WP_003401864.1.75078 WP_003401864.1.75081 WP_003401864.1.75120 WP_003401864.1.75163 WP_003401864.1.75188 WP_003401864.1.75200 WP_003401864.1.75202 WP_003401864.1.75234 WP_003401864.1.75239 WP_003401864.1.75250 WP_003401864.1.75263 WP_003401864.1.75281 WP_003401864.1.75342 WP_003401864.1.7535 WP_003401864.1.75376 WP_003401864.1.75391 WP_003401864.1.75395 WP_003401864.1.75441 WP_003401864.1.75510 WP_003401864.1.75581 WP_003401864.1.75598 WP_003401864.1.75635 WP_003401864.1.75645 WP_003401864.1.75665 WP_003401864.1.75671 WP_003401864.1.75741 WP_003401864.1.75749 WP_003401864.1.75772 WP_003401864.1.75774 WP_003401864.1.75811 WP_003401864.1.7585 WP_003401864.1.75864 WP_003401864.1.75868 WP_003401864.1.75878 WP_003401864.1.75927 WP_003401864.1.75946 WP_003401864.1.75968 WP_003401864.1.75974 WP_003401864.1.76007 WP_003401864.1.76016 WP_003401864.1.76037 WP_003401864.1.76045 WP_003401864.1.76052 WP_003401864.1.76058 WP_003401864.1.76064 WP_003401864.1.76110 WP_003401864.1.76126 WP_003401864.1.76133 WP_003401864.1.76138 WP_003401864.1.76157 WP_003401864.1.76172 WP_003401864.1.76177 WP_003401864.1.76183 WP_003401864.1.76209 WP_003401864.1.76239 WP_003401864.1.76272 WP_003401864.1.76277 WP_003401864.1.76280 WP_003401864.1.76281 WP_003401864.1.76291 WP_003401864.1.76297 WP_003401864.1.76360 WP_003401864.1.76379 WP_003401864.1.76403 WP_003401864.1.76413 WP_003401864.1.76427 WP_003401864.1.76436 WP_003401864.1.76442 WP_003401864.1.76443 WP_003401864.1.76521 WP_003401864.1.76533 WP_003401864.1.76616 WP_003401864.1.76625 WP_003401864.1.76629 WP_003401864.1.76635 WP_003401864.1.76638 WP_003401864.1.76639 WP_003401864.1.76640 WP_003401864.1.76644 WP_003401864.1.76677 WP_003401864.1.76678 WP_003401864.1.76679 WP_003401864.1.76734 WP_003401864.1.76744 WP_003401864.1.76750 WP_003401864.1.76754 WP_003401864.1.76757 WP_003401864.1.76781 WP_003401864.1.76818 WP_003401864.1.76824 WP_003401864.1.76835 WP_003401864.1.76873 WP_003401864.1.76881 WP_003401864.1.76888 WP_003401864.1.76900 WP_003401864.1.7691 WP_003401864.1.76947 WP_003401864.1.76954 WP_003401864.1.76955 WP_003401864.1.76963 WP_003401864.1.76976 WP_003401864.1.770 WP_003401864.1.77000 WP_003401864.1.77008 WP_003401864.1.77021 WP_003401864.1.77056 WP_003401864.1.77065 WP_003401864.1.77075 WP_003401864.1.77093 WP_003401864.1.77107 WP_003401864.1.77115 WP_003401864.1.77118 WP_003401864.1.77125 WP_003401864.1.77141 WP_003401864.1.77142 WP_003401864.1.77166 WP_003401864.1.77250 WP_003401864.1.77252 WP_003401864.1.77260 WP_003401864.1.77266 WP_003401864.1.77280 WP_003401864.1.77285 WP_003401864.1.77312 WP_003401864.1.77348 WP_003401864.1.77351 WP_003401864.1.77352 WP_003401864.1.77361 WP_003401864.1.774 WP_003401864.1.7740 WP_003401864.1.77404 WP_003401864.1.77425 WP_003401864.1.77463 WP_003401864.1.77474 WP_003401864.1.77484 WP_003401864.1.77491 WP_003401864.1.77499 WP_003401864.1.77510 WP_003401864.1.77530 WP_003401864.1.77554 WP_003401864.1.77559 WP_003401864.1.77599 WP_003401864.1.7762 WP_003401864.1.77627 WP_003401864.1.77649 WP_003401864.1.77654 WP_003401864.1.7766 WP_003401864.1.77667 WP_003401864.1.77704 WP_003401864.1.77706 WP_003401864.1.77726 WP_003401864.1.77774 WP_003401864.1.7778 WP_003401864.1.77790 WP_003401864.1.77809 WP_003401864.1.77820 WP_003401864.1.77843 WP_003401864.1.77855 WP_003401864.1.77868 WP_003401864.1.77879 WP_003401864.1.77890 WP_003401864.1.77909 WP_003401864.1.77911 WP_003401864.1.77931 WP_003401864.1.77984 WP_003401864.1.78020 WP_003401864.1.78075 WP_003401864.1.78084 WP_003401864.1.78086 WP_003401864.1.7809 WP_003401864.1.78098 WP_003401864.1.78105 WP_003401864.1.78113 WP_003401864.1.78136 WP_003401864.1.78162 WP_003401864.1.7817 WP_003401864.1.78200 WP_003401864.1.78216 