SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I6WYT7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  I6WYT7
Domain Number - Region: 145-290
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.000654
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I6WYT7
Sequence length 508
Comment (tr|I6WYT7|I6WYT7_MYCTU) Mce-family protein Mce2D {ECO:0000313|EMBL:CCP43331.1} KW=Complete proteome; Reference proteome OX=83332 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv). GN=Rv0592 OC=Mycobacterium; Mycobacterium tuberculosis complex.
Sequence
MSTIFDIRSLRLPKLSAKVVVVGGLVVVLAVVAAAAGARLYRKLTTTTVVAYFSEALALY
PGDKVQIMGVRVGSIDKIEPAGDKMRVTLHYSNKYQVPATATASILNPSLVASRTIQLSP
PYTGGPVLQDGAVIPIERTQVPVEWDQLRDSINGILRQLGPTERQPKGPFGDLIESAADN
LAGKGRQLNETLNSLSQALTALNEGRGDFVAITRSLALFVSALYQNDQQFVALNENLAEF
TDWFTKSDHDLADTVERIDDVLGTVRKFVSDNRSVLAADVNNLADATTTLVQPEPRDGLE
TALHVLPTYASNFNNLYYPLHSSLVGQFVFPNFANPIQLICSAIQAGSRLGYQESAELCA
QYLAPVLDALKFNYLPFGSNPFSSAATLPKEVAYSEERLRPPPGYKDTTVPGIFSRDTPF
SHGNHEPGWVVAPGMQGMQVQPFTANMLTPESLAELLGGPDIAPPPPGTNLPGPPNAYDE
SNPLPPPWYPQPASLPAAGATGQPGPGQ
Download sequence
Identical sequences A0A045IW96 A0A089QI98 A0A109SU40 A0A120IVM6 A0A197IWI8 A0A1S1BH40 A5TZX3 F8M2H3 G0TQ82 I6WYT7 M8DKE6 O07786
gi|506925004|ref|YP_008005454.1| gi|375294805|ref|YP_005099072.1| gi|15839995|ref|NP_335032.1| gi|148660362|ref|YP_001281885.1| gi|340625622|ref|YP_004744074.1| gi|525673416|ref|YP_008224686.1| gi|392385310|ref|YP_005306939.1| gi|494698969|ref|YP_007964451.1| gi|148821795|ref|YP_001286549.1| gi|383306499|ref|YP_005359310.1| gi|392431016|ref|YP_006472060.1| gi|15607732|ref|NP_215106.1| gi|385997368|ref|YP_005915666.1| Rv0592 gi|339630660|ref|YP_004722302.1| gi|15607732|ref|NP_215106.1| gi|253797527|ref|YP_003030528.1| NP_215106.1.84033 WP_003403112.1.100000 WP_003403112.1.100021 WP_003403112.1.100069 WP_003403112.1.100087 WP_003403112.1.10015 WP_003403112.1.100208 WP_003403112.1.100216 WP_003403112.1.10022 WP_003403112.1.100255 WP_003403112.1.100260 WP_003403112.1.100270 WP_003403112.1.100279 WP_003403112.1.100286 WP_003403112.1.100308 WP_003403112.1.100309 WP_003403112.1.100337 WP_003403112.1.100338 WP_003403112.1.100383 WP_003403112.1.100395 WP_003403112.1.100396 WP_003403112.1.100459 WP_003403112.1.100460 WP_003403112.1.100552 WP_003403112.1.100600 WP_003403112.1.10064 WP_003403112.1.100666 WP_003403112.1.100671 WP_003403112.1.100682 WP_003403112.1.100697 WP_003403112.1.100703 WP_003403112.1.100716 WP_003403112.1.100722 WP_003403112.1.100754 WP_003403112.1.100772 WP_003403112.1.1008 WP_003403112.1.100812 WP_003403112.1.100845 WP_003403112.1.100866 WP_003403112.1.10088 WP_003403112.1.100889 WP_003403112.1.100910 WP_003403112.1.100915 WP_003403112.1.100918 WP_003403112.1.100935 WP_003403112.1.100984 WP_003403112.1.100998 WP_003403112.1.101 WP_003403112.1.101025 WP_003403112.1.101028 WP_003403112.1.101048 WP_003403112.1.101054 WP_003403112.1.101075 WP_003403112.1.101143 WP_003403112.1.10116 WP_003403112.1.10117 WP_003403112.1.101209 WP_003403112.1.10125 WP_003403112.1.101290 WP_003403112.1.101323 WP_003403112.1.101324 WP_003403112.1.101350 WP_003403112.1.101367 WP_003403112.1.101398 WP_003403112.1.101403 WP_003403112.1.101421 WP_003403112.1.10144 WP_003403112.1.101442 WP_003403112.1.10145 WP_003403112.1.101452 WP_003403112.1.101456 WP_003403112.1.101493 WP_003403112.1.101496 WP_003403112.1.101525 WP_003403112.1.101533 WP_003403112.1.101553 WP_003403112.1.101558 WP_003403112.1.101573 WP_003403112.1.101576 WP_003403112.1.10159 WP_003403112.1.101592 WP_003403112.1.101604 WP_003403112.1.101607 WP_003403112.1.101622 WP_003403112.1.101644 WP_003403112.1.101671 WP_003403112.1.101687 WP_003403112.1.101698 WP_003403112.1.10170 WP_003403112.1.101713 WP_003403112.1.101722 WP_003403112.1.101733 WP_003403112.1.101743 WP_003403112.1.101754 WP_003403112.1.101764 WP_003403112.1.101773 WP_003403112.1.101795 WP_003403112.1.101797 WP_003403112.1.101798 WP_003403112.1.101802 WP_003403112.1.101826 WP_003403112.1.101836 WP_003403112.1.101858 WP_003403112.1.101862 WP_003403112.1.101888 WP_003403112.1.101894 WP_003403112.1.101899 WP_003403112.1.1019 WP_003403112.1.101923 WP_003403112.1.101925 WP_003403112.1.10193 WP_003403112.1.102 WP_003403112.1.102008 WP_003403112.1.102017 WP_003403112.1.102053 WP_003403112.1.102063 WP_003403112.1.102099 WP_003403112.1.1021 WP_003403112.1.102119 WP_003403112.1.102121 WP_003403112.1.102143 WP_003403112.1.10224 WP_003403112.1.10253 WP_003403112.1.10262 WP_003403112.1.10272 WP_003403112.1.10277 WP_003403112.1.1033 WP_003403112.1.10350 WP_003403112.1.10366 WP_003403112.1.10376 WP_003403112.1.10396 WP_003403112.1.10410 WP_003403112.1.10414 WP_003403112.1.10421 WP_003403112.1.10430 WP_003403112.1.1044 WP_003403112.1.10471 WP_003403112.1.10472 WP_003403112.1.10489 WP_003403112.1.105 WP_003403112.1.10518 WP_003403112.1.10545 WP_003403112.1.1057 WP_003403112.1.10594 WP_003403112.1.10615 WP_003403112.1.10623 WP_003403112.1.10635 WP_003403112.1.10643 WP_003403112.1.10662 WP_003403112.1.10709 WP_003403112.1.10735 WP_003403112.1.10740 WP_003403112.1.10756 WP_003403112.1.1078 WP_003403112.1.10791 WP_003403112.1.10799 WP_003403112.1.10825 WP_003403112.1.10848 WP_003403112.1.10863 WP_003403112.1.10912 WP_003403112.1.10916 WP_003403112.1.10923 WP_003403112.1.10927 WP_003403112.1.1095 WP_003403112.1.10956 WP_003403112.1.10958 WP_003403112.1.10962 WP_003403112.1.10980 WP_003403112.1.10981 WP_003403112.1.10993 WP_003403112.1.1100 WP_003403112.1.11040 WP_003403112.1.11070 WP_003403112.1.11141 WP_003403112.1.11171 WP_003403112.1.11175 WP_003403112.1.11222 WP_003403112.1.11236 WP_003403112.1.11329 WP_003403112.1.1133 WP_003403112.1.11373 WP_003403112.1.11376 WP_003403112.1.11390 WP_003403112.1.11402 WP_003403112.1.11481 WP_003403112.1.11489 WP_003403112.1.11491 WP_003403112.1.11514 WP_003403112.1.11589 WP_003403112.1.11596 WP_003403112.1.11604 WP_003403112.1.11610 WP_003403112.1.11707 WP_003403112.1.11752 WP_003403112.1.11758 WP_003403112.1.11761 WP_003403112.1.11775 WP_003403112.1.11826 WP_003403112.1.11898 WP_003403112.1.11906 WP_003403112.1.11939 WP_003403112.1.11960 WP_003403112.1.11961 WP_003403112.1.11972 WP_003403112.1.11984 WP_003403112.1.120 WP_003403112.1.12001 WP_003403112.1.12049 WP_003403112.1.12052 WP_003403112.1.12100 WP_003403112.1.12116 WP_003403112.1.12130 WP_003403112.1.12161 WP_003403112.1.12165 WP_003403112.1.12190 WP_003403112.1.12216 WP_003403112.1.12265 WP_003403112.1.12275 WP_003403112.1.12293 WP_003403112.1.12294 WP_003403112.1.123 WP_003403112.1.1231 WP_003403112.1.12314 WP_003403112.1.12338 WP_003403112.1.1236 WP_003403112.1.12371 WP_003403112.1.12372 WP_003403112.1.12389 WP_003403112.1.1241 WP_003403112.1.12421 WP_003403112.1.12446 WP_003403112.1.12464 WP_003403112.1.12519 WP_003403112.1.12523 WP_003403112.1.12526 WP_003403112.1.1255 WP_003403112.1.12550 WP_003403112.1.12551 WP_003403112.1.12611 WP_003403112.1.12669 WP_003403112.1.1267 WP_003403112.1.12672 WP_003403112.1.12692 WP_003403112.1.1271 WP_003403112.1.12768 WP_003403112.1.1279 WP_003403112.1.12794 WP_003403112.1.12804 WP_003403112.1.12821 WP_003403112.1.12841 WP_003403112.1.12871 WP_003403112.1.12901 WP_003403112.1.12941 WP_003403112.1.12947 WP_003403112.1.12957 WP_003403112.1.12972 WP_003403112.1.13043 WP_003403112.1.13087 WP_003403112.1.13090 WP_003403112.1.13096 WP_003403112.1.13175 WP_003403112.1.13183 WP_003403112.1.132 WP_003403112.1.13249 WP_003403112.1.13282 WP_003403112.1.13284 WP_003403112.1.13302 WP_003403112.1.13306 WP_003403112.1.13312 WP_003403112.1.13321 WP_003403112.1.13345 WP_003403112.1.13370 WP_003403112.1.13375 WP_003403112.1.13420 WP_003403112.1.13433 WP_003403112.1.13435 WP_003403112.1.13438 WP_003403112.1.13461 WP_003403112.1.13489 WP_003403112.1.13526 WP_003403112.1.13564 WP_003403112.1.13579 WP_003403112.1.13647 WP_003403112.1.13667 WP_003403112.1.13697 WP_003403112.1.13719 WP_003403112.1.1377 WP_003403112.1.13774 WP_003403112.1.13786 WP_003403112.1.13793 WP_003403112.1.13817 WP_003403112.1.13834 WP_003403112.1.13866 WP_003403112.1.13880 WP_003403112.1.13899 WP_003403112.1.13909 WP_003403112.1.13919 WP_003403112.1.13920 WP_003403112.1.13953 WP_003403112.1.13962 WP_003403112.1.1398 WP_003403112.1.13988 WP_003403112.1.14027 WP_003403112.1.14046 WP_003403112.1.14152 WP_003403112.1.14158 WP_003403112.1.14162 WP_003403112.1.14178 WP_003403112.1.14194 WP_003403112.1.14208 WP_003403112.1.14238 WP_003403112.1.14266 WP_003403112.1.14273 WP_003403112.1.14303 WP_003403112.1.14306 WP_003403112.1.14310 WP_003403112.1.14341 WP_003403112.1.14416 WP_003403112.1.14428 WP_003403112.1.14469 WP_003403112.1.14477 WP_003403112.1.14504 WP_003403112.1.14514 WP_003403112.1.1452 WP_003403112.1.14527 WP_003403112.1.1454 WP_003403112.1.14544 WP_003403112.1.14548 WP_003403112.1.14551 WP_003403112.1.14561 WP_003403112.1.1462 WP_003403112.1.14667 WP_003403112.1.14675 WP_003403112.1.14694 WP_003403112.1.14695 WP_003403112.1.14709 WP_003403112.1.14766 WP_003403112.1.14865 WP_003403112.1.14872 WP_003403112.1.14905 WP_003403112.1.14926 WP_003403112.1.14951 WP_003403112.1.15003 WP_003403112.1.15009 WP_003403112.1.15028 WP_003403112.1.15040 WP_003403112.1.15052 WP_003403112.1.15065 WP_003403112.1.15072 WP_003403112.1.15089 WP_003403112.1.1509 WP_003403112.1.15168 WP_003403112.1.15172 WP_003403112.1.15174 WP_003403112.1.15187 WP_003403112.1.15210 WP_003403112.1.15216 WP_003403112.1.15217 WP_003403112.1.1523 WP_003403112.1.15232 WP_003403112.1.15238 WP_003403112.1.15240 WP_003403112.1.15253 WP_003403112.1.15267 WP_003403112.1.1527 WP_003403112.1.15292 WP_003403112.1.15299 WP_003403112.1.15302 WP_003403112.1.1534 WP_003403112.1.15365 WP_003403112.1.15372 WP_003403112.1.15387 WP_003403112.1.15442 WP_003403112.1.15447 WP_003403112.1.15449 WP_003403112.1.15477 WP_003403112.1.15481 WP_003403112.1.15492 WP_003403112.1.15512 WP_003403112.1.15558 WP_003403112.1.15559 WP_003403112.1.15566 WP_003403112.1.15611 WP_003403112.1.1563 WP_003403112.1.15643 WP_003403112.1.15688 WP_003403112.1.15755 WP_003403112.1.15763 WP_003403112.1.15774 WP_003403112.1.1578 WP_003403112.1.15780 WP_003403112.1.15827 WP_003403112.1.15834 WP_003403112.1.15842 WP_003403112.1.15848 WP_003403112.1.15853 WP_003403112.1.15870 WP_003403112.1.15896 WP_003403112.1.15946 WP_003403112.1.15958 WP_003403112.1.15987 WP_003403112.1.15993 WP_003403112.1.16025 WP_003403112.1.16055 WP_003403112.1.16066 WP_003403112.1.16069 WP_003403112.1.16106 WP_003403112.1.16108 WP_003403112.1.16110 WP_003403112.1.16136 WP_003403112.1.16139 WP_003403112.1.16141 WP_003403112.1.16143 WP_003403112.1.1630 WP_003403112.1.1632 WP_003403112.1.16334 WP_003403112.1.16341 WP_003403112.1.16345 WP_003403112.1.16384 WP_003403112.1.16386 WP_003403112.1.164 WP_003403112.1.1642 WP_003403112.1.16421 WP_003403112.1.16424 WP_003403112.1.16426 WP_003403112.1.16431 WP_003403112.1.16438 WP_003403112.1.1644 WP_003403112.1.16448 WP_003403112.1.16451 WP_003403112.1.16476 WP_003403112.1.16480 WP_003403112.1.16494 WP_003403112.1.1652 WP_003403112.1.16549 WP_003403112.1.16560 WP_003403112.1.16598 WP_003403112.1.16609 WP_003403112.1.16619 WP_003403112.1.16620 WP_003403112.1.16637 WP_003403112.1.16707 WP_003403112.1.16743 WP_003403112.1.1683 WP_003403112.1.16837 WP_003403112.1.16852 WP_003403112.1.16940 WP_003403112.1.16950 WP_003403112.1.16959 WP_003403112.1.16968 WP_003403112.1.1697 WP_003403112.1.16977 WP_003403112.1.16987 WP_003403112.1.17005 WP_003403112.1.17010 WP_003403112.1.17015 WP_003403112.1.17019 WP_003403112.1.17041 WP_003403112.1.17052 WP_003403112.1.17057 WP_003403112.1.17062 WP_003403112.1.1707 WP_003403112.1.17094 WP_003403112.1.17130 WP_003403112.1.17138 WP_003403112.1.17147 WP_003403112.1.17167 