SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I6WYY7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I6WYY7
Domain Number 1 Region: 6-132
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 3.92e-25
Family MaoC-like 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I6WYY7
Sequence length 142
Comment (tr|I6WYY7|I6WYY7_MYCTU) (3R)-hydroxyacyl-ACP dehydratase subunit HadB {ECO:0000313|EMBL:CCP43379.1} KW=Complete proteome; Reference proteome OX=83332 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv). GN=Rv0636 OC=Mycobacterium; Mycobacterium tuberculosis complex.
Sequence
MALREFSSVKVGDQLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVVGLDTAIAHGM
LTMGIGGGYVTSWVGDPGAVTEYNVRFTAVVPVPNDGKGAELVFNGRVKSVDPESKSVTI
ALTATTGGKKIFGRAIASAKLA
Download sequence
Identical sequences A0A045H5L3 A0A0H3LCS9 A0A109SKV7 A0A109SU79 A0A197ITU5 A0A1S1BH27 A0A1X1Z1M0 A5U021 F8M2L9 G0TQB6 I6WYY7 L0T618 P96927 R4M373 R4M381
gi|340625655|ref|YP_004744107.1| gi|433625727|ref|YP_007259356.1| gi|494691277|ref|YP_007956820.1| gi|15607776|ref|NP_215150.1| gi|385990120|ref|YP_005908418.1| gi|494699018|ref|YP_007964500.1| gi|433633673|ref|YP_007267300.1| gi|392431063|ref|YP_006472107.1| gi|148821840|ref|YP_001286594.1| 336982.TBFG_10649 419947.MRA_0647 83331.MT0665 83332.Rv0636 NP_215150.1.84033 WP_003903106.1.100000 WP_003903106.1.100021 WP_003903106.1.100069 WP_003903106.1.100087 WP_003903106.1.10015 WP_003903106.1.100208 WP_003903106.1.100216 WP_003903106.1.10022 WP_003903106.1.100255 WP_003903106.1.100260 WP_003903106.1.100270 WP_003903106.1.100279 WP_003903106.1.100286 WP_003903106.1.100308 WP_003903106.1.100309 WP_003903106.1.100318 WP_003903106.1.100337 WP_003903106.1.100338 WP_003903106.1.10037 WP_003903106.1.100383 WP_003903106.1.100395 WP_003903106.1.100396 WP_003903106.1.1004 WP_003903106.1.100401 WP_003903106.1.100459 WP_003903106.1.100460 WP_003903106.1.100552 WP_003903106.1.100581 WP_003903106.1.100600 WP_003903106.1.100625 WP_003903106.1.10064 WP_003903106.1.100666 WP_003903106.1.100671 WP_003903106.1.100677 WP_003903106.1.100682 WP_003903106.1.100697 WP_003903106.1.100703 WP_003903106.1.100716 WP_003903106.1.100722 WP_003903106.1.100754 WP_003903106.1.100757 WP_003903106.1.100772 WP_003903106.1.1008 WP_003903106.1.100812 WP_003903106.1.100845 WP_003903106.1.100866 WP_003903106.1.10088 WP_003903106.1.100889 WP_003903106.1.10090 WP_003903106.1.100910 WP_003903106.1.100915 WP_003903106.1.100918 WP_003903106.1.100935 WP_003903106.1.100984 WP_003903106.1.100992 WP_003903106.1.100998 WP_003903106.1.101 WP_003903106.1.101025 WP_003903106.1.101028 WP_003903106.1.10104 WP_003903106.1.101048 WP_003903106.1.101054 WP_003903106.1.101075 WP_003903106.1.101143 WP_003903106.1.10116 WP_003903106.1.10117 WP_003903106.1.101209 WP_003903106.1.10125 WP_003903106.1.101290 WP_003903106.1.101323 WP_003903106.1.101324 WP_003903106.1.101350 WP_003903106.1.101367 