WP_003401864.1.78236 WP_003401864.1.78238 WP_003401864.1.78322 WP_003401864.1.78338 WP_003401864.1.7836 WP_003401864.1.78360 WP_003401864.1.78386 WP_003401864.1.78429 WP_003401864.1.78435 WP_003401864.1.7844 WP_003401864.1.78459 WP_003401864.1.78488 WP_003401864.1.7849 WP_003401864.1.78499 WP_003401864.1.785 WP_003401864.1.78516 WP_003401864.1.78526 WP_003401864.1.78538 WP_003401864.1.78544 WP_003401864.1.78545 WP_003401864.1.78547 WP_003401864.1.78574 WP_003401864.1.78580 WP_003401864.1.7860 WP_003401864.1.78620 WP_003401864.1.78646 WP_003401864.1.78648 WP_003401864.1.78649 WP_003401864.1.78657 WP_003401864.1.78659 WP_003401864.1.7869 WP_003401864.1.78692 WP_003401864.1.78760 WP_003401864.1.78766 WP_003401864.1.78776 WP_003401864.1.78778 WP_003401864.1.78784 WP_003401864.1.78788 WP_003401864.1.78790 WP_003401864.1.78793 WP_003401864.1.78848 WP_003401864.1.78860 WP_003401864.1.7887 WP_003401864.1.78884 WP_003401864.1.78932 WP_003401864.1.78969 WP_003401864.1.78977 WP_003401864.1.78980 WP_003401864.1.79005 WP_003401864.1.79016 WP_003401864.1.79033 WP_003401864.1.79064 WP_003401864.1.79066 WP_003401864.1.79068 WP_003401864.1.79077 WP_003401864.1.79095 WP_003401864.1.79112 WP_003401864.1.79122 WP_003401864.1.79145 WP_003401864.1.79152 WP_003401864.1.79163 WP_003401864.1.79182 WP_003401864.1.79198 WP_003401864.1.79213 WP_003401864.1.79218 WP_003401864.1.79268 WP_003401864.1.79273 WP_003401864.1.79278 WP_003401864.1.79290 WP_003401864.1.79319 WP_003401864.1.79325 WP_003401864.1.79326 WP_003401864.1.7933 WP_003401864.1.79330 WP_003401864.1.79339 WP_003401864.1.79394 WP_003401864.1.79399 WP_003401864.1.79413 WP_003401864.1.79422 WP_003401864.1.79445 WP_003401864.1.79447 WP_003401864.1.79455 WP_003401864.1.79471 WP_003401864.1.79480 WP_003401864.1.79482 WP_003401864.1.79488 WP_003401864.1.79500 WP_003401864.1.79502 WP_003401864.1.79508 WP_003401864.1.79514 WP_003401864.1.79561 WP_003401864.1.79565 WP_003401864.1.79578 WP_003401864.1.79588 WP_003401864.1.79598 WP_003401864.1.79615 WP_003401864.1.79684 WP_003401864.1.79698 WP_003401864.1.797 WP_003401864.1.79744 WP_003401864.1.79784 WP_003401864.1.79802 WP_003401864.1.79806 WP_003401864.1.79826 WP_003401864.1.79828 WP_003401864.1.79863 WP_003401864.1.79881 WP_003401864.1.79885 WP_003401864.1.79898 WP_003401864.1.7990 WP_003401864.1.79900 WP_003401864.1.79947 WP_003401864.1.79948 WP_003401864.1.7995 WP_003401864.1.7997 WP_003401864.1.80004 WP_003401864.1.80015 WP_003401864.1.80022 WP_003401864.1.80030 WP_003401864.1.80054 WP_003401864.1.80084 WP_003401864.1.80099 WP_003401864.1.80129 WP_003401864.1.80177 WP_003401864.1.80234 WP_003401864.1.8026 WP_003401864.1.80275 WP_003401864.1.8029 WP_003401864.1.80299 WP_003401864.1.80300 WP_003401864.1.80304 WP_003401864.1.80326 WP_003401864.1.80351 WP_003401864.1.8037 WP_003401864.1.80370 WP_003401864.1.80387 WP_003401864.1.80399 WP_003401864.1.8044 WP_003401864.1.80451 WP_003401864.1.80458 WP_003401864.1.80461 WP_003401864.1.80490 WP_003401864.1.80503 WP_003401864.1.80507 WP_003401864.1.80552 WP_003401864.1.80576 WP_003401864.1.80588 WP_003401864.1.80599 WP_003401864.1.8060 WP_003401864.1.80624 WP_003401864.1.80636 WP_003401864.1.80673 WP_003401864.1.80711 WP_003401864.1.80714 WP_003401864.1.80743 WP_003401864.1.80784 WP_003401864.1.80853 WP_003401864.1.80918 WP_003401864.1.8093 WP_003401864.1.80967 WP_003401864.1.8097 WP_003401864.1.80988 WP_003401864.1.81007 WP_003401864.1.81013 WP_003401864.1.8105 WP_003401864.1.81059 WP_003401864.1.81063 WP_003401864.1.81066 WP_003401864.1.81075 WP_003401864.1.81091 WP_003401864.1.81119 WP_003401864.1.81125 WP_003401864.1.81136 WP_003401864.1.81189 WP_003401864.1.81192 WP_003401864.1.812 WP_003401864.1.81249 