WP_003403112.1.17224 WP_003403112.1.17251 WP_003403112.1.17288 WP_003403112.1.17304 WP_003403112.1.17345 WP_003403112.1.17381 WP_003403112.1.17391 WP_003403112.1.17412 WP_003403112.1.1743 WP_003403112.1.17440 WP_003403112.1.17483 WP_003403112.1.17505 WP_003403112.1.17527 WP_003403112.1.17535 WP_003403112.1.17540 WP_003403112.1.17553 WP_003403112.1.17558 WP_003403112.1.17599 WP_003403112.1.17635 WP_003403112.1.17655 WP_003403112.1.17679 WP_003403112.1.17687 WP_003403112.1.17700 WP_003403112.1.17710 WP_003403112.1.17713 WP_003403112.1.17722 WP_003403112.1.17788 WP_003403112.1.17798 WP_003403112.1.17803 WP_003403112.1.17816 WP_003403112.1.17821 WP_003403112.1.17830 WP_003403112.1.17878 WP_003403112.1.17923 WP_003403112.1.1795 WP_003403112.1.17955 WP_003403112.1.17973 WP_003403112.1.18009 WP_003403112.1.18013 WP_003403112.1.18033 WP_003403112.1.18057 WP_003403112.1.18065 WP_003403112.1.18070 WP_003403112.1.18116 WP_003403112.1.18120 WP_003403112.1.18126 WP_003403112.1.1817 WP_003403112.1.18206 WP_003403112.1.18216 WP_003403112.1.18257 WP_003403112.1.18364 WP_003403112.1.18411 WP_003403112.1.18444 WP_003403112.1.18448 WP_003403112.1.18476 WP_003403112.1.18522 WP_003403112.1.18580 WP_003403112.1.18587 WP_003403112.1.186 WP_003403112.1.18601 WP_003403112.1.18639 WP_003403112.1.18647 WP_003403112.1.1868 WP_003403112.1.18694 WP_003403112.1.18751 WP_003403112.1.18781 WP_003403112.1.18793 WP_003403112.1.18804 WP_003403112.1.18816 WP_003403112.1.18823 WP_003403112.1.18827 WP_003403112.1.18838 WP_003403112.1.18849 WP_003403112.1.18856 WP_003403112.1.18945 WP_003403112.1.19005 WP_003403112.1.19056 WP_003403112.1.19063 WP_003403112.1.19071 WP_003403112.1.19085 WP_003403112.1.19159 WP_003403112.1.19193 WP_003403112.1.19231 WP_003403112.1.19243 WP_003403112.1.19307 WP_003403112.1.19326 WP_003403112.1.1933 WP_003403112.1.19382 WP_003403112.1.19400 WP_003403112.1.19426 WP_003403112.1.19464 WP_003403112.1.19480 WP_003403112.1.19512 WP_003403112.1.19553 WP_003403112.1.19562 WP_003403112.1.19564 WP_003403112.1.19568 WP_003403112.1.19572 WP_003403112.1.19596 WP_003403112.1.19600 WP_003403112.1.19630 WP_003403112.1.1970 WP_003403112.1.19707 WP_003403112.1.19742 WP_003403112.1.19785 WP_003403112.1.19820 WP_003403112.1.19868 WP_003403112.1.19874 WP_003403112.1.19890 WP_003403112.1.19900 WP_003403112.1.19922 WP_003403112.1.19936 WP_003403112.1.19946 WP_003403112.1.19949 WP_003403112.1.19960 WP_003403112.1.19964 WP_003403112.1.20007 WP_003403112.1.20016 WP_003403112.1.20028 WP_003403112.1.2003 WP_003403112.1.20085 WP_003403112.1.20097 WP_003403112.1.20130 WP_003403112.1.20140 WP_003403112.1.20141 WP_003403112.1.20142 WP_003403112.1.20158 WP_003403112.1.20239 WP_003403112.1.20243 WP_003403112.1.20259 WP_003403112.1.20262 WP_003403112.1.20268 WP_003403112.1.20273 WP_003403112.1.20280 WP_003403112.1.20294 WP_003403112.1.20300 WP_003403112.1.20309 WP_003403112.1.2037 WP_003403112.1.20372 WP_003403112.1.204 WP_003403112.1.20427 WP_003403112.1.20432 WP_003403112.1.20457 WP_003403112.1.20459 WP_003403112.1.20460 WP_003403112.1.20578 WP_003403112.1.20608 WP_003403112.1.20628 WP_003403112.1.2066 WP_003403112.1.20707 WP_003403112.1.20722 WP_003403112.1.20729 WP_003403112.1.20742 WP_003403112.1.20751 WP_003403112.1.20776 WP_003403112.1.20843 WP_003403112.1.20850 WP_003403112.1.20868 WP_003403112.1.20876 WP_003403112.1.20897 WP_003403112.1.20898 WP_003403112.1.2090 WP_003403112.1.20911 WP_003403112.1.20916 WP_003403112.1.20921 WP_003403112.1.20926 WP_003403112.1.20927 WP_003403112.1.20951 WP_003403112.1.20970 WP_003403112.1.2104 WP_003403112.1.21127 WP_003403112.1.21135 WP_003403112.1.21173 WP_003403112.1.212 WP_003403112.1.2120 WP_003403112.1.21219 WP_003403112.1.21231 WP_003403112.1.21234 WP_003403112.1.2126 WP_003403112.1.21292 WP_003403112.1.21307 WP_003403112.1.2131 WP_003403112.1.21311 WP_003403112.1.21321 WP_003403112.1.21365 WP_003403112.1.2137 WP_003403112.1.21392 WP_003403112.1.21397 WP_003403112.1.21403 WP_003403112.1.21415 WP_003403112.1.21418 WP_003403112.1.21430 WP_003403112.1.21434 WP_003403112.1.21444 WP_003403112.1.21468 WP_003403112.1.21498 WP_003403112.1.21513 WP_003403112.1.21560 WP_003403112.1.21565 WP_003403112.1.21586 WP_003403112.1.21602 WP_003403112.1.21615 WP_003403112.1.21638 WP_003403112.1.21639 WP_003403112.1.21658 WP_003403112.1.21741 WP_003403112.1.21777 WP_003403112.1.21795 WP_003403112.1.218 WP_003403112.1.21826 WP_003403112.1.21829 WP_003403112.1.21843 WP_003403112.1.21872 WP_003403112.1.2188 WP_003403112.1.21882 WP_003403112.1.21906 WP_003403112.1.2194 WP_003403112.1.21941 WP_003403112.1.21956 WP_003403112.1.21958 WP_003403112.1.21960 WP_003403112.1.21983 WP_003403112.1.22003 WP_003403112.1.22013 WP_003403112.1.22025 WP_003403112.1.22075 WP_003403112.1.2212 WP_003403112.1.22127 WP_003403112.1.22140 WP_003403112.1.22233 WP_003403112.1.22255 WP_003403112.1.22277 WP_003403112.1.22305 WP_003403112.1.22348 WP_003403112.1.22356 WP_003403112.1.22366 WP_003403112.1.22438 WP_003403112.1.22445 WP_003403112.1.22490 WP_003403112.1.22511 WP_003403112.1.2253 WP_003403112.1.22585 WP_003403112.1.22589 WP_003403112.1.22606 WP_003403112.1.22609 WP_003403112.1.2262 WP_003403112.1.22624 WP_003403112.1.22629 WP_003403112.1.22647 WP_003403112.1.22664 WP_003403112.1.22665 WP_003403112.1.22670 WP_003403112.1.22674 WP_003403112.1.22725 WP_003403112.1.22728 WP_003403112.1.22737 WP_003403112.1.2275 WP_003403112.1.22754 WP_003403112.1.22797 WP_003403112.1.22800 WP_003403112.1.22804 WP_003403112.1.22840 WP_003403112.1.22844 WP_003403112.1.22963 WP_003403112.1.22970 WP_003403112.1.22996 WP_003403112.1.23032 WP_003403112.1.23101 WP_003403112.1.2312 WP_003403112.1.23153 WP_003403112.1.2320 WP_003403112.1.23204 WP_003403112.1.23229 WP_003403112.1.23233 WP_003403112.1.2326 WP_003403112.1.23261 WP_003403112.1.23289 WP_003403112.1.2329 WP_003403112.1.23308 WP_003403112.1.23321 WP_003403112.1.23325 WP_003403112.1.2339 WP_003403112.1.23406 WP_003403112.1.23438 WP_003403112.1.23445 WP_003403112.1.23447 WP_003403112.1.23452 WP_003403112.1.23461 WP_003403112.1.2349 WP_003403112.1.23496 WP_003403112.1.23506 WP_003403112.1.23530 WP_003403112.1.23539 WP_003403112.1.23546 WP_003403112.1.23551 WP_003403112.1.23583 WP_003403112.1.23628 WP_003403112.1.23677 WP_003403112.1.23683 WP_003403112.1.23694 WP_003403112.1.23699 WP_003403112.1.2371 WP_003403112.1.23803 WP_003403112.1.23807 WP_003403112.1.23825 WP_003403112.1.23832 WP_003403112.1.2384 WP_003403112.1.23843 WP_003403112.1.23863 WP_003403112.1.2387 WP_003403112.1.23993 WP_003403112.1.2400 WP_003403112.1.24007 WP_003403112.1.24008 WP_003403112.1.24057 WP_003403112.1.24113 WP_003403112.1.24119 WP_003403112.1.24128 WP_003403112.1.24140 WP_003403112.1.24176 WP_003403112.1.24190 WP_003403112.1.24244 WP_003403112.1.24261 WP_003403112.1.24284 WP_003403112.1.24294 WP_003403112.1.24357 WP_003403112.1.24396 WP_003403112.1.24414 WP_003403112.1.24446 WP_003403112.1.24461 WP_003403112.1.24500 WP_003403112.1.24507 WP_003403112.1.24509 WP_003403112.1.24529 WP_003403112.1.24553 WP_003403112.1.24599 WP_003403112.1.24629 WP_003403112.1.24638 WP_003403112.1.2466 WP_003403112.1.24767 WP_003403112.1.24824 WP_003403112.1.24831 WP_003403112.1.24840 WP_003403112.1.24848 WP_003403112.1.24857 WP_003403112.1.2487 WP_003403112.1.24893 WP_003403112.1.24907 WP_003403112.1.24933 WP_003403112.1.24956 WP_003403112.1.24985 WP_003403112.1.2499 WP_003403112.1.2505 WP_003403112.1.25051 WP_003403112.1.2507 WP_003403112.1.25103 WP_003403112.1.25184 WP_003403112.1.25247 WP_003403112.1.25252 WP_003403112.1.25283 WP_003403112.1.25309 WP_003403112.1.25313 WP_003403112.1.25338 WP_003403112.1.25342 WP_003403112.1.25367 WP_003403112.1.25393 WP_003403112.1.25437 WP_003403112.1.25445 WP_003403112.1.25455 WP_003403112.1.25504 WP_003403112.1.25513 WP_003403112.1.25542 WP_003403112.1.25579 WP_003403112.1.25594 WP_003403112.1.25606 WP_003403112.1.25645 WP_003403112.1.2566 WP_003403112.1.25673 WP_003403112.1.25674 WP_003403112.1.25693 WP_003403112.1.25699 WP_003403112.1.25727 WP_003403112.1.25736 WP_003403112.1.25738 WP_003403112.1.25756 WP_003403112.1.25759 WP_003403112.1.25813 WP_003403112.1.25853 WP_003403112.1.25854 WP_003403112.1.25874 WP_003403112.1.25892 WP_003403112.1.25906 WP_003403112.1.25914 WP_003403112.1.25916 WP_003403112.1.2594 WP_003403112.1.25972 WP_003403112.1.26017 WP_003403112.1.26032 WP_003403112.1.26038 WP_003403112.1.26072 WP_003403112.1.26089 WP_003403112.1.26098 WP_003403112.1.26109 WP_003403112.1.26118 WP_003403112.1.26126 WP_003403112.1.26168 WP_003403112.1.26182 WP_003403112.1.26190 WP_003403112.1.2620 WP_003403112.1.26234 WP_003403112.1.26243 WP_003403112.1.26267 WP_003403112.1.26292 WP_003403112.1.26310 WP_003403112.1.26328 WP_003403112.1.26349 WP_003403112.1.26407 WP_003403112.1.26454 WP_003403112.1.26464 WP_003403112.1.2653 WP_003403112.1.26571 WP_003403112.1.2659 WP_003403112.1.26597 WP_003403112.1.26603 WP_003403112.1.26629 WP_003403112.1.26651 WP_003403112.1.26702 WP_003403112.1.26707 WP_003403112.1.26710 WP_003403112.1.26737 WP_003403112.1.26738 WP_003403112.1.26745 WP_003403112.1.2676 WP_003403112.1.2677 WP_003403112.1.26779 WP_003403112.1.26780 WP_003403112.1.26798 WP_003403112.1.26854 WP_003403112.1.26868 WP_003403112.1.26876 WP_003403112.1.26888 WP_003403112.1.26945 WP_003403112.1.26959 WP_003403112.1.26969 WP_003403112.1.26984 WP_003403112.1.26992 WP_003403112.1.27004 WP_003403112.1.27017 WP_003403112.1.27074 WP_003403112.1.27075 WP_003403112.1.27128 WP_003403112.1.27130 WP_003403112.1.27152 WP_003403112.1.27162 WP_003403112.1.27164 WP_003403112.1.27193 WP_003403112.1.27235 WP_003403112.1.27278 WP_003403112.1.27343 WP_003403112.1.27352 WP_003403112.1.27391 WP_003403112.1.27398 WP_003403112.1.27402 WP_003403112.1.27460 WP_003403112.1.27463 WP_003403112.1.27492 WP_003403112.1.27541 WP_003403112.1.27576 WP_003403112.1.27582 WP_003403112.1.27596 WP_003403112.1.27607 WP_003403112.1.277 WP_003403112.1.27724 WP_003403112.1.27743 WP_003403112.1.27750 WP_003403112.1.27771 WP_003403112.1.27779 WP_003403112.1.27795 WP_003403112.1.27803 WP_003403112.1.27819 WP_003403112.1.27835 WP_003403112.1.27915 WP_003403112.1.27962 WP_003403112.1.28053 WP_003403112.1.28092 WP_003403112.1.28131 WP_003403112.1.28142 WP_003403112.1.28159 WP_003403112.1.2816 WP_003403112.1.28161 WP_003403112.1.28192 WP_003403112.1.28202 WP_003403112.1.28241 WP_003403112.1.28242 WP_003403112.1.28251 WP_003403112.1.28269 WP_003403112.1.28276 WP_003403112.1.28331 WP_003403112.1.28367 WP_003403112.1.28378 WP_003403112.1.28391 WP_003403112.1.2842 WP_003403112.1.28448 WP_003403112.1.28471 WP_003403112.1.28473 WP_003403112.1.28493 WP_003403112.1.28497 WP_003403112.1.28530 WP_003403112.1.28545 WP_003403112.1.28561 WP_003403112.1.28567 WP_003403112.1.28585 WP_003403112.1.286 WP_003403112.1.28610 WP_003403112.1.28617 WP_003403112.1.28634 WP_003403112.1.28642 WP_003403112.1.28671 WP_003403112.1.28682 WP_003403112.1.28698 WP_003403112.1.28703 WP_003403112.1.28758 WP_003403112.1.28787 WP_003403112.1.28827 WP_003403112.1.28839 WP_003403112.1.28847 WP_003403112.1.28851 WP_003403112.1.28865 WP_003403112.1.28897 WP_003403112.1.28935 WP_003403112.1.28939 WP_003403112.1.28943 WP_003403112.1.28952 WP_003403112.1.28975 WP_003403112.1.28993 WP_003403112.1.2901 WP_003403112.1.29028 WP_003403112.1.29033 WP_003403112.1.29058 WP_003403112.1.29078 WP_003403112.1.29102 WP_003403112.1.29115 WP_003403112.1.2916 WP_003403112.1.29217 WP_003403112.1.29223 WP_003403112.1.29275 WP_003403112.1.29306 WP_003403112.1.29339 WP_003403112.1.29348 WP_003403112.1.29364 WP_003403112.1.29367 WP_003403112.1.29399 WP_003403112.1.29426 WP_003403112.1.2944 WP_003403112.1.29449 