WP_003903106.1.101398 WP_003903106.1.101403 WP_003903106.1.10144 WP_003903106.1.101442 WP_003903106.1.10145 WP_003903106.1.101452 WP_003903106.1.101456 WP_003903106.1.101481 WP_003903106.1.101493 WP_003903106.1.101496 WP_003903106.1.101525 WP_003903106.1.101533 WP_003903106.1.101535 WP_003903106.1.101553 WP_003903106.1.101558 WP_003903106.1.10156 WP_003903106.1.101573 WP_003903106.1.101576 WP_003903106.1.10159 WP_003903106.1.101592 WP_003903106.1.101604 WP_003903106.1.101607 WP_003903106.1.101622 WP_003903106.1.101644 WP_003903106.1.101671 WP_003903106.1.101687 WP_003903106.1.101698 WP_003903106.1.10170 WP_003903106.1.101713 WP_003903106.1.101722 WP_003903106.1.101733 WP_003903106.1.101743 WP_003903106.1.101753 WP_003903106.1.101754 WP_003903106.1.101764 WP_003903106.1.101773 WP_003903106.1.101795 WP_003903106.1.101797 WP_003903106.1.101798 WP_003903106.1.101802 WP_003903106.1.101826 WP_003903106.1.101836 WP_003903106.1.101858 WP_003903106.1.101859 WP_003903106.1.101862 WP_003903106.1.101888 WP_003903106.1.101894 WP_003903106.1.101899 WP_003903106.1.1019 WP_003903106.1.101923 WP_003903106.1.101925 WP_003903106.1.10193 WP_003903106.1.102 WP_003903106.1.102008 WP_003903106.1.102017 WP_003903106.1.102053 WP_003903106.1.102055 WP_003903106.1.102063 WP_003903106.1.102099 WP_003903106.1.1021 WP_003903106.1.10211 WP_003903106.1.102119 WP_003903106.1.102121 WP_003903106.1.102143 WP_003903106.1.10216 WP_003903106.1.10224 WP_003903106.1.10253 WP_003903106.1.10262 WP_003903106.1.10272 WP_003903106.1.10277 WP_003903106.1.1033 WP_003903106.1.10350 WP_003903106.1.10362 WP_003903106.1.10366 WP_003903106.1.10376 WP_003903106.1.10396 WP_003903106.1.10410 WP_003903106.1.10414 WP_003903106.1.10421 WP_003903106.1.10430 WP_003903106.1.1044 WP_003903106.1.10440 WP_003903106.1.10445 WP_003903106.1.10471 WP_003903106.1.10472 WP_003903106.1.10489 WP_003903106.1.105 WP_003903106.1.10518 WP_003903106.1.10523 WP_003903106.1.10545 WP_003903106.1.1057 WP_003903106.1.10594 WP_003903106.1.10603 WP_003903106.1.10606 WP_003903106.1.10615 WP_003903106.1.10623 WP_003903106.1.10635 WP_003903106.1.10643 WP_003903106.1.10648 WP_003903106.1.10662 WP_003903106.1.10709 WP_003903106.1.10735 WP_003903106.1.10740 WP_003903106.1.10756 WP_003903106.1.1078 WP_003903106.1.10791 WP_003903106.1.10799 WP_003903106.1.10825 WP_003903106.1.10848 WP_003903106.1.10863 WP_003903106.1.10879 WP_003903106.1.10912 WP_003903106.1.10916 WP_003903106.1.10923 WP_003903106.1.10927 WP_003903106.1.1095 WP_003903106.1.10956 WP_003903106.1.10958 WP_003903106.1.10962 WP_003903106.1.10980 WP_003903106.1.10981 WP_003903106.1.10993 WP_003903106.1.1100 WP_003903106.1.11040 WP_003903106.1.11061 WP_003903106.1.11070 WP_003903106.1.11141 WP_003903106.1.11171 WP_003903106.1.11175 WP_003903106.1.11176 WP_003903106.1.11222 WP_003903106.1.11236 WP_003903106.1.11329 WP_003903106.1.1133 WP_003903106.1.11342 WP_003903106.1.11373 