WP_003401864.1.81250 WP_003401864.1.81264 WP_003401864.1.8128 WP_003401864.1.81287 WP_003401864.1.81297 WP_003401864.1.8138 WP_003401864.1.81407 WP_003401864.1.8143 WP_003401864.1.81439 WP_003401864.1.81505 WP_003401864.1.81529 WP_003401864.1.81538 WP_003401864.1.81541 WP_003401864.1.81560 WP_003401864.1.81561 WP_003401864.1.81567 WP_003401864.1.81583 WP_003401864.1.81686 WP_003401864.1.81712 WP_003401864.1.81720 WP_003401864.1.81731 WP_003401864.1.81774 WP_003401864.1.81788 WP_003401864.1.81809 WP_003401864.1.81820 WP_003401864.1.81850 WP_003401864.1.81883 WP_003401864.1.81891 WP_003401864.1.81911 WP_003401864.1.81918 WP_003401864.1.82011 WP_003401864.1.82069 WP_003401864.1.82071 WP_003401864.1.82108 WP_003401864.1.82136 WP_003401864.1.82142 WP_003401864.1.82158 WP_003401864.1.8217 WP_003401864.1.82209 WP_003401864.1.82210 WP_003401864.1.82228 WP_003401864.1.82236 WP_003401864.1.82251 WP_003401864.1.82271 WP_003401864.1.82305 WP_003401864.1.82307 WP_003401864.1.82309 WP_003401864.1.82317 WP_003401864.1.8232 WP_003401864.1.82346 WP_003401864.1.82374 WP_003401864.1.82385 WP_003401864.1.82429 WP_003401864.1.82460 WP_003401864.1.82462 WP_003401864.1.82494 WP_003401864.1.82531 WP_003401864.1.82546 WP_003401864.1.82547 WP_003401864.1.82549 WP_003401864.1.82577 WP_003401864.1.82592 WP_003401864.1.82597 WP_003401864.1.82598 WP_003401864.1.82625 WP_003401864.1.82642 WP_003401864.1.82651 WP_003401864.1.82653 WP_003401864.1.82681 WP_003401864.1.82685 WP_003401864.1.8271 WP_003401864.1.82712 WP_003401864.1.8273 WP_003401864.1.82743 WP_003401864.1.82757 WP_003401864.1.82774 WP_003401864.1.82803 WP_003401864.1.82836 WP_003401864.1.82871 WP_003401864.1.82892 WP_003401864.1.82957 WP_003401864.1.82973 WP_003401864.1.82981 WP_003401864.1.82983 WP_003401864.1.83004 WP_003401864.1.83009 WP_003401864.1.83044 WP_003401864.1.83065 WP_003401864.1.83074 WP_003401864.1.83110 WP_003401864.1.83146 WP_003401864.1.83149 WP_003401864.1.83159 WP_003401864.1.8317 WP_003401864.1.83173 WP_003401864.1.83181 WP_003401864.1.83182 WP_003401864.1.83191 WP_003401864.1.83197 WP_003401864.1.83212 WP_003401864.1.8326 WP_003401864.1.83262 WP_003401864.1.83268 WP_003401864.1.83273 WP_003401864.1.83309 WP_003401864.1.83332 WP_003401864.1.83341 WP_003401864.1.83349 WP_003401864.1.8335 WP_003401864.1.83353 WP_003401864.1.83367 WP_003401864.1.83381 WP_003401864.1.83408 WP_003401864.1.83409 WP_003401864.1.83470 WP_003401864.1.83524 WP_003401864.1.83526 WP_003401864.1.8358 WP_003401864.1.83589 WP_003401864.1.83611 WP_003401864.1.83638 WP_003401864.1.83656 WP_003401864.1.83667 WP_003401864.1.83689 WP_003401864.1.83692 WP_003401864.1.83704 WP_003401864.1.83705 WP_003401864.1.83766 WP_003401864.1.83802 WP_003401864.1.83805 WP_003401864.1.83839 WP_003401864.1.83850 WP_003401864.1.83861 WP_003401864.1.83884 WP_003401864.1.83920 WP_003401864.1.83929 WP_003401864.1.83930 WP_003401864.1.83975 WP_003401864.1.83991 WP_003401864.1.8400 WP_003401864.1.84027 WP_003401864.1.8404 WP_003401864.1.84057 WP_003401864.1.84070 WP_003401864.1.8409 WP_003401864.1.84112 WP_003401864.1.84146 WP_003401864.1.8415 WP_003401864.1.84176 WP_003401864.1.84186 WP_003401864.1.84192 WP_003401864.1.84228 WP_003401864.1.8424 WP_003401864.1.84244 WP_003401864.1.84259 WP_003401864.1.8426 WP_003401864.1.84277 WP_003401864.1.84287 WP_003401864.1.8434 WP_003401864.1.84388 WP_003401864.1.84408 WP_003401864.1.84409 WP_003401864.1.84438 WP_003401864.1.84460 WP_003401864.1.84488 WP_003401864.1.84504 WP_003401864.1.84525 WP_003401864.1.84620 WP_003401864.1.84623 WP_003401864.1.84641 WP_003401864.1.84655 WP_003401864.1.84666 WP_003401864.1.84670 WP_003401864.1.84739 WP_003401864.1.84748 WP_003401864.1.84766 WP_003401864.1.84772 