WP_003403112.1.29450 WP_003403112.1.29452 WP_003403112.1.2949 WP_003403112.1.29510 WP_003403112.1.29525 WP_003403112.1.29587 WP_003403112.1.29599 WP_003403112.1.29611 WP_003403112.1.29649 WP_003403112.1.2965 WP_003403112.1.29659 WP_003403112.1.2969 WP_003403112.1.29698 WP_003403112.1.29742 WP_003403112.1.29745 WP_003403112.1.29747 WP_003403112.1.29769 WP_003403112.1.29825 WP_003403112.1.29830 WP_003403112.1.29847 WP_003403112.1.29861 WP_003403112.1.29869 WP_003403112.1.29890 WP_003403112.1.299 WP_003403112.1.29931 WP_003403112.1.29960 WP_003403112.1.30014 WP_003403112.1.30040 WP_003403112.1.30074 WP_003403112.1.30097 WP_003403112.1.30114 WP_003403112.1.30126 WP_003403112.1.30138 WP_003403112.1.30139 WP_003403112.1.30145 WP_003403112.1.30211 WP_003403112.1.30224 WP_003403112.1.30235 WP_003403112.1.30237 WP_003403112.1.30279 WP_003403112.1.30282 WP_003403112.1.30283 WP_003403112.1.30291 WP_003403112.1.30363 WP_003403112.1.30433 WP_003403112.1.30438 WP_003403112.1.30462 WP_003403112.1.30464 WP_003403112.1.30468 WP_003403112.1.3057 WP_003403112.1.30574 WP_003403112.1.30628 WP_003403112.1.30641 WP_003403112.1.30642 WP_003403112.1.30683 WP_003403112.1.30699 WP_003403112.1.30709 WP_003403112.1.30713 WP_003403112.1.30719 WP_003403112.1.30730 WP_003403112.1.30736 WP_003403112.1.30745 WP_003403112.1.30760 WP_003403112.1.308 WP_003403112.1.30807 WP_003403112.1.30818 WP_003403112.1.30824 WP_003403112.1.30877 WP_003403112.1.30888 WP_003403112.1.30901 WP_003403112.1.30912 WP_003403112.1.30913 WP_003403112.1.30919 WP_003403112.1.30977 WP_003403112.1.3100 WP_003403112.1.31002 WP_003403112.1.3101 WP_003403112.1.31034 WP_003403112.1.31047 WP_003403112.1.31074 WP_003403112.1.31102 WP_003403112.1.31127 WP_003403112.1.31184 WP_003403112.1.31199 WP_003403112.1.31226 WP_003403112.1.31230 WP_003403112.1.31263 WP_003403112.1.31264 WP_003403112.1.31270 WP_003403112.1.31287 WP_003403112.1.31304 WP_003403112.1.31348 WP_003403112.1.31354 WP_003403112.1.31390 WP_003403112.1.31414 WP_003403112.1.31417 WP_003403112.1.31428 WP_003403112.1.3143 WP_003403112.1.31458 WP_003403112.1.31483 WP_003403112.1.3149 WP_003403112.1.31498 WP_003403112.1.31507 WP_003403112.1.31548 WP_003403112.1.31569 WP_003403112.1.316 WP_003403112.1.31666 WP_003403112.1.31703 WP_003403112.1.31744 WP_003403112.1.31745 WP_003403112.1.31770 WP_003403112.1.31776 WP_003403112.1.31783 WP_003403112.1.318 WP_003403112.1.31840 WP_003403112.1.31880 WP_003403112.1.31911 WP_003403112.1.31930 WP_003403112.1.31932 WP_003403112.1.31955 WP_003403112.1.31985 WP_003403112.1.31995 WP_003403112.1.32004 WP_003403112.1.32039 WP_003403112.1.3204 WP_003403112.1.32045 WP_003403112.1.32071 WP_003403112.1.32098 WP_003403112.1.32132 WP_003403112.1.32157 WP_003403112.1.32164 WP_003403112.1.32179 WP_003403112.1.32198 WP_003403112.1.32297 WP_003403112.1.32317 WP_003403112.1.32383 WP_003403112.1.32403 WP_003403112.1.32433 WP_003403112.1.32482 WP_003403112.1.32503 WP_003403112.1.32556 WP_003403112.1.32569 WP_003403112.1.32592 WP_003403112.1.32620 WP_003403112.1.32647 WP_003403112.1.32653 WP_003403112.1.32654 WP_003403112.1.32695 WP_003403112.1.32706 WP_003403112.1.32738 WP_003403112.1.32752 WP_003403112.1.32780 WP_003403112.1.32781 WP_003403112.1.32799 WP_003403112.1.32833 WP_003403112.1.32880 WP_003403112.1.32935 WP_003403112.1.32974 WP_003403112.1.33007 WP_003403112.1.3302 WP_003403112.1.33028 WP_003403112.1.33035 WP_003403112.1.33054 WP_003403112.1.33082 WP_003403112.1.33141 WP_003403112.1.33148 WP_003403112.1.33155 WP_003403112.1.33168 WP_003403112.1.3321 WP_003403112.1.3325 WP_003403112.1.3327 WP_003403112.1.33278 WP_003403112.1.33288 WP_003403112.1.33305 WP_003403112.1.33319 WP_003403112.1.3333 WP_003403112.1.33393 WP_003403112.1.33403 WP_003403112.1.33452 WP_003403112.1.33467 WP_003403112.1.33477 WP_003403112.1.3349 WP_003403112.1.33519 WP_003403112.1.33601 WP_003403112.1.33602 WP_003403112.1.33633 WP_003403112.1.33646 WP_003403112.1.3369 WP_003403112.1.33705 WP_003403112.1.33762 WP_003403112.1.33783 WP_003403112.1.3383 WP_003403112.1.33848 WP_003403112.1.3387 WP_003403112.1.33886 WP_003403112.1.33895 WP_003403112.1.33906 WP_003403112.1.33954 WP_003403112.1.3399 WP_003403112.1.3405 WP_003403112.1.34055 WP_003403112.1.34056 WP_003403112.1.34065 WP_003403112.1.34090 WP_003403112.1.34109 WP_003403112.1.34131 WP_003403112.1.34152 WP_003403112.1.34153 WP_003403112.1.34163 WP_003403112.1.34181 WP_003403112.1.34197 WP_003403112.1.34198 WP_003403112.1.34215 WP_003403112.1.34219 WP_003403112.1.34255 WP_003403112.1.34260 WP_003403112.1.34275 WP_003403112.1.343 WP_003403112.1.34347 WP_003403112.1.34392 WP_003403112.1.344 WP_003403112.1.34428 WP_003403112.1.3443 WP_003403112.1.34435 WP_003403112.1.34446 WP_003403112.1.34499 WP_003403112.1.34516 WP_003403112.1.34529 WP_003403112.1.34563 WP_003403112.1.34576 WP_003403112.1.34581 WP_003403112.1.34588 WP_003403112.1.34596 WP_003403112.1.34599 WP_003403112.1.34639 WP_003403112.1.34673 WP_003403112.1.34724 WP_003403112.1.34740 WP_003403112.1.34755 WP_003403112.1.34777 WP_003403112.1.34783 WP_003403112.1.34841 WP_003403112.1.34919 WP_003403112.1.3492 WP_003403112.1.34945 WP_003403112.1.34946 WP_003403112.1.34960 WP_003403112.1.34961 WP_003403112.1.34963 WP_003403112.1.34965 WP_003403112.1.34968 WP_003403112.1.35023 WP_003403112.1.35100 WP_003403112.1.35146 WP_003403112.1.35156 WP_003403112.1.35160 WP_003403112.1.35176 WP_003403112.1.3520 WP_003403112.1.35213 WP_003403112.1.35221 WP_003403112.1.35246 WP_003403112.1.35278 WP_003403112.1.35301 WP_003403112.1.35311 WP_003403112.1.35317 WP_003403112.1.35319 WP_003403112.1.35347 WP_003403112.1.35363 WP_003403112.1.35382 WP_003403112.1.35385 WP_003403112.1.35396 WP_003403112.1.35426 WP_003403112.1.35439 WP_003403112.1.3548 WP_003403112.1.35484 WP_003403112.1.3553 WP_003403112.1.35553 WP_003403112.1.35555 WP_003403112.1.35561 WP_003403112.1.35602 WP_003403112.1.35610 WP_003403112.1.35687 WP_003403112.1.35689 WP_003403112.1.35707 WP_003403112.1.35732 WP_003403112.1.35754 WP_003403112.1.35767 WP_003403112.1.35771 WP_003403112.1.35780 WP_003403112.1.35805 WP_003403112.1.35811 WP_003403112.1.3584 WP_003403112.1.35848 WP_003403112.1.35864 WP_003403112.1.35874 WP_003403112.1.35876 WP_003403112.1.35897 WP_003403112.1.35899 WP_003403112.1.35923 WP_003403112.1.3593 WP_003403112.1.35954 WP_003403112.1.36005 WP_003403112.1.36014 WP_003403112.1.36023 WP_003403112.1.36053 WP_003403112.1.36075 WP_003403112.1.36097 WP_003403112.1.36098 WP_003403112.1.36145 WP_003403112.1.36156 WP_003403112.1.36205 WP_003403112.1.36228 WP_003403112.1.36260 WP_003403112.1.36270 WP_003403112.1.36271 WP_003403112.1.36309 WP_003403112.1.36315 WP_003403112.1.36319 WP_003403112.1.36321 WP_003403112.1.36326 WP_003403112.1.36356 WP_003403112.1.36357 WP_003403112.1.3636 WP_003403112.1.36385 WP_003403112.1.36399 WP_003403112.1.36436 WP_003403112.1.36469 WP_003403112.1.36473 WP_003403112.1.36485 WP_003403112.1.36508 WP_003403112.1.36540 WP_003403112.1.36571 WP_003403112.1.36578 WP_003403112.1.36585 WP_003403112.1.36597 WP_003403112.1.36614 WP_003403112.1.36674 WP_003403112.1.36720 WP_003403112.1.36727 WP_003403112.1.36733 WP_003403112.1.36785 WP_003403112.1.36810 WP_003403112.1.36844 WP_003403112.1.36851 WP_003403112.1.36862 WP_003403112.1.36893 WP_003403112.1.36921 WP_003403112.1.36935 WP_003403112.1.36941 WP_003403112.1.3695 WP_003403112.1.36951 WP_003403112.1.36968 WP_003403112.1.3700 WP_003403112.1.37012 WP_003403112.1.37071 WP_003403112.1.37088 WP_003403112.1.37131 WP_003403112.1.37157 WP_003403112.1.37175 WP_003403112.1.37188 WP_003403112.1.37213 WP_003403112.1.37229 WP_003403112.1.3724 WP_003403112.1.37305 WP_003403112.1.37330 WP_003403112.1.37389 WP_003403112.1.37400 WP_003403112.1.37440 WP_003403112.1.37459 WP_003403112.1.37468 WP_003403112.1.37475 WP_003403112.1.37484 WP_003403112.1.37601 WP_003403112.1.37643 WP_003403112.1.37655 WP_003403112.1.37660 WP_003403112.1.37700 WP_003403112.1.37701 WP_003403112.1.37709 WP_003403112.1.37711 WP_003403112.1.37721 WP_003403112.1.37722 WP_003403112.1.37804 WP_003403112.1.37809 WP_003403112.1.37859 WP_003403112.1.37877 WP_003403112.1.37912 WP_003403112.1.37913 WP_003403112.1.37943 WP_003403112.1.37973 WP_003403112.1.37975 WP_003403112.1.37983 WP_003403112.1.38 WP_003403112.1.38002 WP_003403112.1.3802 WP_003403112.1.38039 WP_003403112.1.38040 WP_003403112.1.38067 WP_003403112.1.38068 WP_003403112.1.38138 WP_003403112.1.38158 WP_003403112.1.38159 WP_003403112.1.38210 WP_003403112.1.38240 WP_003403112.1.38299 WP_003403112.1.38332 WP_003403112.1.38347 WP_003403112.1.38354 WP_003403112.1.38380 WP_003403112.1.38384 WP_003403112.1.38389 WP_003403112.1.38398 WP_003403112.1.38402 WP_003403112.1.38418 WP_003403112.1.38421 WP_003403112.1.38466 WP_003403112.1.38477 WP_003403112.1.38483 WP_003403112.1.3849 WP_003403112.1.385 WP_003403112.1.38530 WP_003403112.1.38535 WP_003403112.1.38539 WP_003403112.1.38594 WP_003403112.1.38611 WP_003403112.1.38638 WP_003403112.1.38639 WP_003403112.1.38654 WP_003403112.1.38659 WP_003403112.1.38660 WP_003403112.1.38672 WP_003403112.1.38772 WP_003403112.1.38812 WP_003403112.1.38821 WP_003403112.1.38844 WP_003403112.1.38863 WP_003403112.1.38865 WP_003403112.1.38873 WP_003403112.1.3889 WP_003403112.1.38894 WP_003403112.1.38909 WP_003403112.1.38939 WP_003403112.1.38974 WP_003403112.1.38975 WP_003403112.1.38991 WP_003403112.1.39025 WP_003403112.1.39070 WP_003403112.1.39072 WP_003403112.1.39106 WP_003403112.1.39165 WP_003403112.1.39176 WP_003403112.1.39190 WP_003403112.1.39201 WP_003403112.1.39236 WP_003403112.1.39239 WP_003403112.1.39252 WP_003403112.1.39288 WP_003403112.1.39295 WP_003403112.1.39306 WP_003403112.1.39359 WP_003403112.1.39364 WP_003403112.1.39400 WP_003403112.1.39447 WP_003403112.1.3945 WP_003403112.1.39450 WP_003403112.1.39455 WP_003403112.1.3949 WP_003403112.1.39521 WP_003403112.1.39560 WP_003403112.1.39593 WP_003403112.1.396 WP_003403112.1.3960 WP_003403112.1.39616 WP_003403112.1.39654 WP_003403112.1.39657 WP_003403112.1.39661 WP_003403112.1.39674 WP_003403112.1.39678 WP_003403112.1.39728 WP_003403112.1.39739 WP_003403112.1.39751 WP_003403112.1.39759 WP_003403112.1.39801 WP_003403112.1.39804 WP_003403112.1.39848 WP_003403112.1.39877 WP_003403112.1.39925 WP_003403112.1.3994 WP_003403112.1.39959 WP_003403112.1.39960 WP_003403112.1.3997 WP_003403112.1.40000 WP_003403112.1.40029 WP_003403112.1.40094 WP_003403112.1.40096 WP_003403112.1.40150 WP_003403112.1.40156 WP_003403112.1.40174 WP_003403112.1.40186 WP_003403112.1.40276 WP_003403112.1.40277 WP_003403112.1.40323 WP_003403112.1.40336 WP_003403112.1.4036 WP_003403112.1.40372 WP_003403112.1.40402 WP_003403112.1.40413 WP_003403112.1.40440 WP_003403112.1.40446 WP_003403112.1.40451 WP_003403112.1.40455 WP_003403112.1.40523 WP_003403112.1.40543 WP_003403112.1.40641 WP_003403112.1.40646 WP_003403112.1.40651 WP_003403112.1.40653 WP_003403112.1.4067 WP_003403112.1.40705 WP_003403112.1.40723 WP_003403112.1.40731 WP_003403112.1.40735 WP_003403112.1.40799 WP_003403112.1.40852 WP_003403112.1.40876 WP_003403112.1.40881 WP_003403112.1.40922 WP_003403112.1.40948 WP_003403112.1.4095 WP_003403112.1.40956 WP_003403112.1.40957 WP_003403112.1.40964 WP_003403112.1.410 WP_003403112.1.41000 WP_003403112.1.41055 WP_003403112.1.41123 WP_003403112.1.41177 WP_003403112.1.41202 WP_003403112.1.41231 WP_003403112.1.41249 WP_003403112.1.4127 WP_003403112.1.41296 WP_003403112.1.41355 WP_003403112.1.41376 WP_003403112.1.41447 WP_003403112.1.41469 WP_003403112.1.41504 WP_003403112.1.41564 WP_003403112.1.41616 WP_003403112.1.41632 WP_003403112.1.41635 WP_003403112.1.41636 WP_003403112.1.41660 WP_003403112.1.41685 WP_003403112.1.41695 