WP_003401864.1.84774 WP_003401864.1.848 WP_003401864.1.84812 WP_003401864.1.84836 WP_003401864.1.84839 WP_003401864.1.84846 WP_003401864.1.84873 WP_003401864.1.84911 WP_003401864.1.84938 WP_003401864.1.84968 WP_003401864.1.84973 WP_003401864.1.84981 WP_003401864.1.84985 WP_003401864.1.8503 WP_003401864.1.85038 WP_003401864.1.85041 WP_003401864.1.85043 WP_003401864.1.8505 WP_003401864.1.85074 WP_003401864.1.8509 WP_003401864.1.8512 WP_003401864.1.85148 WP_003401864.1.8518 WP_003401864.1.8522 WP_003401864.1.85242 WP_003401864.1.85276 WP_003401864.1.85284 WP_003401864.1.85314 WP_003401864.1.85319 WP_003401864.1.85330 WP_003401864.1.85341 WP_003401864.1.85346 WP_003401864.1.8535 WP_003401864.1.85363 WP_003401864.1.85377 WP_003401864.1.85387 WP_003401864.1.85399 WP_003401864.1.85458 WP_003401864.1.8546 WP_003401864.1.85464 WP_003401864.1.85478 WP_003401864.1.85480 WP_003401864.1.85488 WP_003401864.1.85495 WP_003401864.1.85551 WP_003401864.1.85557 WP_003401864.1.85577 WP_003401864.1.85597 WP_003401864.1.85599 WP_003401864.1.85610 WP_003401864.1.8563 WP_003401864.1.85648 WP_003401864.1.85679 WP_003401864.1.85704 WP_003401864.1.85717 WP_003401864.1.85727 WP_003401864.1.85737 WP_003401864.1.85763 WP_003401864.1.85808 WP_003401864.1.85819 WP_003401864.1.85820 WP_003401864.1.85823 WP_003401864.1.85832 WP_003401864.1.8586 WP_003401864.1.85872 WP_003401864.1.85894 WP_003401864.1.85913 WP_003401864.1.85953 WP_003401864.1.85986 WP_003401864.1.86000 WP_003401864.1.86024 WP_003401864.1.86025 WP_003401864.1.86032 WP_003401864.1.86048 WP_003401864.1.86052 WP_003401864.1.86103 WP_003401864.1.86122 WP_003401864.1.86124 WP_003401864.1.86160 WP_003401864.1.86164 WP_003401864.1.86168 WP_003401864.1.86190 WP_003401864.1.86204 WP_003401864.1.86208 WP_003401864.1.86235 WP_003401864.1.86249 WP_003401864.1.86260 WP_003401864.1.86290 WP_003401864.1.863 WP_003401864.1.86327 WP_003401864.1.86334 WP_003401864.1.86368 WP_003401864.1.86377 WP_003401864.1.86425 WP_003401864.1.86459 WP_003401864.1.8649 WP_003401864.1.86499 WP_003401864.1.86520 WP_003401864.1.86561 WP_003401864.1.86568 WP_003401864.1.86575 WP_003401864.1.86584 WP_003401864.1.86605 WP_003401864.1.86626 WP_003401864.1.86648 WP_003401864.1.8666 WP_003401864.1.86684 WP_003401864.1.86696 WP_003401864.1.86705 WP_003401864.1.86718 WP_003401864.1.86725 WP_003401864.1.86757 WP_003401864.1.86766 WP_003401864.1.86801 WP_003401864.1.86814 WP_003401864.1.86820 WP_003401864.1.86825 WP_003401864.1.86834 WP_003401864.1.8685 WP_003401864.1.86851 WP_003401864.1.86855 WP_003401864.1.86867 WP_003401864.1.86877 WP_003401864.1.86883 WP_003401864.1.8689 WP_003401864.1.86892 WP_003401864.1.86941 WP_003401864.1.86950 WP_003401864.1.86962 WP_003401864.1.86963 WP_003401864.1.86979 WP_003401864.1.8700 WP_003401864.1.87001 WP_003401864.1.87002 WP_003401864.1.87031 WP_003401864.1.87116 WP_003401864.1.87117 WP_003401864.1.8714 WP_003401864.1.87162 WP_003401864.1.87178 WP_003401864.1.87209 WP_003401864.1.87240 WP_003401864.1.87266 WP_003401864.1.87273 WP_003401864.1.87275 WP_003401864.1.8733 WP_003401864.1.87345 WP_003401864.1.87369 WP_003401864.1.87401 WP_003401864.1.87404 WP_003401864.1.87406 WP_003401864.1.87409 WP_003401864.1.87444 WP_003401864.1.87446 WP_003401864.1.87459 WP_003401864.1.87472 WP_003401864.1.87489 WP_003401864.1.87494 WP_003401864.1.87496 WP_003401864.1.87588 WP_003401864.1.87617 WP_003401864.1.87619 WP_003401864.1.87634 WP_003401864.1.87643 WP_003401864.1.8765 WP_003401864.1.87650 WP_003401864.1.87654 WP_003401864.1.87658 WP_003401864.1.87665 WP_003401864.1.87676 WP_003401864.1.87677 WP_003401864.1.87684 WP_003401864.1.87692 WP_003401864.1.87707 WP_003401864.1.87732 WP_003401864.1.87784 WP_003401864.1.87796 WP_003401864.1.87809 WP_003401864.1.87817 WP_003401864.1.87827 WP_003401864.1.87831 WP_003401864.1.87835 WP_003401864.1.87866 WP_003401864.1.8789 WP_003401864.1.87911 WP_003401864.1.87924 WP_003401864.1.87955 WP_003401864.1.87956 WP_003401864.1.87991 WP_003401864.1.88 WP_003401864.1.88002 WP_003401864.1.88037 WP_003401864.1.88039 WP_003401864.1.88072 WP_003401864.1.88077 WP_003401864.1.88180 WP_003401864.1.88191 WP_003401864.1.88205 WP_003401864.1.88217 WP_003401864.1.88219 WP_003401864.1.88245 WP_003401864.1.88253 WP_003401864.1.88294 WP_003401864.1.88315 WP_003401864.1.88316 WP_003401864.1.88320 WP_003401864.1.88338 WP_003401864.1.8840 WP_003401864.1.88437 WP_003401864.1.88453 WP_003401864.1.88469 WP_003401864.1.88489 WP_003401864.1.88507 WP_003401864.1.88521 WP_003401864.1.88530 WP_003401864.1.88537 WP_003401864.1.88541 WP_003401864.1.88592 WP_003401864.1.88618 WP_003401864.1.8862 WP_003401864.1.88625 WP_003401864.1.88632 WP_003401864.1.88634 WP_003401864.1.88649 WP_003401864.1.8870 WP_003401864.1.88737 WP_003401864.1.88756 WP_003401864.1.888 WP_003401864.1.88824 WP_003401864.1.88886 WP_003401864.1.88965 WP_003401864.1.88985 WP_003401864.1.8902 WP_003401864.1.89025 WP_003401864.1.89041 WP_003401864.1.89046 WP_003401864.1.89082 WP_003401864.1.89162 WP_003401864.1.89168 WP_003401864.1.8917 WP_003401864.1.89193 WP_003401864.1.89205 WP_003401864.1.89207 WP_003401864.1.89225 WP_003401864.1.8925 WP_003401864.1.89277 WP_003401864.1.89286 WP_003401864.1.89293 WP_003401864.1.89320 WP_003401864.1.8935 WP_003401864.1.89371 WP_003401864.1.89378 WP_003401864.1.89392 WP_003401864.1.89406 WP_003401864.1.8943 WP_003401864.1.89451 WP_003401864.1.89453 WP_003401864.1.89473 WP_003401864.1.89475 WP_003401864.1.89483 WP_003401864.1.895 WP_003401864.1.89513 WP_003401864.1.89517 WP_003401864.1.89522 WP_003401864.1.8954 WP_003401864.1.89543 WP_003401864.1.89567 WP_003401864.1.8957 WP_003401864.1.89572 WP_003401864.1.89589 WP_003401864.1.89607 WP_003401864.1.89613 WP_003401864.1.89625 WP_003401864.1.89648 WP_003401864.1.8967 WP_003401864.1.89670 WP_003401864.1.89676 WP_003401864.1.89729 WP_003401864.1.89739 WP_003401864.1.89762 WP_003401864.1.89802 WP_003401864.1.89808 WP_003401864.1.8982 WP_003401864.1.89829 WP_003401864.1.89831 WP_003401864.1.89844 WP_003401864.1.89849 WP_003401864.1.8989 WP_003401864.1.89901 WP_003401864.1.89903 WP_003401864.1.89909 WP_003401864.1.89922 WP_003401864.1.89926 WP_003401864.1.89963 WP_003401864.1.89971 WP_003401864.1.8998 WP_003401864.1.89987 WP_003401864.1.900 WP_003401864.1.90048 WP_003401864.1.9007 WP_003401864.1.90080 WP_003401864.1.90130 WP_003401864.1.90134 WP_003401864.1.90137 WP_003401864.1.90157 WP_003401864.1.90184 WP_003401864.1.90199 WP_003401864.1.90231 WP_003401864.1.90245 WP_003401864.1.90308 WP_003401864.1.90322 WP_003401864.1.90328 WP_003401864.1.90372 WP_003401864.1.90439 WP_003401864.1.90481 WP_003401864.1.90499 WP_003401864.1.9050 WP_003401864.1.90527 WP_003401864.1.90550 WP_003401864.1.90560 WP_003401864.1.90612 WP_003401864.1.90640 WP_003401864.1.90687 WP_003401864.1.90691 WP_003401864.1.90711 WP_003401864.1.90722 WP_003401864.1.90744 WP_003401864.1.90756 WP_003401864.1.90767 WP_003401864.1.90771 WP_003401864.1.90785 WP_003401864.1.90788 WP_003401864.1.90800 WP_003401864.1.90810 WP_003401864.1.90816 WP_003401864.1.90819 WP_003401864.1.9082 WP_003401864.1.90831 WP_003401864.1.90884 WP_003401864.1.90899 WP_003401864.1.90906 WP_003401864.1.90958 WP_003401864.1.90976 WP_003401864.1.90977 WP_003401864.1.90987 WP_003401864.1.9102 WP_003401864.1.91026 WP_003401864.1.91032 WP_003401864.1.91043 WP_003401864.1.91053 WP_003401864.1.91082 WP_003401864.1.91106 WP_003401864.1.91112 WP_003401864.1.91144 