WP_003403112.1.41704 WP_003403112.1.4171 WP_003403112.1.41719 WP_003403112.1.41733 WP_003403112.1.41744 WP_003403112.1.41774 WP_003403112.1.41791 WP_003403112.1.41803 WP_003403112.1.41820 WP_003403112.1.41828 WP_003403112.1.41829 WP_003403112.1.41860 WP_003403112.1.41912 WP_003403112.1.41921 WP_003403112.1.41944 WP_003403112.1.42043 WP_003403112.1.42075 WP_003403112.1.42078 WP_003403112.1.42122 WP_003403112.1.42134 WP_003403112.1.42183 WP_003403112.1.42188 WP_003403112.1.42202 WP_003403112.1.42208 WP_003403112.1.42247 WP_003403112.1.42255 WP_003403112.1.42273 WP_003403112.1.42278 WP_003403112.1.42304 WP_003403112.1.42309 WP_003403112.1.42385 WP_003403112.1.42400 WP_003403112.1.42409 WP_003403112.1.42430 WP_003403112.1.42461 WP_003403112.1.42467 WP_003403112.1.42473 WP_003403112.1.4248 WP_003403112.1.42494 WP_003403112.1.42519 WP_003403112.1.42524 WP_003403112.1.42534 WP_003403112.1.4255 WP_003403112.1.42562 WP_003403112.1.42568 WP_003403112.1.42570 WP_003403112.1.42618 WP_003403112.1.42660 WP_003403112.1.42695 WP_003403112.1.42704 WP_003403112.1.42705 WP_003403112.1.42722 WP_003403112.1.42782 WP_003403112.1.42835 WP_003403112.1.42839 WP_003403112.1.42842 WP_003403112.1.42905 WP_003403112.1.42930 WP_003403112.1.43005 WP_003403112.1.43009 WP_003403112.1.43053 WP_003403112.1.43082 WP_003403112.1.43087 WP_003403112.1.43208 WP_003403112.1.43236 WP_003403112.1.43246 WP_003403112.1.43255 WP_003403112.1.43266 WP_003403112.1.43269 WP_003403112.1.43273 WP_003403112.1.43296 WP_003403112.1.4335 WP_003403112.1.43368 WP_003403112.1.43395 WP_003403112.1.43462 WP_003403112.1.43475 WP_003403112.1.43478 WP_003403112.1.43588 WP_003403112.1.43664 WP_003403112.1.43684 WP_003403112.1.43686 WP_003403112.1.43706 WP_003403112.1.43716 WP_003403112.1.43815 WP_003403112.1.43861 WP_003403112.1.43863 WP_003403112.1.43866 WP_003403112.1.43872 WP_003403112.1.43885 WP_003403112.1.43897 WP_003403112.1.4390 WP_003403112.1.43902 WP_003403112.1.43921 WP_003403112.1.43937 WP_003403112.1.43960 WP_003403112.1.4399 WP_003403112.1.43996 WP_003403112.1.44 WP_003403112.1.44001 WP_003403112.1.44033 WP_003403112.1.44037 WP_003403112.1.44041 WP_003403112.1.44070 WP_003403112.1.44076 WP_003403112.1.44104 WP_003403112.1.44111 WP_003403112.1.44124 WP_003403112.1.44169 WP_003403112.1.44277 WP_003403112.1.44279 WP_003403112.1.44336 WP_003403112.1.44355 WP_003403112.1.44358 WP_003403112.1.4438 WP_003403112.1.44392 WP_003403112.1.4441 WP_003403112.1.44415 WP_003403112.1.44464 WP_003403112.1.44466 WP_003403112.1.44489 WP_003403112.1.44492 WP_003403112.1.44494 WP_003403112.1.44500 WP_003403112.1.44519 WP_003403112.1.44526 WP_003403112.1.44532 WP_003403112.1.44534 WP_003403112.1.44562 WP_003403112.1.44589 WP_003403112.1.44600 WP_003403112.1.44602 WP_003403112.1.44615 WP_003403112.1.4464 WP_003403112.1.44651 WP_003403112.1.44659 WP_003403112.1.44665 WP_003403112.1.44694 WP_003403112.1.44700 WP_003403112.1.44713 WP_003403112.1.44735 WP_003403112.1.44757 WP_003403112.1.4476 WP_003403112.1.44761 WP_003403112.1.44767 WP_003403112.1.44776 WP_003403112.1.44779 WP_003403112.1.44786 WP_003403112.1.44808 WP_003403112.1.44864 WP_003403112.1.44901 WP_003403112.1.44908 WP_003403112.1.44913 WP_003403112.1.4492 WP_003403112.1.44939 WP_003403112.1.44979 WP_003403112.1.44981 WP_003403112.1.45002 WP_003403112.1.45011 WP_003403112.1.4504 WP_003403112.1.45062 WP_003403112.1.45066 WP_003403112.1.45081 WP_003403112.1.45113 WP_003403112.1.45129 WP_003403112.1.45147 WP_003403112.1.45168 WP_003403112.1.45181 WP_003403112.1.45185 WP_003403112.1.45200 WP_003403112.1.45205 WP_003403112.1.45211 WP_003403112.1.45249 WP_003403112.1.4526 WP_003403112.1.45286 WP_003403112.1.45326 WP_003403112.1.45347 WP_003403112.1.45374 WP_003403112.1.45390 WP_003403112.1.454 WP_003403112.1.45407 WP_003403112.1.45451 WP_003403112.1.45453 WP_003403112.1.45460 WP_003403112.1.45463 WP_003403112.1.45470 WP_003403112.1.45474 WP_003403112.1.45491 WP_003403112.1.45563 WP_003403112.1.45584 WP_003403112.1.45626 WP_003403112.1.45631 WP_003403112.1.45666 WP_003403112.1.45697 WP_003403112.1.4571 WP_003403112.1.45731 WP_003403112.1.45743 WP_003403112.1.45765 WP_003403112.1.45776 WP_003403112.1.45783 WP_003403112.1.45805 WP_003403112.1.45849 WP_003403112.1.45867 WP_003403112.1.45884 WP_003403112.1.4590 WP_003403112.1.45923 WP_003403112.1.45926 WP_003403112.1.45963 WP_003403112.1.45989 WP_003403112.1.45992 WP_003403112.1.46025 WP_003403112.1.46083 WP_003403112.1.46090 WP_003403112.1.46100 WP_003403112.1.46101 WP_003403112.1.46103 WP_003403112.1.46107 WP_003403112.1.46127 WP_003403112.1.46128 WP_003403112.1.46129 WP_003403112.1.46141 WP_003403112.1.46201 WP_003403112.1.46226 WP_003403112.1.4624 WP_003403112.1.46253 WP_003403112.1.46300 WP_003403112.1.46313 WP_003403112.1.46336 WP_003403112.1.46381 WP_003403112.1.46402 WP_003403112.1.46411 WP_003403112.1.4644 WP_003403112.1.46442 WP_003403112.1.46453 WP_003403112.1.46463 WP_003403112.1.46478 WP_003403112.1.46492 WP_003403112.1.46521 WP_003403112.1.46532 WP_003403112.1.46568 WP_003403112.1.46609 WP_003403112.1.46613 WP_003403112.1.46625 WP_003403112.1.46642 WP_003403112.1.46647 WP_003403112.1.46674 WP_003403112.1.46786 WP_003403112.1.46792 WP_003403112.1.46847 WP_003403112.1.46851 WP_003403112.1.4687 WP_003403112.1.46897 WP_003403112.1.46936 WP_003403112.1.46980 WP_003403112.1.47011 WP_003403112.1.47012 WP_003403112.1.47066 WP_003403112.1.47077 WP_003403112.1.47106 WP_003403112.1.47142 WP_003403112.1.47147 WP_003403112.1.47166 WP_003403112.1.47194 WP_003403112.1.47207 WP_003403112.1.47210 WP_003403112.1.47261 WP_003403112.1.47402 WP_003403112.1.47423 WP_003403112.1.47467 WP_003403112.1.4751 WP_003403112.1.47540 WP_003403112.1.47572 WP_003403112.1.47588 WP_003403112.1.47636 WP_003403112.1.4764 WP_003403112.1.47653 WP_003403112.1.47679 WP_003403112.1.47690 WP_003403112.1.4771 WP_003403112.1.47717 WP_003403112.1.47754 WP_003403112.1.47776 WP_003403112.1.47780 WP_003403112.1.47805 WP_003403112.1.47832 WP_003403112.1.47847 WP_003403112.1.47858 WP_003403112.1.47868 WP_003403112.1.47893 WP_003403112.1.47899 WP_003403112.1.479 WP_003403112.1.47912 WP_003403112.1.47913 WP_003403112.1.47926 WP_003403112.1.4794 WP_003403112.1.47943 WP_003403112.1.47944 WP_003403112.1.47959 WP_003403112.1.47974 WP_003403112.1.47993 WP_003403112.1.48004 WP_003403112.1.48039 WP_003403112.1.48084 WP_003403112.1.48097 WP_003403112.1.48101 WP_003403112.1.4813 WP_003403112.1.48130 WP_003403112.1.48135 WP_003403112.1.48143 WP_003403112.1.48155 WP_003403112.1.48170 WP_003403112.1.48173 WP_003403112.1.48185 WP_003403112.1.48204 WP_003403112.1.48219 WP_003403112.1.4823 WP_003403112.1.48240 WP_003403112.1.48256 WP_003403112.1.48264 WP_003403112.1.48287 WP_003403112.1.48330 WP_003403112.1.48333 WP_003403112.1.48354 WP_003403112.1.48372 WP_003403112.1.48383 WP_003403112.1.48419 WP_003403112.1.48423 WP_003403112.1.48443 WP_003403112.1.48450 WP_003403112.1.48462 WP_003403112.1.48543 WP_003403112.1.48550 WP_003403112.1.48605 WP_003403112.1.4863 WP_003403112.1.48648 WP_003403112.1.48658 WP_003403112.1.48666 WP_003403112.1.48687 WP_003403112.1.48779 WP_003403112.1.4878 WP_003403112.1.48798 WP_003403112.1.48802 WP_003403112.1.48826 WP_003403112.1.48857 WP_003403112.1.4890 WP_003403112.1.48946 WP_003403112.1.49048 WP_003403112.1.49059 WP_003403112.1.4907 WP_003403112.1.49103 WP_003403112.1.49110 WP_003403112.1.49111 WP_003403112.1.4919 WP_003403112.1.49251 WP_003403112.1.49263 WP_003403112.1.49291 WP_003403112.1.49296 WP_003403112.1.49335 WP_003403112.1.49337 WP_003403112.1.49419 WP_003403112.1.49437 WP_003403112.1.49439 WP_003403112.1.49474 WP_003403112.1.49506 WP_003403112.1.49516 WP_003403112.1.49523 WP_003403112.1.49526 WP_003403112.1.49588 WP_003403112.1.4959 WP_003403112.1.49687 WP_003403112.1.49699 WP_003403112.1.4971 WP_003403112.1.49736 WP_003403112.1.49746 WP_003403112.1.49764 WP_003403112.1.49773 WP_003403112.1.49796 WP_003403112.1.49814 WP_003403112.1.49815 WP_003403112.1.49816 WP_003403112.1.49839 WP_003403112.1.49857 WP_003403112.1.49878 WP_003403112.1.49880 WP_003403112.1.4999 WP_003403112.1.50068 WP_003403112.1.5008 WP_003403112.1.50081 WP_003403112.1.50122 WP_003403112.1.50126 WP_003403112.1.50162 WP_003403112.1.5018 WP_003403112.1.50194 WP_003403112.1.50235 WP_003403112.1.50249 WP_003403112.1.50265 WP_003403112.1.50271 WP_003403112.1.50347 WP_003403112.1.50372 WP_003403112.1.50398 WP_003403112.1.50444 WP_003403112.1.50466 WP_003403112.1.50472 WP_003403112.1.5048 WP_003403112.1.50498 WP_003403112.1.5050 WP_003403112.1.50540 WP_003403112.1.50554 WP_003403112.1.50557 WP_003403112.1.50610 WP_003403112.1.50632 WP_003403112.1.50642 WP_003403112.1.50655 WP_003403112.1.50659 WP_003403112.1.50683 WP_003403112.1.50689 WP_003403112.1.50692 WP_003403112.1.50714 WP_003403112.1.50756 WP_003403112.1.50784 WP_003403112.1.50794 WP_003403112.1.50841 WP_003403112.1.50877 WP_003403112.1.5096 WP_003403112.1.51009 WP_003403112.1.51037 WP_003403112.1.51074 WP_003403112.1.51101 WP_003403112.1.51116 WP_003403112.1.51156 WP_003403112.1.51157 WP_003403112.1.51213 WP_003403112.1.51232 WP_003403112.1.51247 WP_003403112.1.51266 WP_003403112.1.51279 WP_003403112.1.51329 WP_003403112.1.51391 WP_003403112.1.51422 WP_003403112.1.51445 WP_003403112.1.51455 WP_003403112.1.51466 WP_003403112.1.51468 WP_003403112.1.51478 WP_003403112.1.51497 WP_003403112.1.51520 WP_003403112.1.51593 WP_003403112.1.5164 WP_003403112.1.51647 WP_003403112.1.51660 WP_003403112.1.51696 WP_003403112.1.51721 WP_003403112.1.51788 WP_003403112.1.51795 WP_003403112.1.51801 WP_003403112.1.51817 WP_003403112.1.51854 WP_003403112.1.51923 WP_003403112.1.51942 WP_003403112.1.51948 WP_003403112.1.51963 WP_003403112.1.51969 WP_003403112.1.52000 WP_003403112.1.52001 WP_003403112.1.52003 WP_003403112.1.52006 WP_003403112.1.52038 WP_003403112.1.52046 WP_003403112.1.52059 WP_003403112.1.52082 WP_003403112.1.52102 WP_003403112.1.52106 WP_003403112.1.52166 WP_003403112.1.52168 WP_003403112.1.52173 WP_003403112.1.52178 WP_003403112.1.52216 WP_003403112.1.52241 WP_003403112.1.52280 WP_003403112.1.52314 WP_003403112.1.52385 WP_003403112.1.52390 WP_003403112.1.524 WP_003403112.1.52460 WP_003403112.1.52485 WP_003403112.1.52486 WP_003403112.1.52495 WP_003403112.1.52504 WP_003403112.1.52522 WP_003403112.1.52531 WP_003403112.1.52533 WP_003403112.1.52545 WP_003403112.1.52553 WP_003403112.1.52563 WP_003403112.1.52574 WP_003403112.1.52641 WP_003403112.1.52674 WP_003403112.1.52708 WP_003403112.1.52713 WP_003403112.1.52761 WP_003403112.1.52778 WP_003403112.1.52791 WP_003403112.1.52797 WP_003403112.1.52818 WP_003403112.1.52872 WP_003403112.1.52891 WP_003403112.1.52892 WP_003403112.1.52909 WP_003403112.1.52970 WP_003403112.1.52998 WP_003403112.1.53053 WP_003403112.1.53056 WP_003403112.1.5306 WP_003403112.1.5309 WP_003403112.1.531 WP_003403112.1.53142 WP_003403112.1.53143 WP_003403112.1.53157 WP_003403112.1.53167 WP_003403112.1.53200 WP_003403112.1.53204 WP_003403112.1.53213 WP_003403112.1.53217 WP_003403112.1.53229 WP_003403112.1.53230 WP_003403112.1.53237 WP_003403112.1.53254 WP_003403112.1.53257 WP_003403112.1.53276 WP_003403112.1.53278 WP_003403112.1.533 WP_003403112.1.53302 WP_003403112.1.5334 WP_003403112.1.53353 WP_003403112.1.53381 WP_003403112.1.53460 WP_003403112.1.53480 WP_003403112.1.53517 WP_003403112.1.53522 WP_003403112.1.53525 WP_003403112.1.53526 WP_003403112.1.53553 WP_003403112.1.53606 WP_003403112.1.53609 WP_003403112.1.53628 WP_003403112.1.53679 WP_003403112.1.53715 WP_003403112.1.53730 WP_003403112.1.53743 WP_003403112.1.53754 WP_003403112.1.53775 WP_003403112.1.53803 WP_003403112.1.53818 WP_003403112.1.53822 WP_003403112.1.53853 WP_003403112.1.53865 WP_003403112.1.53888 WP_003403112.1.53912 WP_003403112.1.53952 WP_003403112.1.5398 WP_003403112.1.5408 WP_003403112.1.54089 WP_003403112.1.54093 WP_003403112.1.54099 WP_003403112.1.54112 WP_003403112.1.54125 WP_003403112.1.54141 WP_003403112.1.54162 WP_003403112.1.54179 WP_003403112.1.54218 WP_003403112.1.54225 WP_003403112.1.54227 WP_003403112.1.54232 WP_003403112.1.54241 WP_003403112.1.54247 WP_003403112.1.54260 WP_003403112.1.54275 WP_003403112.1.5429 WP_003403112.1.54294 WP_003403112.1.54314 WP_003403112.1.54347 WP_003403112.1.54351 WP_003403112.1.54370 WP_003403112.1.54428 WP_003403112.1.54449 WP_003403112.1.54494 WP_003403112.1.54519 WP_003403112.1.5452 WP_003403112.1.54531 WP_003403112.1.54537 WP_003403112.1.54553 WP_003403112.1.54555 WP_003403112.1.54633 WP_003403112.1.54687 WP_003403112.1.54705 WP_003403112.1.54730 WP_003403112.1.54732 WP_003403112.1.5475 WP_003403112.1.54797 WP_003403112.1.54836 WP_003403112.1.54838 WP_003403112.1.54860 WP_003403112.1.54888 WP_003403112.1.54905 WP_003403112.1.54909 WP_003403112.1.54937 WP_003403112.1.54939 WP_003403112.1.54944 WP_003403112.1.54945 WP_003403112.1.54953 WP_003403112.1.54964 WP_003403112.1.55015 WP_003403112.1.55022 WP_003403112.1.55023 WP_003403112.1.55051 WP_003403112.1.55088 WP_003403112.1.55106 WP_003403112.1.55126 WP_003403112.1.55128 WP_003403112.1.55140 WP_003403112.1.55210 WP_003403112.1.55227 WP_003403112.1.55248 WP_003403112.1.55257 WP_003403112.1.55258 WP_003403112.1.55267 WP_003403112.1.55307 WP_003403112.1.55326 WP_003403112.1.55328 WP_003403112.1.5533 WP_003403112.1.55345 WP_003403112.1.55398 WP_003403112.1.55441 WP_003403112.1.55501 WP_003403112.1.55504 WP_003403112.1.55578 WP_003403112.1.55626 WP_003403112.1.5569 WP_003403112.1.55723 WP_003403112.1.55735 WP_003403112.1.5574 WP_003403112.1.55807 WP_003403112.1.55819 WP_003403112.1.55821 WP_003403112.1.5583 WP_003403112.1.55849 WP_003403112.1.55856 WP_003403112.1.55882 WP_003403112.1.55883 WP_003403112.1.55894 WP_003403112.1.55902 WP_003403112.1.55909 WP_003403112.1.5591 WP_003403112.1.55961 WP_003403112.1.55977 WP_003403112.1.55983 WP_003403112.1.56028 WP_003403112.1.56057 WP_003403112.1.56060 WP_003403112.1.56107 WP_003403112.1.56132 WP_003403112.1.56163 WP_003403112.1.56167 WP_003403112.1.56178 WP_003403112.1.56287 WP_003403112.1.56292 WP_003403112.1.56341 WP_003403112.1.56359 WP_003403112.1.56365 WP_003403112.1.56473 WP_003403112.1.56478 WP_003403112.1.56500 WP_003403112.1.56534 WP_003403112.1.5656 WP_003403112.1.56577 WP_003403112.1.56625 WP_003403112.1.56670 WP_003403112.1.567 WP_003403112.1.56701 WP_003403112.1.56709 WP_003403112.1.56743 WP_003403112.1.56755 WP_003403112.1.56764 WP_003403112.1.56770 WP_003403112.1.56795 WP_003403112.1.5681 WP_003403112.1.56863 WP_003403112.1.56869 WP_003403112.1.56926 WP_003403112.1.56961 WP_003403112.1.56971 WP_003403112.1.56972 WP_003403112.1.57023 WP_003403112.1.57035 WP_003403112.1.57077 WP_003403112.1.57087 WP_003403112.1.57094 WP_003403112.1.57134 WP_003403112.1.57151 WP_003403112.1.57169 WP_003403112.1.57208 WP_003403112.1.57212 WP_003403112.1.57230 WP_003403112.1.5724 WP_003403112.1.57273 WP_003403112.1.573 WP_003403112.1.57326 WP_003403112.1.57328 WP_003403112.1.57331 WP_003403112.1.57340 WP_003403112.1.57352 WP_003403112.1.57380 WP_003403112.1.5744 WP_003403112.1.57440 WP_003403112.1.5745 WP_003403112.1.57461 WP_003403112.1.57489 WP_003403112.1.575 WP_003403112.1.57519 WP_003403112.1.57525 WP_003403112.1.5758 WP_003403112.1.57596 WP_003403112.1.57604 WP_003403112.1.57617 WP_003403112.1.57619 WP_003403112.1.57627 WP_003403112.1.57642 WP_003403112.1.57658 WP_003403112.1.57667 WP_003403112.1.57675 WP_003403112.1.57689 WP_003403112.1.57821 WP_003403112.1.57825 WP_003403112.1.57906 WP_003403112.1.57924 WP_003403112.1.57926 WP_003403112.1.57930 WP_003403112.1.57957 WP_003403112.1.57960 WP_003403112.1.57964 WP_003403112.1.57991 WP_003403112.1.58086 WP_003403112.1.58103 WP_003403112.1.5811 WP_003403112.1.58121 WP_003403112.1.58145 WP_003403112.1.58174 WP_003403112.1.58202 WP_003403112.1.5824 WP_003403112.1.58259 WP_003403112.1.58288 WP_003403112.1.5830 WP_003403112.1.58303 WP_003403112.1.58311 WP_003403112.1.58330 WP_003403112.1.58359 WP_003403112.1.58386 WP_003403112.1.58393 WP_003403112.1.58431 WP_003403112.1.5844 WP_003403112.1.58457 WP_003403112.1.58488 WP_003403112.1.58518 WP_003403112.1.58534 WP_003403112.1.58559 WP_003403112.1.58567 WP_003403112.1.58573 WP_003403112.1.58602 WP_003403112.1.58619 WP_003403112.1.58630 WP_003403112.1.5865 WP_003403112.1.58671 WP_003403112.1.58690 WP_003403112.1.58743 WP_003403112.1.58754 WP_003403112.1.5879 WP_003403112.1.5881 WP_003403112.1.58848 WP_003403112.1.58857 WP_003403112.1.5890 WP_003403112.1.58904 WP_003403112.1.58921 WP_003403112.1.58939 WP_003403112.1.58941 WP_003403112.1.58953 WP_003403112.1.58961 WP_003403112.1.59025 WP_003403112.1.59037 WP_003403112.1.59044 WP_003403112.1.59085 WP_003403112.1.59130 WP_003403112.1.59147 WP_003403112.1.59166 WP_003403112.1.59205 WP_003403112.1.59209 WP_003403112.1.59237 WP_003403112.1.59253 WP_003403112.1.59254 WP_003403112.1.59262 WP_003403112.1.59270 WP_003403112.1.5928 WP_003403112.1.59305 WP_003403112.1.59309 WP_003403112.1.59316 WP_003403112.1.59326 WP_003403112.1.59328 WP_003403112.1.59333 WP_003403112.1.59388 WP_003403112.1.59428 WP_003403112.1.59487 WP_003403112.1.59537 WP_003403112.1.59561 WP_003403112.1.59677 WP_003403112.1.59722 WP_003403112.1.59732 WP_003403112.1.59750 WP_003403112.1.59761 WP_003403112.1.59808 WP_003403112.1.59856 WP_003403112.1.59860 WP_003403112.1.59861 WP_003403112.1.5987 WP_003403112.1.59878 WP_003403112.1.59888 WP_003403112.1.59952 WP_003403112.1.5996 WP_003403112.1.59961 WP_003403112.1.59974 WP_003403112.1.6000 WP_003403112.1.60007 WP_003403112.1.60016 WP_003403112.1.60047 WP_003403112.1.6007 WP_003403112.1.60091 WP_003403112.1.60121 WP_003403112.1.60125 WP_003403112.1.60135 WP_003403112.1.60139 WP_003403112.1.60152 WP_003403112.1.60171 WP_003403112.1.60197 WP_003403112.1.6020 WP_003403112.1.60207 WP_003403112.1.60267 WP_003403112.1.60291 WP_003403112.1.60305 WP_003403112.1.60312 WP_003403112.1.60313 WP_003403112.1.60314 WP_003403112.1.60376 WP_003403112.1.60403 WP_003403112.1.60413 WP_003403112.1.60421 WP_003403112.1.60479 WP_003403112.1.60487 WP_003403112.1.60512 WP_003403112.1.60573 WP_003403112.1.60632 WP_003403112.1.60657 WP_003403112.1.60689 WP_003403112.1.60727 WP_003403112.1.60738 WP_003403112.1.60763 WP_003403112.1.6077 WP_003403112.1.60791 WP_003403112.1.60834 WP_003403112.1.60870 WP_003403112.1.60878 WP_003403112.1.60879 WP_003403112.1.60913 WP_003403112.1.60978 WP_003403112.1.61000 WP_003403112.1.61001 WP_003403112.1.61012 WP_003403112.1.61014 WP_003403112.1.61015 WP_003403112.1.61037 WP_003403112.1.61052 WP_003403112.1.61065 WP_003403112.1.61100 WP_003403112.1.61101 WP_003403112.1.61138 WP_003403112.1.61142 WP_003403112.1.61198 WP_003403112.1.612 WP_003403112.1.61281 WP_003403112.1.61314 WP_003403112.1.61321 WP_003403112.1.61326 WP_003403112.1.61328 WP_003403112.1.61368 WP_003403112.1.61391 WP_003403112.1.61406 WP_003403112.1.61409 WP_003403112.1.61422 WP_003403112.1.61425 WP_003403112.1.61428 WP_003403112.1.61469 WP_003403112.1.61494 WP_003403112.1.61522 WP_003403112.1.61557 WP_003403112.1.61567 WP_003403112.1.61571 WP_003403112.1.61573 WP_003403112.1.61584 WP_003403112.1.61586 WP_003403112.1.6159 WP_003403112.1.61592 WP_003403112.1.6163 WP_003403112.1.61655 WP_003403112.1.61665 WP_003403112.1.61682 WP_003403112.1.61719 WP_003403112.1.61728 WP_003403112.1.61750 WP_003403112.1.61754 WP_003403112.1.61755 WP_003403112.1.6179 WP_003403112.1.61793 WP_003403112.1.61816 WP_003403112.1.61842 WP_003403112.1.61850 WP_003403112.1.61862 WP_003403112.1.61865 WP_003403112.1.61868 WP_003403112.1.61911 WP_003403112.1.61925 WP_003403112.1.61953 WP_003403112.1.61979 WP_003403112.1.61986 WP_003403112.1.61987 WP_003403112.1.61998 WP_003403112.1.62021 WP_003403112.1.62087 WP_003403112.1.62101 WP_003403112.1.6211 WP_003403112.1.62132 WP_003403112.1.62162 WP_003403112.1.62225 WP_003403112.1.62238 WP_003403112.1.62249 WP_003403112.1.62270 WP_003403112.1.62281 WP_003403112.1.62307 WP_003403112.1.6231 WP_003403112.1.62359 WP_003403112.1.62379 WP_003403112.1.62395 WP_003403112.1.62408 WP_003403112.1.62449 WP_003403112.1.62468 WP_003403112.1.6248 WP_003403112.1.62565 WP_003403112.1.62594 WP_003403112.1.62606 WP_003403112.1.62616 WP_003403112.1.62687 WP_003403112.1.62730 WP_003403112.1.62761 WP_003403112.1.62766 WP_003403112.1.62786 WP_003403112.1.62813 WP_003403112.1.62839 WP_003403112.1.62841 WP_003403112.1.62909 WP_003403112.1.62936 WP_003403112.1.6294 WP_003403112.1.6295 WP_003403112.1.62962 WP_003403112.1.63007 WP_003403112.1.63019 WP_003403112.1.63032 WP_003403112.1.63037 WP_003403112.1.63064 WP_003403112.1.63072 WP_003403112.1.6308 WP_003403112.1.63081 WP_003403112.1.63096 WP_003403112.1.63106 WP_003403112.1.6314 WP_003403112.1.63144 WP_003403112.1.63154 WP_003403112.1.63160 WP_003403112.1.63161 WP_003403112.1.63166 WP_003403112.1.63175 WP_003403112.1.63194 WP_003403112.1.6322 WP_003403112.1.63222 WP_003403112.1.63247 WP_003403112.1.6328 WP_003403112.1.63291 WP_003403112.1.63317 WP_003403112.1.63331 WP_003403112.1.63373 WP_003403112.1.63384 WP_003403112.1.63403 WP_003403112.1.63424 WP_003403112.1.63428 WP_003403112.1.6345 WP_003403112.1.63464 WP_003403112.1.63483 WP_003403112.1.63502 WP_003403112.1.63504 WP_003403112.1.63522 WP_003403112.1.63538 WP_003403112.1.63564 WP_003403112.1.63567 WP_003403112.1.63596 WP_003403112.1.63600 WP_003403112.1.63623 WP_003403112.1.63624 WP_003403112.1.63625 WP_003403112.1.63627 WP_003403112.1.63654 WP_003403112.1.63662 WP_003403112.1.63711 WP_003403112.1.63734 WP_003403112.1.63807 WP_003403112.1.63819 WP_003403112.1.63844 WP_003403112.1.63888 WP_003403112.1.63913 WP_003403112.1.63915 WP_003403112.1.63970 WP_003403112.1.64000 WP_003403112.1.64058 WP_003403112.1.64065 WP_003403112.1.6407 WP_003403112.1.64082 WP_003403112.1.64102 WP_003403112.1.64104 WP_003403112.1.64119 WP_003403112.1.64219 WP_003403112.1.64223 WP_003403112.1.64228 WP_003403112.1.64235 WP_003403112.1.64249 WP_003403112.1.6427 WP_003403112.1.64278 WP_003403112.1.6443 WP_003403112.1.64497 WP_003403112.1.64511 WP_003403112.1.64513 WP_003403112.1.64514 WP_003403112.1.64515 WP_003403112.1.64522 WP_003403112.1.64526 WP_003403112.1.64543 WP_003403112.1.6456 WP_003403112.1.64567 WP_003403112.1.64588 WP_003403112.1.64589 WP_003403112.1.64594 WP_003403112.1.64595 WP_003403112.1.64608 WP_003403112.1.64619 WP_003403112.1.64629 WP_003403112.1.64664 WP_003403112.1.64672 WP_003403112.1.64680 WP_003403112.1.64682 WP_003403112.1.64727 WP_003403112.1.64729 WP_003403112.1.64776 WP_003403112.1.64802 WP_003403112.1.64832 WP_003403112.1.6486 WP_003403112.1.64870 WP_003403112.1.64898 WP_003403112.1.64922 WP_003403112.1.64924 WP_003403112.1.6493 WP_003403112.1.64937 WP_003403112.1.64941 WP_003403112.1.64973 WP_003403112.1.65001 WP_003403112.1.65026 WP_003403112.1.65053 WP_003403112.1.65070 WP_003403112.1.65079 WP_003403112.1.65102 WP_003403112.1.65157 WP_003403112.1.65181 WP_003403112.1.65212 WP_003403112.1.65229 WP_003403112.1.6523 WP_003403112.1.65253 WP_003403112.1.65289 WP_003403112.1.65291 WP_003403112.1.65315 WP_003403112.1.65359 WP_003403112.1.6536 WP_003403112.1.65374 WP_003403112.1.65414 WP_003403112.1.65416 WP_003403112.1.65455 WP_003403112.1.65467 WP_003403112.1.65488 WP_003403112.1.65529 WP_003403112.1.65539 WP_003403112.1.65583 WP_003403112.1.65612 WP_003403112.1.65623 WP_003403112.1.65635 WP_003403112.1.65637 WP_003403112.1.65648 WP_003403112.1.65688 WP_003403112.1.65733 WP_003403112.1.65746 WP_003403112.1.65747 