WP_003401864.1.91151 WP_003401864.1.91157 WP_003401864.1.91167 WP_003401864.1.91169 WP_003401864.1.91192 WP_003401864.1.91201 WP_003401864.1.91207 WP_003401864.1.91208 WP_003401864.1.91211 WP_003401864.1.91214 WP_003401864.1.91230 WP_003401864.1.91244 WP_003401864.1.91251 WP_003401864.1.91260 WP_003401864.1.91265 WP_003401864.1.9128 WP_003401864.1.91284 WP_003401864.1.91294 WP_003401864.1.91303 WP_003401864.1.91322 WP_003401864.1.91352 WP_003401864.1.91386 WP_003401864.1.9139 WP_003401864.1.91398 WP_003401864.1.91411 WP_003401864.1.91430 WP_003401864.1.91436 WP_003401864.1.91483 WP_003401864.1.91496 WP_003401864.1.91507 WP_003401864.1.91508 WP_003401864.1.91576 WP_003401864.1.91589 WP_003401864.1.91694 WP_003401864.1.91695 WP_003401864.1.91713 WP_003401864.1.91716 WP_003401864.1.91717 WP_003401864.1.91728 WP_003401864.1.91743 WP_003401864.1.91759 WP_003401864.1.91784 WP_003401864.1.91785 WP_003401864.1.91802 WP_003401864.1.91822 WP_003401864.1.91828 WP_003401864.1.9189 WP_003401864.1.91896 WP_003401864.1.9190 WP_003401864.1.91915 WP_003401864.1.91931 WP_003401864.1.91937 WP_003401864.1.91944 WP_003401864.1.91953 WP_003401864.1.91957 WP_003401864.1.91976 WP_003401864.1.91978 WP_003401864.1.92021 WP_003401864.1.92083 WP_003401864.1.92127 WP_003401864.1.92144 WP_003401864.1.92150 WP_003401864.1.92153 WP_003401864.1.92190 WP_003401864.1.92192 WP_003401864.1.92220 WP_003401864.1.92221 WP_003401864.1.92222 WP_003401864.1.92273 WP_003401864.1.92289 WP_003401864.1.9229 WP_003401864.1.92294 WP_003401864.1.92300 WP_003401864.1.92317 WP_003401864.1.92334 WP_003401864.1.92338 WP_003401864.1.92345 WP_003401864.1.92356 WP_003401864.1.92364 WP_003401864.1.92380 WP_003401864.1.92416 WP_003401864.1.92428 WP_003401864.1.92447 WP_003401864.1.92456 WP_003401864.1.92467 WP_003401864.1.92471 WP_003401864.1.92490 WP_003401864.1.92508 WP_003401864.1.9251 WP_003401864.1.92511 WP_003401864.1.92523 WP_003401864.1.92527 WP_003401864.1.92536 WP_003401864.1.92592 WP_003401864.1.92597 WP_003401864.1.92603 WP_003401864.1.92606 WP_003401864.1.92610 WP_003401864.1.92613 WP_003401864.1.9263 WP_003401864.1.9265 WP_003401864.1.92650 WP_003401864.1.92677 WP_003401864.1.92685 WP_003401864.1.92689 WP_003401864.1.92690 WP_003401864.1.92706 WP_003401864.1.92714 WP_003401864.1.92736 WP_003401864.1.9274 WP_003401864.1.92752 WP_003401864.1.92760 WP_003401864.1.92777 WP_003401864.1.92803 WP_003401864.1.92833 WP_003401864.1.92856 WP_003401864.1.92881 WP_003401864.1.92892 WP_003401864.1.92907 WP_003401864.1.92908 WP_003401864.1.9291 WP_003401864.1.92917 WP_003401864.1.92996 WP_003401864.1.93006 WP_003401864.1.93008 WP_003401864.1.93009 WP_003401864.1.93015 WP_003401864.1.93043 WP_003401864.1.9307 WP_003401864.1.93083 WP_003401864.1.93097 WP_003401864.1.93137 WP_003401864.1.93192 WP_003401864.1.93203 WP_003401864.1.93212 WP_003401864.1.93234 WP_003401864.1.93245 WP_003401864.1.93257 WP_003401864.1.93265 WP_003401864.1.93297 WP_003401864.1.93328 WP_003401864.1.93337 WP_003401864.1.93343 WP_003401864.1.93349 WP_003401864.1.93363 WP_003401864.1.93377 WP_003401864.1.9338 WP_003401864.1.93407 WP_003401864.1.93417 WP_003401864.1.93419 WP_003401864.1.93426 WP_003401864.1.93443 WP_003401864.1.93447 WP_003401864.1.93470 WP_003401864.1.93483 WP_003401864.1.93495 WP_003401864.1.93499 WP_003401864.1.93516 WP_003401864.1.93536 WP_003401864.1.93544 WP_003401864.1.93555 WP_003401864.1.93560 WP_003401864.1.93564 WP_003401864.1.9357 WP_003401864.1.93576 WP_003401864.1.93588 WP_003401864.1.9363 WP_003401864.1.93645 WP_003401864.1.93649 WP_003401864.1.93659 WP_003401864.1.93677 WP_003401864.1.9368 WP_003401864.1.93689 WP_003401864.1.93693 WP_003401864.1.93698 WP_003401864.1.93706 WP_003401864.1.9371 