WP_003403112.1.65759 WP_003403112.1.65816 WP_003403112.1.65830 WP_003403112.1.65858 WP_003403112.1.65862 WP_003403112.1.65869 WP_003403112.1.65929 WP_003403112.1.65958 WP_003403112.1.65974 WP_003403112.1.66004 WP_003403112.1.6606 WP_003403112.1.66089 WP_003403112.1.66149 WP_003403112.1.66151 WP_003403112.1.66229 WP_003403112.1.66276 WP_003403112.1.66323 WP_003403112.1.66325 WP_003403112.1.6633 WP_003403112.1.66334 WP_003403112.1.66367 WP_003403112.1.66394 WP_003403112.1.66396 WP_003403112.1.66451 WP_003403112.1.66455 WP_003403112.1.66457 WP_003403112.1.66464 WP_003403112.1.66466 WP_003403112.1.66504 WP_003403112.1.66558 WP_003403112.1.66580 WP_003403112.1.66582 WP_003403112.1.66612 WP_003403112.1.66617 WP_003403112.1.66635 WP_003403112.1.66656 WP_003403112.1.66663 WP_003403112.1.66675 WP_003403112.1.66715 WP_003403112.1.66762 WP_003403112.1.66776 WP_003403112.1.66808 WP_003403112.1.66817 WP_003403112.1.66819 WP_003403112.1.66826 WP_003403112.1.66830 WP_003403112.1.66842 WP_003403112.1.66868 WP_003403112.1.66878 WP_003403112.1.66880 WP_003403112.1.66893 WP_003403112.1.66961 WP_003403112.1.67005 WP_003403112.1.67044 WP_003403112.1.67089 WP_003403112.1.67098 WP_003403112.1.67146 WP_003403112.1.67197 WP_003403112.1.67198 WP_003403112.1.6720 WP_003403112.1.67207 WP_003403112.1.67218 WP_003403112.1.67225 WP_003403112.1.6724 WP_003403112.1.67257 WP_003403112.1.67298 WP_003403112.1.67324 WP_003403112.1.67332 WP_003403112.1.67346 WP_003403112.1.67354 WP_003403112.1.67381 WP_003403112.1.67396 WP_003403112.1.67417 WP_003403112.1.67422 WP_003403112.1.67453 WP_003403112.1.67459 WP_003403112.1.67481 WP_003403112.1.67482 WP_003403112.1.67496 WP_003403112.1.67499 WP_003403112.1.67516 WP_003403112.1.67523 WP_003403112.1.67536 WP_003403112.1.67575 WP_003403112.1.67587 WP_003403112.1.67600 WP_003403112.1.67602 WP_003403112.1.67679 WP_003403112.1.67692 WP_003403112.1.67744 WP_003403112.1.6775 WP_003403112.1.67750 WP_003403112.1.67809 WP_003403112.1.67816 WP_003403112.1.67844 WP_003403112.1.67848 WP_003403112.1.67888 WP_003403112.1.67915 WP_003403112.1.67945 WP_003403112.1.67949 WP_003403112.1.67980 WP_003403112.1.67982 WP_003403112.1.68029 WP_003403112.1.68037 WP_003403112.1.68038 WP_003403112.1.68045 WP_003403112.1.68057 WP_003403112.1.68083 WP_003403112.1.68088 WP_003403112.1.68106 WP_003403112.1.68110 WP_003403112.1.68164 WP_003403112.1.68169 WP_003403112.1.68193 WP_003403112.1.68212 WP_003403112.1.68227 WP_003403112.1.68243 WP_003403112.1.6825 WP_003403112.1.68297 WP_003403112.1.68309 WP_003403112.1.68325 WP_003403112.1.68329 WP_003403112.1.68340 WP_003403112.1.68384 WP_003403112.1.68388 WP_003403112.1.68429 WP_003403112.1.6843 WP_003403112.1.68433 WP_003403112.1.68444 WP_003403112.1.68484 WP_003403112.1.68518 WP_003403112.1.68569 WP_003403112.1.68576 WP_003403112.1.68586 WP_003403112.1.68624 WP_003403112.1.68637 WP_003403112.1.68667 WP_003403112.1.68684 WP_003403112.1.68704 WP_003403112.1.6872 WP_003403112.1.68730 WP_003403112.1.68734 WP_003403112.1.68748 WP_003403112.1.68754 WP_003403112.1.6876 WP_003403112.1.68761 WP_003403112.1.68763 WP_003403112.1.68774 WP_003403112.1.68796 WP_003403112.1.68824 WP_003403112.1.68833 WP_003403112.1.68841 WP_003403112.1.68859 WP_003403112.1.68876 WP_003403112.1.68906 WP_003403112.1.68916 WP_003403112.1.68923 WP_003403112.1.6896 WP_003403112.1.68981 WP_003403112.1.68984 WP_003403112.1.68997 WP_003403112.1.69008 WP_003403112.1.69076 WP_003403112.1.6908 WP_003403112.1.69082 WP_003403112.1.69178 WP_003403112.1.69208 WP_003403112.1.69231 WP_003403112.1.69256 WP_003403112.1.6935 WP_003403112.1.69374 WP_003403112.1.69398 WP_003403112.1.69401 WP_003403112.1.69426 WP_003403112.1.69429 WP_003403112.1.6949 WP_003403112.1.69511 WP_003403112.1.69526 WP_003403112.1.69528 WP_003403112.1.69581 WP_003403112.1.6960 WP_003403112.1.69617 WP_003403112.1.69634 WP_003403112.1.69647 WP_003403112.1.69659 WP_003403112.1.69682 WP_003403112.1.69684 WP_003403112.1.69686 WP_003403112.1.69707 WP_003403112.1.69723 WP_003403112.1.69736 WP_003403112.1.69778 WP_003403112.1.69800 WP_003403112.1.69873 WP_003403112.1.69898 WP_003403112.1.69913 WP_003403112.1.69925 WP_003403112.1.69931 WP_003403112.1.69938 WP_003403112.1.69955 WP_003403112.1.69957 WP_003403112.1.69981 WP_003403112.1.69990 WP_003403112.1.70 WP_003403112.1.70000 WP_003403112.1.70017 WP_003403112.1.70032 WP_003403112.1.70055 WP_003403112.1.70062 WP_003403112.1.70072 WP_003403112.1.70132 WP_003403112.1.70227 WP_003403112.1.70255 WP_003403112.1.70271 WP_003403112.1.70274 WP_003403112.1.7029 WP_003403112.1.70325 WP_003403112.1.70328 WP_003403112.1.70356 WP_003403112.1.70364 WP_003403112.1.70368 WP_003403112.1.70418 WP_003403112.1.70422 WP_003403112.1.70435 WP_003403112.1.70444 WP_003403112.1.70471 WP_003403112.1.70494 WP_003403112.1.70505 WP_003403112.1.70573 WP_003403112.1.70577 WP_003403112.1.70610 WP_003403112.1.70615 WP_003403112.1.70618 WP_003403112.1.70626 WP_003403112.1.70668 WP_003403112.1.70699 WP_003403112.1.70729 WP_003403112.1.70757 WP_003403112.1.70782 WP_003403112.1.70834 WP_003403112.1.7084 WP_003403112.1.70840 WP_003403112.1.70864 WP_003403112.1.70871 WP_003403112.1.70915 WP_003403112.1.70955 WP_003403112.1.70958 WP_003403112.1.70964 WP_003403112.1.71015 WP_003403112.1.71026 WP_003403112.1.71063 WP_003403112.1.71076 WP_003403112.1.71083 WP_003403112.1.71118 WP_003403112.1.71128 WP_003403112.1.7113 WP_003403112.1.71187 WP_003403112.1.71191 WP_003403112.1.71255 WP_003403112.1.71258 WP_003403112.1.71259 WP_003403112.1.71289 WP_003403112.1.71329 WP_003403112.1.71331 WP_003403112.1.71344 WP_003403112.1.71390 WP_003403112.1.71457 WP_003403112.1.7146 WP_003403112.1.71464 WP_003403112.1.71490 WP_003403112.1.71492 WP_003403112.1.71516 WP_003403112.1.71527 WP_003403112.1.71532 WP_003403112.1.71545 WP_003403112.1.71546 WP_003403112.1.71569 WP_003403112.1.71604 WP_003403112.1.71630 WP_003403112.1.71654 WP_003403112.1.71664 WP_003403112.1.71665 WP_003403112.1.71683 WP_003403112.1.71701 WP_003403112.1.71718 WP_003403112.1.71731 WP_003403112.1.71778 WP_003403112.1.71781 WP_003403112.1.71803 WP_003403112.1.71847 WP_003403112.1.7185 WP_003403112.1.71851 WP_003403112.1.71871 WP_003403112.1.71970 WP_003403112.1.72047 WP_003403112.1.72072 WP_003403112.1.72122 WP_003403112.1.72143 WP_003403112.1.7216 WP_003403112.1.72168 WP_003403112.1.72179 WP_003403112.1.72209 WP_003403112.1.72227 WP_003403112.1.7224 WP_003403112.1.72268 WP_003403112.1.72332 WP_003403112.1.72380 WP_003403112.1.72401 WP_003403112.1.72405 WP_003403112.1.72420 WP_003403112.1.72441 WP_003403112.1.72452 WP_003403112.1.72457 WP_003403112.1.72460 WP_003403112.1.72466 WP_003403112.1.72487 WP_003403112.1.72488 WP_003403112.1.72492 WP_003403112.1.72506 WP_003403112.1.7256 WP_003403112.1.72576 WP_003403112.1.72578 WP_003403112.1.72585 WP_003403112.1.72591 WP_003403112.1.72592 WP_003403112.1.72640 WP_003403112.1.72684 WP_003403112.1.72739 WP_003403112.1.72755 WP_003403112.1.72759 WP_003403112.1.72784 WP_003403112.1.72792 WP_003403112.1.72826 WP_003403112.1.72831 WP_003403112.1.72853 WP_003403112.1.72879 WP_003403112.1.72880 WP_003403112.1.72938 WP_003403112.1.72954 WP_003403112.1.72957 WP_003403112.1.72959 WP_003403112.1.72973 WP_003403112.1.7298 WP_003403112.1.72988 WP_003403112.1.73006 WP_003403112.1.73013 WP_003403112.1.73025 WP_003403112.1.73028 WP_003403112.1.73042 WP_003403112.1.73092 WP_003403112.1.73118 WP_003403112.1.7312 WP_003403112.1.73127 WP_003403112.1.73134 WP_003403112.1.73150 WP_003403112.1.73154 WP_003403112.1.73182 WP_003403112.1.73205 WP_003403112.1.7321 WP_003403112.1.73310 WP_003403112.1.73365 WP_003403112.1.73391 WP_003403112.1.73404 WP_003403112.1.73424 WP_003403112.1.73436 WP_003403112.1.73453 WP_003403112.1.73465 WP_003403112.1.73466 WP_003403112.1.73470 WP_003403112.1.73471 WP_003403112.1.73478 WP_003403112.1.73482 WP_003403112.1.73507 WP_003403112.1.73550 WP_003403112.1.73564 WP_003403112.1.73629 WP_003403112.1.73644 WP_003403112.1.73661 WP_003403112.1.7368 WP_003403112.1.73688 WP_003403112.1.73723 WP_003403112.1.73744 WP_003403112.1.73750 WP_003403112.1.73760 WP_003403112.1.73774 WP_003403112.1.7379 WP_003403112.1.73840 WP_003403112.1.73876 WP_003403112.1.73986 WP_003403112.1.74016 WP_003403112.1.74039 WP_003403112.1.74101 WP_003403112.1.74107 WP_003403112.1.74120 WP_003403112.1.74129 WP_003403112.1.74144 WP_003403112.1.74190 WP_003403112.1.74210 WP_003403112.1.7423 WP_003403112.1.74269 WP_003403112.1.74282 WP_003403112.1.74291 WP_003403112.1.74296 WP_003403112.1.74304 WP_003403112.1.7432 WP_003403112.1.74347 WP_003403112.1.74378 WP_003403112.1.74395 WP_003403112.1.74400 WP_003403112.1.74401 WP_003403112.1.74432 WP_003403112.1.74442 WP_003403112.1.74487 WP_003403112.1.74499 WP_003403112.1.74504 WP_003403112.1.74511 WP_003403112.1.74523 WP_003403112.1.74525 WP_003403112.1.74551 WP_003403112.1.74641 WP_003403112.1.74653 WP_003403112.1.74683 WP_003403112.1.7469 WP_003403112.1.74725 WP_003403112.1.74760 WP_003403112.1.74786 WP_003403112.1.74809 WP_003403112.1.74820 WP_003403112.1.74870 WP_003403112.1.74881 WP_003403112.1.74888 WP_003403112.1.7496 WP_003403112.1.74988 WP_003403112.1.75043 WP_003403112.1.75045 WP_003403112.1.75055 WP_003403112.1.75081 WP_003403112.1.75120 WP_003403112.1.75163 WP_003403112.1.75200 WP_003403112.1.75202 WP_003403112.1.75234 WP_003403112.1.75239 WP_003403112.1.75250 WP_003403112.1.75263 WP_003403112.1.75281 WP_003403112.1.75342 WP_003403112.1.7535 WP_003403112.1.75391 WP_003403112.1.75395 WP_003403112.1.75510 WP_003403112.1.75581 WP_003403112.1.75598 WP_003403112.1.75645 WP_003403112.1.75665 WP_003403112.1.75671 WP_003403112.1.75749 WP_003403112.1.75772 WP_003403112.1.75811 WP_003403112.1.75864 WP_003403112.1.75868 WP_003403112.1.75878 WP_003403112.1.75927 WP_003403112.1.75946 WP_003403112.1.75968 WP_003403112.1.76007 WP_003403112.1.76016 WP_003403112.1.76045 WP_003403112.1.76052 WP_003403112.1.76058 WP_003403112.1.76064 WP_003403112.1.76110 WP_003403112.1.76126 WP_003403112.1.76138 WP_003403112.1.76157 WP_003403112.1.76177 WP_003403112.1.76183 WP_003403112.1.76239 WP_003403112.1.76272 WP_003403112.1.76277 WP_003403112.1.76280 WP_003403112.1.76281 WP_003403112.1.76291 WP_003403112.1.76297 WP_003403112.1.76413 WP_003403112.1.76436 WP_003403112.1.76443 WP_003403112.1.76521 WP_003403112.1.76533 WP_003403112.1.76616 WP_003403112.1.76625 WP_003403112.1.76635 WP_003403112.1.76638 WP_003403112.1.76639 WP_003403112.1.76640 WP_003403112.1.76644 WP_003403112.1.76677 WP_003403112.1.76678 WP_003403112.1.76679 WP_003403112.1.76734 WP_003403112.1.76744 WP_003403112.1.76750 WP_003403112.1.76754 WP_003403112.1.76757 WP_003403112.1.76781 WP_003403112.1.76818 WP_003403112.1.76835 WP_003403112.1.76873 WP_003403112.1.76881 WP_003403112.1.76888 WP_003403112.1.76900 WP_003403112.1.7691 WP_003403112.1.76947 WP_003403112.1.76954 WP_003403112.1.76955 WP_003403112.1.76963 WP_003403112.1.770 WP_003403112.1.77008 WP_003403112.1.77056 WP_003403112.1.77065 WP_003403112.1.77075 WP_003403112.1.77107 WP_003403112.1.77115 WP_003403112.1.77118 WP_003403112.1.77125 WP_003403112.1.77141 WP_003403112.1.77142 WP_003403112.1.77250 WP_003403112.1.77252 WP_003403112.1.77260 WP_003403112.1.77266 WP_003403112.1.77280 WP_003403112.1.77285 WP_003403112.1.77312 WP_003403112.1.77348 WP_003403112.1.77351 WP_003403112.1.77352 WP_003403112.1.77361 WP_003403112.1.774 WP_003403112.1.7740 WP_003403112.1.77404 WP_003403112.1.77425 WP_003403112.1.77463 WP_003403112.1.77474 WP_003403112.1.77484 WP_003403112.1.77491 WP_003403112.1.77499 WP_003403112.1.77510 WP_003403112.1.77530 WP_003403112.1.77554 WP_003403112.1.77559 WP_003403112.1.77599 WP_003403112.1.77605 WP_003403112.1.7762 WP_003403112.1.77627 WP_003403112.1.77649 WP_003403112.1.77654 WP_003403112.1.7766 WP_003403112.1.77667 WP_003403112.1.77706 WP_003403112.1.77726 WP_003403112.1.77774 WP_003403112.1.7778 WP_003403112.1.77809 WP_003403112.1.77820 WP_003403112.1.77843 WP_003403112.1.77855 WP_003403112.1.77868 WP_003403112.1.77909 WP_003403112.1.77911 WP_003403112.1.77931 WP_003403112.1.77984 WP_003403112.1.78020 WP_003403112.1.78075 WP_003403112.1.78084 WP_003403112.1.7809 WP_003403112.1.78098 WP_003403112.1.78105 WP_003403112.1.78113 WP_003403112.1.78136 WP_003403112.1.78162 WP_003403112.1.7817 WP_003403112.1.78200 WP_003403112.1.78216 WP_003403112.1.78236 WP_003403112.1.78238 WP_003403112.1.78322 WP_003403112.1.78338 WP_003403112.1.7836 WP_003403112.1.78360 WP_003403112.1.78386 WP_003403112.1.78435 WP_003403112.1.7844 WP_003403112.1.78459 WP_003403112.1.78488 WP_003403112.1.7849 WP_003403112.1.78499 WP_003403112.1.785 WP_003403112.1.78516 WP_003403112.1.78526 WP_003403112.1.78547 WP_003403112.1.78574 WP_003403112.1.78580 WP_003403112.1.7860 WP_003403112.1.78620 WP_003403112.1.78646 WP_003403112.1.78648 WP_003403112.1.78649 WP_003403112.1.78657 WP_003403112.1.78659 WP_003403112.1.7869 WP_003403112.1.78692 WP_003403112.1.78766 WP_003403112.1.78776 WP_003403112.1.78784 WP_003403112.1.78788 WP_003403112.1.78790 WP_003403112.1.78793 WP_003403112.1.78860 WP_003403112.1.7887 WP_003403112.1.78884 WP_003403112.1.78932 WP_003403112.1.78969 WP_003403112.1.78977 WP_003403112.1.78980 WP_003403112.1.79005 WP_003403112.1.79016 WP_003403112.1.79064 WP_003403112.1.79066 WP_003403112.1.79068 WP_003403112.1.79077 WP_003403112.1.79112 WP_003403112.1.79122 WP_003403112.1.79152 WP_003403112.1.79163 WP_003403112.1.79182 WP_003403112.1.79198 WP_003403112.1.79213 WP_003403112.1.79218 WP_003403112.1.79268 WP_003403112.1.79273 WP_003403112.1.79278 WP_003403112.1.79290 WP_003403112.1.79319 WP_003403112.1.79325 WP_003403112.1.79326 WP_003403112.1.79330 WP_003403112.1.79339 WP_003403112.1.79394 WP_003403112.1.79399 WP_003403112.1.79413 WP_003403112.1.79422 WP_003403112.1.79445 WP_003403112.1.79455 WP_003403112.1.79471 WP_003403112.1.79480 WP_003403112.1.79482 WP_003403112.1.79500 WP_003403112.1.79502 WP_003403112.1.79508 WP_003403112.1.79514 WP_003403112.1.79561 WP_003403112.1.79565 WP_003403112.1.79578 WP_003403112.1.79588 WP_003403112.1.79598 WP_003403112.1.79615 WP_003403112.1.79684 WP_003403112.1.79698 WP_003403112.1.797 WP_003403112.1.79744 WP_003403112.1.79784 WP_003403112.1.79802 WP_003403112.1.79806 WP_003403112.1.79826 WP_003403112.1.79828 WP_003403112.1.79863 WP_003403112.1.79881 WP_003403112.1.79885 WP_003403112.1.7990 WP_003403112.1.79900 WP_003403112.1.79918 WP_003403112.1.79947 WP_003403112.1.79948 WP_003403112.1.7995 WP_003403112.1.7997 WP_003403112.1.80004 WP_003403112.1.80015 WP_003403112.1.80022 WP_003403112.1.80030 WP_003403112.1.80054 WP_003403112.1.80084 WP_003403112.1.80099 WP_003403112.1.80129 WP_003403112.1.80177 WP_003403112.1.80234 WP_003403112.1.8026 WP_003403112.1.80275 WP_003403112.1.8029 WP_003403112.1.80299 WP_003403112.1.80300 WP_003403112.1.80304 WP_003403112.1.80326 WP_003403112.1.80351 WP_003403112.1.80370 WP_003403112.1.8044 WP_003403112.1.80451 WP_003403112.1.80458 WP_003403112.1.80490 WP_003403112.1.80503 WP_003403112.1.80507 WP_003403112.1.80552 WP_003403112.1.80576 WP_003403112.1.80588 WP_003403112.1.80599 WP_003403112.1.8060 WP_003403112.1.80624 WP_003403112.1.80636 WP_003403112.1.80669 WP_003403112.1.80711 WP_003403112.1.80714 WP_003403112.1.80743 WP_003403112.1.80784 WP_003403112.1.80853 WP_003403112.1.80918 WP_003403112.1.8093 WP_003403112.1.8097 WP_003403112.1.80988 WP_003403112.1.81007 WP_003403112.1.8105 WP_003403112.1.81059 WP_003403112.1.81063 WP_003403112.1.81066 WP_003403112.1.81075 WP_003403112.1.81091 WP_003403112.1.81119 WP_003403112.1.81125 WP_003403112.1.81136 WP_003403112.1.81189 WP_003403112.1.81192 WP_003403112.1.81249 WP_003403112.1.81250 WP_003403112.1.81264 WP_003403112.1.8128 WP_003403112.1.81287 WP_003403112.1.81297 WP_003403112.1.8138 WP_003403112.1.81407 WP_003403112.1.8143 WP_003403112.1.81439 WP_003403112.1.81505 WP_003403112.1.81529 WP_003403112.1.81538 WP_003403112.1.81541 WP_003403112.1.81560 WP_003403112.1.81567 WP_003403112.1.81583 WP_003403112.1.81686 WP_003403112.1.81712 WP_003403112.1.81720 WP_003403112.1.81731 WP_003403112.1.81774 WP_003403112.1.81809 WP_003403112.1.81820 WP_003403112.1.81850 WP_003403112.1.81883 WP_003403112.1.81891 WP_003403112.1.81911 WP_003403112.1.81918 WP_003403112.1.82011 WP_003403112.1.82069 WP_003403112.1.82071 WP_003403112.1.82108 WP_003403112.1.82142 WP_003403112.1.82158 WP_003403112.1.8217 WP_003403112.1.82210 WP_003403112.1.82228 WP_003403112.1.82236 WP_003403112.1.82251 WP_003403112.1.82271 WP_003403112.1.82305 WP_003403112.1.82307 WP_003403112.1.82309 WP_003403112.1.82317 WP_003403112.1.8232 WP_003403112.1.82346 WP_003403112.1.82374 WP_003403112.1.82385 WP_003403112.1.82429 WP_003403112.1.82460 WP_003403112.1.82462 WP_003403112.1.82494 WP_003403112.1.82531 WP_003403112.1.82546 WP_003403112.1.82547 WP_003403112.1.82549 WP_003403112.1.82577 WP_003403112.1.82592 WP_003403112.1.82597 WP_003403112.1.82598 WP_003403112.1.82625 WP_003403112.1.82642 WP_003403112.1.82651 WP_003403112.1.82653 WP_003403112.1.82681 WP_003403112.1.82685 WP_003403112.1.8271 WP_003403112.1.82712 WP_003403112.1.8273 WP_003403112.1.82743 WP_003403112.1.82757 WP_003403112.1.82774 WP_003403112.1.82803 WP_003403112.1.82836 WP_003403112.1.82892 WP_003403112.1.82957 WP_003403112.1.82973 WP_003403112.1.82981 WP_003403112.1.82983 WP_003403112.1.83004 WP_003403112.1.83009 WP_003403112.1.83044 WP_003403112.1.83074 WP_003403112.1.83110 WP_003403112.1.83146 WP_003403112.1.83159 WP_003403112.1.8317 WP_003403112.1.83173 WP_003403112.1.83181 WP_003403112.1.83182 WP_003403112.1.83191 WP_003403112.1.83197 WP_003403112.1.83212 WP_003403112.1.8326 WP_003403112.1.83262 WP_003403112.1.83273 WP_003403112.1.83309 WP_003403112.1.83332 WP_003403112.1.83341 WP_003403112.1.83349 WP_003403112.1.8335 WP_003403112.1.83353 WP_003403112.1.83367 WP_003403112.1.83381 WP_003403112.1.83389 WP_003403112.1.83408 WP_003403112.1.83409 WP_003403112.1.83470 WP_003403112.1.83524 WP_003403112.1.83526 WP_003403112.1.8358 WP_003403112.1.83589 WP_003403112.1.83638 WP_003403112.1.83648 WP_003403112.1.83667 WP_003403112.1.83692 WP_003403112.1.83705 WP_003403112.1.83766 WP_003403112.1.83793 WP_003403112.1.83802 WP_003403112.1.83805 WP_003403112.1.83839 WP_003403112.1.83842 WP_003403112.1.83850 WP_003403112.1.83861 WP_003403112.1.83920 WP_003403112.1.83929 WP_003403112.1.83930 WP_003403112.1.83975 WP_003403112.1.83991 WP_003403112.1.8400 WP_003403112.1.84027 WP_003403112.1.8404 WP_003403112.1.84057 WP_003403112.1.84070 WP_003403112.1.84112 WP_003403112.1.84146 WP_003403112.1.84176 WP_003403112.1.84186 WP_003403112.1.8424 WP_003403112.1.84244 WP_003403112.1.84259 WP_003403112.1.8426 WP_003403112.1.84277 WP_003403112.1.84287 WP_003403112.1.84388 WP_003403112.1.84408 WP_003403112.1.84409 WP_003403112.1.84438 WP_003403112.1.84460 WP_003403112.1.84488 WP_003403112.1.84504 WP_003403112.1.84620 WP_003403112.1.84623 WP_003403112.1.84641 WP_003403112.1.84655 WP_003403112.1.84666 WP_003403112.1.84739 WP_003403112.1.84748 WP_003403112.1.84766 WP_003403112.1.84772 WP_003403112.1.84774 WP_003403112.1.848 WP_003403112.1.84812 WP_003403112.1.84836 WP_003403112.1.84839 WP_003403112.1.84846 WP_003403112.1.84873 WP_003403112.1.84938 WP_003403112.1.84968 WP_003403112.1.84981 WP_003403112.1.84985 WP_003403112.1.8503 WP_003403112.1.85038 WP_003403112.1.85041 WP_003403112.1.85043 WP_003403112.1.8505 WP_003403112.1.85074 WP_003403112.1.8509 WP_003403112.1.8512 WP_003403112.1.85148 WP_003403112.1.8518 WP_003403112.1.8522 WP_003403112.1.85242 WP_003403112.1.85276 WP_003403112.1.85284 WP_003403112.1.85314 WP_003403112.1.85319 WP_003403112.1.85330 WP_003403112.1.85341 WP_003403112.1.85346 WP_003403112.1.8535 WP_003403112.1.85363 WP_003403112.1.85377 WP_003403112.1.85387 WP_003403112.1.85399 WP_003403112.1.85458 WP_003403112.1.8546 WP_003403112.1.85464 WP_003403112.1.85478 WP_003403112.1.85480 WP_003403112.1.85488 WP_003403112.1.85495 WP_003403112.1.85551 WP_003403112.1.85577 WP_003403112.1.85597 WP_003403112.1.85599 WP_003403112.1.85610 WP_003403112.1.85648 WP_003403112.1.85679 WP_003403112.1.85704 WP_003403112.1.85727 WP_003403112.1.85737 WP_003403112.1.85808 WP_003403112.1.85819 WP_003403112.1.85820 WP_003403112.1.85823 WP_003403112.1.85832 WP_003403112.1.8586 WP_003403112.1.85872 WP_003403112.1.85894 WP_003403112.1.85913 WP_003403112.1.85953 WP_003403112.1.85986 WP_003403112.1.86024 WP_003403112.1.86025 WP_003403112.1.86032 WP_003403112.1.86048 WP_003403112.1.86052 WP_003403112.1.86103 WP_003403112.1.86122 WP_003403112.1.86124 WP_003403112.1.86164 WP_003403112.1.86168 WP_003403112.1.86204 WP_003403112.1.86208 WP_003403112.1.86235 WP_003403112.1.86249 WP_003403112.1.86260 WP_003403112.1.86290 WP_003403112.1.863 WP_003403112.1.86327 WP_003403112.1.86334 WP_003403112.1.86368 WP_003403112.1.86377 WP_003403112.1.86425 WP_003403112.1.86459 WP_003403112.1.8649 WP_003403112.1.86499 WP_003403112.1.86520 WP_003403112.1.86561 WP_003403112.1.86568 WP_003403112.1.86575 WP_003403112.1.86584 WP_003403112.1.86605 WP_003403112.1.86626 WP_003403112.1.86648 WP_003403112.1.8666 WP_003403112.1.86684 WP_003403112.1.86696 WP_003403112.1.86705 WP_003403112.1.86718 WP_003403112.1.86725 WP_003403112.1.86757 WP_003403112.1.86766 WP_003403112.1.86801 WP_003403112.1.86814 WP_003403112.1.86820 WP_003403112.1.86825 WP_003403112.1.8685 WP_003403112.1.86851 WP_003403112.1.86855 WP_003403112.1.86867 WP_003403112.1.86877 WP_003403112.1.86883 WP_003403112.1.8689 WP_003403112.1.86892 WP_003403112.1.86933 WP_003403112.1.86941 WP_003403112.1.86950 WP_003403112.1.86962 WP_003403112.1.86963 WP_003403112.1.86979 WP_003403112.1.8700 WP_003403112.1.87001 WP_003403112.1.87002 WP_003403112.1.87031 WP_003403112.1.87116 WP_003403112.1.87117 WP_003403112.1.8714 WP_003403112.1.87162 WP_003403112.1.87209 WP_003403112.1.87240 WP_003403112.1.87266 WP_003403112.1.87273 WP_003403112.1.87275 WP_003403112.1.8733 WP_003403112.1.87345 WP_003403112.1.87369 WP_003403112.1.87401 WP_003403112.1.87404 WP_003403112.1.87406 WP_003403112.1.87409 WP_003403112.1.87446 WP_003403112.1.87459 WP_003403112.1.87472 WP_003403112.1.87489 WP_003403112.1.87494 WP_003403112.1.87588 WP_003403112.1.87617 WP_003403112.1.87619 WP_003403112.1.87634 WP_003403112.1.87643 WP_003403112.1.8765 WP_003403112.1.87650 WP_003403112.1.87658 WP_003403112.1.87665 WP_003403112.1.87676 WP_003403112.1.87677 WP_003403112.1.87684 WP_003403112.1.87692 WP_003403112.1.87707 WP_003403112.1.87732 WP_003403112.1.87784 WP_003403112.1.87796 WP_003403112.1.87809 WP_003403112.1.87817 WP_003403112.1.87827 WP_003403112.1.87831 WP_003403112.1.87835 WP_003403112.1.87866 WP_003403112.1.8789 WP_003403112.1.87911 WP_003403112.1.87924 WP_003403112.1.87955 WP_003403112.1.87956 WP_003403112.1.87991 WP_003403112.1.88 WP_003403112.1.88002 WP_003403112.1.88039 WP_003403112.1.88072 WP_003403112.1.88077 WP_003403112.1.88180 WP_003403112.1.88205 WP_003403112.1.88217 WP_003403112.1.88219 WP_003403112.1.88245 WP_003403112.1.88253 WP_003403112.1.88294 WP_003403112.1.88315 WP_003403112.1.88316 WP_003403112.1.88320 WP_003403112.1.88338 WP_003403112.1.8840 WP_003403112.1.88437 WP_003403112.1.88453 WP_003403112.1.88469 WP_003403112.1.88489 WP_003403112.1.88507 WP_003403112.1.88521 WP_003403112.1.88530 WP_003403112.1.88537 WP_003403112.1.88541 WP_003403112.1.88592 WP_003403112.1.88616 WP_003403112.1.88618 WP_003403112.1.8862 WP_003403112.1.88625 WP_003403112.1.88632 