WP_003401864.1.93823 WP_003401864.1.9388 WP_003401864.1.93894 WP_003401864.1.93903 WP_003401864.1.93907 WP_003401864.1.93913 WP_003401864.1.93946 WP_003401864.1.93950 WP_003401864.1.93954 WP_003401864.1.93988 WP_003401864.1.9407 WP_003401864.1.94143 WP_003401864.1.94154 WP_003401864.1.94184 WP_003401864.1.94204 WP_003401864.1.94205 WP_003401864.1.94226 WP_003401864.1.94231 WP_003401864.1.94256 WP_003401864.1.94261 WP_003401864.1.94281 WP_003401864.1.94292 WP_003401864.1.94297 WP_003401864.1.94326 WP_003401864.1.94392 WP_003401864.1.94416 WP_003401864.1.94421 WP_003401864.1.94456 WP_003401864.1.94470 WP_003401864.1.94480 WP_003401864.1.94495 WP_003401864.1.94511 WP_003401864.1.94525 WP_003401864.1.94528 WP_003401864.1.94564 WP_003401864.1.946 WP_003401864.1.94602 WP_003401864.1.94623 WP_003401864.1.94629 WP_003401864.1.9465 WP_003401864.1.94673 WP_003401864.1.94714 WP_003401864.1.94730 WP_003401864.1.94736 WP_003401864.1.94776 WP_003401864.1.94834 WP_003401864.1.94852 WP_003401864.1.94872 WP_003401864.1.9488 WP_003401864.1.94902 WP_003401864.1.94916 WP_003401864.1.94979 WP_003401864.1.94994 WP_003401864.1.94996 WP_003401864.1.94998 WP_003401864.1.95007 WP_003401864.1.95010 WP_003401864.1.95015 WP_003401864.1.95034 WP_003401864.1.95068 WP_003401864.1.95081 WP_003401864.1.95082 WP_003401864.1.9509 WP_003401864.1.95096 WP_003401864.1.95112 WP_003401864.1.95138 WP_003401864.1.9514 WP_003401864.1.95179 WP_003401864.1.95188 WP_003401864.1.95190 WP_003401864.1.95234 WP_003401864.1.95241 WP_003401864.1.95245 WP_003401864.1.95279 WP_003401864.1.9531 WP_003401864.1.95335 WP_003401864.1.95344 WP_003401864.1.9535 WP_003401864.1.95370 WP_003401864.1.95392 WP_003401864.1.95416 WP_003401864.1.95417 WP_003401864.1.95454 WP_003401864.1.95455 WP_003401864.1.95491 WP_003401864.1.95497 WP_003401864.1.95508 WP_003401864.1.95556 WP_003401864.1.95557 WP_003401864.1.95565 WP_003401864.1.95578 WP_003401864.1.95580 WP_003401864.1.95585 WP_003401864.1.95643 WP_003401864.1.95679 WP_003401864.1.95685 WP_003401864.1.95724 WP_003401864.1.95727 WP_003401864.1.95730 WP_003401864.1.95758 WP_003401864.1.95797 WP_003401864.1.95839 WP_003401864.1.9585 WP_003401864.1.9590 WP_003401864.1.95902 WP_003401864.1.95908 WP_003401864.1.95924 WP_003401864.1.95926 WP_003401864.1.95953 WP_003401864.1.95964 WP_003401864.1.95973 WP_003401864.1.96006 WP_003401864.1.9602 WP_003401864.1.96036 WP_003401864.1.96062 WP_003401864.1.96065 WP_003401864.1.96098 WP_003401864.1.96146 WP_003401864.1.96166 WP_003401864.1.96171 WP_003401864.1.96182 WP_003401864.1.96204 WP_003401864.1.96230 WP_003401864.1.96235 WP_003401864.1.96242 WP_003401864.1.96245 WP_003401864.1.96254 WP_003401864.1.96259 WP_003401864.1.96286 WP_003401864.1.96313 WP_003401864.1.96318 WP_003401864.1.96345 WP_003401864.1.96373 WP_003401864.1.96456 WP_003401864.1.96486 WP_003401864.1.96560 WP_003401864.1.96569 WP_003401864.1.96573 WP_003401864.1.96575 WP_003401864.1.96576 WP_003401864.1.96611 WP_003401864.1.96621 WP_003401864.1.9667 WP_003401864.1.96681 WP_003401864.1.96726 WP_003401864.1.96733 WP_003401864.1.96742 WP_003401864.1.96754 WP_003401864.1.9678 WP_003401864.1.96832 WP_003401864.1.9685 WP_003401864.1.97008 WP_003401864.1.97009 WP_003401864.1.97056 WP_003401864.1.97087 WP_003401864.1.97094 WP_003401864.1.97096 WP_003401864.1.97099 WP_003401864.1.97108 WP_003401864.1.97113 WP_003401864.1.97122 WP_003401864.1.97127 WP_003401864.1.97129 WP_003401864.1.97136 WP_003401864.1.9716 WP_003401864.1.97176 WP_003401864.1.97222 WP_003401864.1.97223 WP_003401864.1.97237 WP_003401864.1.97242 WP_003401864.1.97270 WP_003401864.1.97283 WP_003401864.1.97296 WP_003401864.1.97321 WP_003401864.1.97325 WP_003401864.1.97330 