WP_003403112.1.88634 WP_003403112.1.88649 WP_003403112.1.8870 WP_003403112.1.88737 WP_003403112.1.888 WP_003403112.1.88824 WP_003403112.1.88886 WP_003403112.1.88965 WP_003403112.1.88985 WP_003403112.1.8902 WP_003403112.1.89025 WP_003403112.1.89041 WP_003403112.1.89046 WP_003403112.1.89082 WP_003403112.1.89162 WP_003403112.1.89168 WP_003403112.1.8917 WP_003403112.1.89193 WP_003403112.1.89205 WP_003403112.1.89225 WP_003403112.1.8925 WP_003403112.1.89277 WP_003403112.1.89286 WP_003403112.1.89293 WP_003403112.1.89320 WP_003403112.1.8935 WP_003403112.1.89371 WP_003403112.1.89378 WP_003403112.1.89392 WP_003403112.1.89451 WP_003403112.1.89453 WP_003403112.1.89473 WP_003403112.1.89483 WP_003403112.1.895 WP_003403112.1.89513 WP_003403112.1.89517 WP_003403112.1.89522 WP_003403112.1.8954 WP_003403112.1.89567 WP_003403112.1.8957 WP_003403112.1.89572 WP_003403112.1.89589 WP_003403112.1.89607 WP_003403112.1.89613 WP_003403112.1.89625 WP_003403112.1.89648 WP_003403112.1.89670 WP_003403112.1.89676 WP_003403112.1.89739 WP_003403112.1.89762 WP_003403112.1.8982 WP_003403112.1.89829 WP_003403112.1.89831 WP_003403112.1.89844 WP_003403112.1.89849 WP_003403112.1.8989 WP_003403112.1.89901 WP_003403112.1.89903 WP_003403112.1.8992 WP_003403112.1.89922 WP_003403112.1.89926 WP_003403112.1.89963 WP_003403112.1.8998 WP_003403112.1.900 WP_003403112.1.90048 WP_003403112.1.9007 WP_003403112.1.90080 WP_003403112.1.90130 WP_003403112.1.90137 WP_003403112.1.90157 WP_003403112.1.90184 WP_003403112.1.90199 WP_003403112.1.90231 WP_003403112.1.90245 WP_003403112.1.90308 WP_003403112.1.90322 WP_003403112.1.90328 WP_003403112.1.90372 WP_003403112.1.90439 WP_003403112.1.90481 WP_003403112.1.90499 WP_003403112.1.9050 WP_003403112.1.90527 WP_003403112.1.90550 WP_003403112.1.90560 WP_003403112.1.90612 WP_003403112.1.90672 WP_003403112.1.90687 WP_003403112.1.90691 WP_003403112.1.90711 WP_003403112.1.90722 WP_003403112.1.90744 WP_003403112.1.90756 WP_003403112.1.90767 WP_003403112.1.90771 WP_003403112.1.90785 WP_003403112.1.90788 WP_003403112.1.90800 WP_003403112.1.90810 WP_003403112.1.90816 WP_003403112.1.90819 WP_003403112.1.9082 WP_003403112.1.90884 WP_003403112.1.90899 WP_003403112.1.90906 WP_003403112.1.90958 WP_003403112.1.90976 WP_003403112.1.90977 WP_003403112.1.90987 WP_003403112.1.9102 WP_003403112.1.91043 WP_003403112.1.91053 WP_003403112.1.91082 WP_003403112.1.91106 WP_003403112.1.91112 WP_003403112.1.91144 WP_003403112.1.91167 WP_003403112.1.91169 WP_003403112.1.91192 WP_003403112.1.91201 WP_003403112.1.91207 WP_003403112.1.91208 WP_003403112.1.91211 WP_003403112.1.91214 WP_003403112.1.91244 WP_003403112.1.91251 WP_003403112.1.91260 WP_003403112.1.91284 WP_003403112.1.91294 WP_003403112.1.91303 WP_003403112.1.91322 WP_003403112.1.91352 WP_003403112.1.91386 WP_003403112.1.9139 WP_003403112.1.91398 WP_003403112.1.91430 WP_003403112.1.91436 WP_003403112.1.91496 WP_003403112.1.91576 WP_003403112.1.91589 WP_003403112.1.91694 WP_003403112.1.91713 WP_003403112.1.91716 WP_003403112.1.91717 WP_003403112.1.91728 WP_003403112.1.91743 WP_003403112.1.91759 WP_003403112.1.91784 WP_003403112.1.91802 WP_003403112.1.91822 WP_003403112.1.91828 WP_003403112.1.9189 WP_003403112.1.91896 WP_003403112.1.9190 WP_003403112.1.91915 WP_003403112.1.91937 WP_003403112.1.91944 WP_003403112.1.91953 WP_003403112.1.91957 WP_003403112.1.91978 WP_003403112.1.92021 WP_003403112.1.92083 WP_003403112.1.92127 WP_003403112.1.92144 WP_003403112.1.92150 WP_003403112.1.92153 WP_003403112.1.92190 WP_003403112.1.92192 WP_003403112.1.92221 WP_003403112.1.92222 WP_003403112.1.92294 WP_003403112.1.92300 WP_003403112.1.92317 WP_003403112.1.92338 WP_003403112.1.92345 WP_003403112.1.92364 WP_003403112.1.92380 WP_003403112.1.92416 WP_003403112.1.92428 WP_003403112.1.92447 WP_003403112.1.92456 WP_003403112.1.92467 WP_003403112.1.92471 WP_003403112.1.92490 WP_003403112.1.92508 WP_003403112.1.9251 WP_003403112.1.92523 WP_003403112.1.92536 WP_003403112.1.92592 WP_003403112.1.92597 WP_003403112.1.92606 WP_003403112.1.92610 WP_003403112.1.92613 WP_003403112.1.9263 WP_003403112.1.9265 WP_003403112.1.92650 WP_003403112.1.92660 WP_003403112.1.92677 WP_003403112.1.92685 WP_003403112.1.92689 WP_003403112.1.92690 WP_003403112.1.92706 WP_003403112.1.92714 WP_003403112.1.92736 WP_003403112.1.9274 WP_003403112.1.92752 WP_003403112.1.92760 WP_003403112.1.92777 WP_003403112.1.92803 WP_003403112.1.92833 WP_003403112.1.92856 WP_003403112.1.92881 WP_003403112.1.92892 WP_003403112.1.92907 WP_003403112.1.92908 WP_003403112.1.9291 WP_003403112.1.92917 WP_003403112.1.92996 WP_003403112.1.93006 WP_003403112.1.93015 WP_003403112.1.93043 WP_003403112.1.93083 WP_003403112.1.93097 WP_003403112.1.93137 WP_003403112.1.93192 WP_003403112.1.93203 WP_003403112.1.93212 WP_003403112.1.93234 WP_003403112.1.93245 WP_003403112.1.93257 WP_003403112.1.93265 WP_003403112.1.93297 WP_003403112.1.93328 WP_003403112.1.93337 WP_003403112.1.93343 WP_003403112.1.93349 WP_003403112.1.93377 WP_003403112.1.9338 WP_003403112.1.93407 WP_003403112.1.93417 WP_003403112.1.93419 WP_003403112.1.93426 WP_003403112.1.9344 WP_003403112.1.93443 WP_003403112.1.93447 WP_003403112.1.93483 WP_003403112.1.93495 WP_003403112.1.93499 WP_003403112.1.93516 WP_003403112.1.93536 WP_003403112.1.93544 WP_003403112.1.93555 WP_003403112.1.93560 WP_003403112.1.93564 WP_003403112.1.9357 WP_003403112.1.93588 WP_003403112.1.9363 WP_003403112.1.93645 WP_003403112.1.93649 WP_003403112.1.93659 WP_003403112.1.93677 WP_003403112.1.9368 WP_003403112.1.93689 WP_003403112.1.93693 WP_003403112.1.93698 WP_003403112.1.93706 WP_003403112.1.9371 WP_003403112.1.93823 WP_003403112.1.9388 WP_003403112.1.93894 WP_003403112.1.93903 WP_003403112.1.93907 WP_003403112.1.93913 WP_003403112.1.93950 WP_003403112.1.93954 WP_003403112.1.93988 WP_003403112.1.9407 WP_003403112.1.94143 WP_003403112.1.94154 WP_003403112.1.94184 WP_003403112.1.94204 WP_003403112.1.94205 WP_003403112.1.94226 WP_003403112.1.94231 WP_003403112.1.94256 WP_003403112.1.94261 WP_003403112.1.94281 WP_003403112.1.94292 WP_003403112.1.94297 WP_003403112.1.94326 WP_003403112.1.94339 WP_003403112.1.94392 WP_003403112.1.94416 WP_003403112.1.94421 WP_003403112.1.94456 WP_003403112.1.94470 WP_003403112.1.94480 WP_003403112.1.94495 WP_003403112.1.94511 WP_003403112.1.94525 WP_003403112.1.94564 WP_003403112.1.94602 WP_003403112.1.9465 WP_003403112.1.94673 WP_003403112.1.94714 WP_003403112.1.94776 WP_003403112.1.94872 WP_003403112.1.94902 WP_003403112.1.94916 WP_003403112.1.94979 WP_003403112.1.94994 WP_003403112.1.94996 WP_003403112.1.94998 WP_003403112.1.95007 WP_003403112.1.95010 WP_003403112.1.95015 WP_003403112.1.95034 WP_003403112.1.95068 WP_003403112.1.95081 WP_003403112.1.95112 WP_003403112.1.9514 WP_003403112.1.95179 WP_003403112.1.95188 WP_003403112.1.95190 WP_003403112.1.95245 WP_003403112.1.95279 WP_003403112.1.9531 WP_003403112.1.95335 WP_003403112.1.95370 WP_003403112.1.95392 WP_003403112.1.95416 WP_003403112.1.95417 WP_003403112.1.95454 WP_003403112.1.95455 WP_003403112.1.95508 WP_003403112.1.95556 WP_003403112.1.95557 WP_003403112.1.95565 WP_003403112.1.95578 WP_003403112.1.95580 WP_003403112.1.95585 WP_003403112.1.95679 WP_003403112.1.95685 WP_003403112.1.95724 WP_003403112.1.95727 WP_003403112.1.95730 WP_003403112.1.95758 WP_003403112.1.95797 WP_003403112.1.95839 WP_003403112.1.9585 WP_003403112.1.9590 WP_003403112.1.95902 WP_003403112.1.95924 WP_003403112.1.95926 WP_003403112.1.95953 WP_003403112.1.95964 WP_003403112.1.95973 WP_003403112.1.96006 WP_003403112.1.96036 WP_003403112.1.96062 WP_003403112.1.96065 WP_003403112.1.96098 WP_003403112.1.96166 WP_003403112.1.96171 WP_003403112.1.96182 WP_003403112.1.96235 WP_003403112.1.96242 WP_003403112.1.96254 WP_003403112.1.96259 WP_003403112.1.96313 WP_003403112.1.96318 WP_003403112.1.96345 WP_003403112.1.96373 WP_003403112.1.96456 WP_003403112.1.96486 WP_003403112.1.96569 WP_003403112.1.96573 WP_003403112.1.96575 WP_003403112.1.96611 WP_003403112.1.96621 WP_003403112.1.9667 WP_003403112.1.96681 WP_003403112.1.96726 WP_003403112.1.96733 WP_003403112.1.96742 WP_003403112.1.96754 WP_003403112.1.9678 WP_003403112.1.96832 WP_003403112.1.9685 WP_003403112.1.97008 WP_003403112.1.97056 WP_003403112.1.97087 WP_003403112.1.97094 WP_003403112.1.97096 WP_003403112.1.97099 WP_003403112.1.97108 WP_003403112.1.97127 WP_003403112.1.97129 WP_003403112.1.97136 WP_003403112.1.9716 WP_003403112.1.97176 WP_003403112.1.97222 WP_003403112.1.97223 WP_003403112.1.97237 WP_003403112.1.97242 WP_003403112.1.97270 WP_003403112.1.97283 WP_003403112.1.97296 WP_003403112.1.97321 WP_003403112.1.97325 WP_003403112.1.97366 WP_003403112.1.97376 WP_003403112.1.97380 WP_003403112.1.9739 WP_003403112.1.97462 WP_003403112.1.97517 WP_003403112.1.97519 WP_003403112.1.97535 WP_003403112.1.97540 WP_003403112.1.97546 WP_003403112.1.97550 WP_003403112.1.97577 WP_003403112.1.97584 WP_003403112.1.9759 WP_003403112.1.97591 WP_003403112.1.97618 WP_003403112.1.9763 WP_003403112.1.97669 WP_003403112.1.97673 WP_003403112.1.97700 WP_003403112.1.9773 WP_003403112.1.97730 WP_003403112.1.97751 WP_003403112.1.97754 WP_003403112.1.97797 WP_003403112.1.9782 WP_003403112.1.97888 WP_003403112.1.97951 WP_003403112.1.97958 WP_003403112.1.97966 WP_003403112.1.97979 WP_003403112.1.97995 WP_003403112.1.98034 WP_003403112.1.98052 WP_003403112.1.98071 WP_003403112.1.98072 WP_003403112.1.98113 WP_003403112.1.98114 WP_003403112.1.98128 WP_003403112.1.98181 WP_003403112.1.98188 WP_003403112.1.98189 WP_003403112.1.98213 WP_003403112.1.98225 WP_003403112.1.98291 WP_003403112.1.98335 WP_003403112.1.98350 WP_003403112.1.98395 WP_003403112.1.98441 WP_003403112.1.98443 WP_003403112.1.98462 WP_003403112.1.9848 WP_003403112.1.98482 WP_003403112.1.98486 WP_003403112.1.98488 WP_003403112.1.98503 WP_003403112.1.98516 WP_003403112.1.98541 WP_003403112.1.98576 WP_003403112.1.98590 WP_003403112.1.98594 WP_003403112.1.98599 WP_003403112.1.98629 WP_003403112.1.98645 WP_003403112.1.98646 WP_003403112.1.98649 WP_003403112.1.98656 WP_003403112.1.9867 WP_003403112.1.98674 WP_003403112.1.98697 WP_003403112.1.98701 WP_003403112.1.98739 WP_003403112.1.98749 WP_003403112.1.98765 WP_003403112.1.98770 WP_003403112.1.98777 WP_003403112.1.98778 WP_003403112.1.98802 WP_003403112.1.98838 WP_003403112.1.98850 WP_003403112.1.98906 WP_003403112.1.98935 WP_003403112.1.98948 WP_003403112.1.98953 WP_003403112.1.99000 WP_003403112.1.99023 WP_003403112.1.99030 WP_003403112.1.99055 WP_003403112.1.99062 WP_003403112.1.99086 WP_003403112.1.99115 WP_003403112.1.99117 WP_003403112.1.99161 WP_003403112.1.99205 WP_003403112.1.99211 WP_003403112.1.99216 WP_003403112.1.99222 WP_003403112.1.99251 WP_003403112.1.99312 WP_003403112.1.99315 WP_003403112.1.99316 WP_003403112.1.99322 WP_003403112.1.99365 WP_003403112.1.99368 WP_003403112.1.99379 WP_003403112.1.99396 WP_003403112.1.99404 WP_003403112.1.99419 WP_003403112.1.99438 WP_003403112.1.99460 WP_003403112.1.99468 WP_003403112.1.99473 WP_003403112.1.99513 WP_003403112.1.99529 WP_003403112.1.99548 WP_003403112.1.99572 WP_003403112.1.99578 WP_003403112.1.99605 WP_003403112.1.99609 WP_003403112.1.99617 WP_003403112.1.99635 WP_003403112.1.99650 WP_003403112.1.99701 WP_003403112.1.99716 WP_003403112.1.99740 WP_003403112.1.99745 WP_003403112.1.99749 WP_003403112.1.9976 WP_003403112.1.99817 WP_003403112.1.99832 WP_003403112.1.99886 WP_003403112.1.99897 WP_003403112.1.99899 WP_003403112.1.9993 WP_003403112.1.99982 WP_003403112.1.99991 336982.TBFG_10604 419947.MRA_0600 478434.TBMG_00600 83331.MT0622 83332.Rv0592 gi|506925004|ref|YP_008005454.1| gi|479313461|ref|YP_007853513.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]