WP_003401864.1.97366 WP_003401864.1.97376 WP_003401864.1.97380 WP_003401864.1.9739 WP_003401864.1.97462 WP_003401864.1.97517 WP_003401864.1.97519 WP_003401864.1.97535 WP_003401864.1.97540 WP_003401864.1.97545 WP_003401864.1.97546 WP_003401864.1.97550 WP_003401864.1.97568 WP_003401864.1.97577 WP_003401864.1.97584 WP_003401864.1.9759 WP_003401864.1.97591 WP_003401864.1.97596 WP_003401864.1.97609 WP_003401864.1.97618 WP_003401864.1.9763 WP_003401864.1.97669 WP_003401864.1.97673 WP_003401864.1.97700 WP_003401864.1.9773 WP_003401864.1.97730 WP_003401864.1.97740 WP_003401864.1.97751 WP_003401864.1.97754 WP_003401864.1.97797 WP_003401864.1.9782 WP_003401864.1.9784 WP_003401864.1.97888 WP_003401864.1.9790 WP_003401864.1.97951 WP_003401864.1.97958 WP_003401864.1.97966 WP_003401864.1.97977 WP_003401864.1.97979 WP_003401864.1.97995 WP_003401864.1.98018 WP_003401864.1.98034 WP_003401864.1.98052 WP_003401864.1.98071 WP_003401864.1.98072 WP_003401864.1.98113 WP_003401864.1.98114 WP_003401864.1.98128 WP_003401864.1.98181 WP_003401864.1.98188 WP_003401864.1.98189 WP_003401864.1.98213 WP_003401864.1.98225 WP_003401864.1.98291 WP_003401864.1.98335 WP_003401864.1.98350 WP_003401864.1.98395 WP_003401864.1.98412 WP_003401864.1.98441 WP_003401864.1.98443 WP_003401864.1.98462 WP_003401864.1.9848 WP_003401864.1.98482 WP_003401864.1.98486 WP_003401864.1.98488 WP_003401864.1.98503 WP_003401864.1.98516 WP_003401864.1.98524 WP_003401864.1.98536 WP_003401864.1.98541 WP_003401864.1.98566 WP_003401864.1.98576 WP_003401864.1.98590 WP_003401864.1.98594 WP_003401864.1.98599 WP_003401864.1.98629 WP_003401864.1.98645 WP_003401864.1.98646 WP_003401864.1.98649 WP_003401864.1.98656 WP_003401864.1.9867 WP_003401864.1.98674 WP_003401864.1.98697 WP_003401864.1.98701 WP_003401864.1.98739 WP_003401864.1.98749 WP_003401864.1.98765 WP_003401864.1.98770 WP_003401864.1.98777 WP_003401864.1.98778 WP_003401864.1.98802 WP_003401864.1.98838 WP_003401864.1.98850 WP_003401864.1.98906 WP_003401864.1.98935 WP_003401864.1.98948 WP_003401864.1.98953 WP_003401864.1.99000 WP_003401864.1.99023 WP_003401864.1.99030 WP_003401864.1.99037 WP_003401864.1.99055 WP_003401864.1.99062 WP_003401864.1.99086 WP_003401864.1.99115 WP_003401864.1.99117 WP_003401864.1.99161 WP_003401864.1.99176 WP_003401864.1.99205 WP_003401864.1.99211 WP_003401864.1.99216 WP_003401864.1.99222 WP_003401864.1.99251 WP_003401864.1.99269 WP_003401864.1.99294 WP_003401864.1.99312 WP_003401864.1.99315 WP_003401864.1.99316 WP_003401864.1.99322 WP_003401864.1.99328 WP_003401864.1.99365 WP_003401864.1.99368 WP_003401864.1.99379 WP_003401864.1.99396 WP_003401864.1.99402 WP_003401864.1.99404 WP_003401864.1.99419 WP_003401864.1.99438 WP_003401864.1.99460 WP_003401864.1.99468 WP_003401864.1.99473 WP_003401864.1.99513 WP_003401864.1.99529 WP_003401864.1.99548 WP_003401864.1.99572 WP_003401864.1.99575 WP_003401864.1.99578 WP_003401864.1.99605 WP_003401864.1.99609 WP_003401864.1.99617 WP_003401864.1.99635 WP_003401864.1.99650 WP_003401864.1.99672 WP_003401864.1.99701 WP_003401864.1.99716 WP_003401864.1.99740 WP_003401864.1.99745 WP_003401864.1.99749 WP_003401864.1.9976 WP_003401864.1.99798 WP_003401864.1.99817 WP_003401864.1.99832 WP_003401864.1.99847 WP_003401864.1.99852 WP_003401864.1.99886 WP_003401864.1.99897 WP_003401864.1.99899 WP_003401864.1.99915 WP_003401864.1.9993 WP_003401864.1.99982 WP_003401864.1.99991 gi|525673206|ref|YP_008224462.1| gi|15607512|ref|NP_214885.1| 233413.Mb0378c 336982.TBFG_10376 410289.BCG_0409c 419947.MRA_0380 478434.TBMG_00375 561275.JTY_0379 83331.MT0386 83332.Rv0371c gi|339630441|ref|YP_004722083.1| gi|375294579|ref|YP_005098846.1| gi|15607512|ref|NP_214885.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]