WP_003903106.1.11376 WP_003903106.1.11390 WP_003903106.1.11402 WP_003903106.1.11481 WP_003903106.1.11487 WP_003903106.1.11489 WP_003903106.1.11491 WP_003903106.1.11514 WP_003903106.1.11589 WP_003903106.1.11596 WP_003903106.1.11604 WP_003903106.1.11610 WP_003903106.1.11697 WP_003903106.1.11707 WP_003903106.1.11752 WP_003903106.1.11758 WP_003903106.1.11761 WP_003903106.1.11775 WP_003903106.1.11804 WP_003903106.1.11822 WP_003903106.1.11826 WP_003903106.1.11856 WP_003903106.1.11898 WP_003903106.1.11906 WP_003903106.1.11939 WP_003903106.1.11960 WP_003903106.1.11961 WP_003903106.1.11972 WP_003903106.1.11984 WP_003903106.1.120 WP_003903106.1.12001 WP_003903106.1.12049 WP_003903106.1.12052 WP_003903106.1.12100 WP_003903106.1.12116 WP_003903106.1.12130 WP_003903106.1.12133 WP_003903106.1.12161 WP_003903106.1.12165 WP_003903106.1.12184 WP_003903106.1.12190 WP_003903106.1.12216 WP_003903106.1.12265 WP_003903106.1.12275 WP_003903106.1.12293 WP_003903106.1.12294 WP_003903106.1.123 WP_003903106.1.1231 WP_003903106.1.12314 WP_003903106.1.12327 WP_003903106.1.12338 WP_003903106.1.1236 WP_003903106.1.12371 WP_003903106.1.12372 WP_003903106.1.12389 WP_003903106.1.12406 WP_003903106.1.1241 WP_003903106.1.12421 WP_003903106.1.12424 WP_003903106.1.12446 WP_003903106.1.12464 WP_003903106.1.12479 WP_003903106.1.12519 WP_003903106.1.12523 WP_003903106.1.12526 WP_003903106.1.1255 WP_003903106.1.12550 WP_003903106.1.12551 WP_003903106.1.12563 WP_003903106.1.12611 WP_003903106.1.12669 WP_003903106.1.1267 WP_003903106.1.12672 WP_003903106.1.12692 WP_003903106.1.1271 WP_003903106.1.12768 WP_003903106.1.1279 WP_003903106.1.12794 WP_003903106.1.12804 WP_003903106.1.12821 WP_003903106.1.12841 WP_003903106.1.12854 WP_003903106.1.12871 WP_003903106.1.12901 WP_003903106.1.12941 WP_003903106.1.12947 WP_003903106.1.12957 WP_003903106.1.12972 WP_003903106.1.13028 WP_003903106.1.13043 WP_003903106.1.13086 WP_003903106.1.13087 WP_003903106.1.13090 WP_003903106.1.13096 WP_003903106.1.13163 WP_003903106.1.13175 WP_003903106.1.13183 WP_003903106.1.132 WP_003903106.1.13249 WP_003903106.1.13282 WP_003903106.1.13284 WP_003903106.1.13296 WP_003903106.1.13298 WP_003903106.1.13302 WP_003903106.1.13306 WP_003903106.1.13312 WP_003903106.1.13313 WP_003903106.1.13321 WP_003903106.1.13345 WP_003903106.1.13358 WP_003903106.1.13370 WP_003903106.1.13375 WP_003903106.1.1338 WP_003903106.1.13420 WP_003903106.1.13433 WP_003903106.1.13435 WP_003903106.1.13438 WP_003903106.1.13461 WP_003903106.1.13466 WP_003903106.1.13489 WP_003903106.1.13526 WP_003903106.1.13551 WP_003903106.1.13561 WP_003903106.1.13564 WP_003903106.1.13579 WP_003903106.1.13647 WP_003903106.1.13667 WP_003903106.1.13687 WP_003903106.1.13697 WP_003903106.1.13719 WP_003903106.1.13763 WP_003903106.1.1377 WP_003903106.1.13774 WP_003903106.1.13786 WP_003903106.1.13793 WP_003903106.1.13794 WP_003903106.1.13817 WP_003903106.1.13834 WP_003903106.1.13866 WP_003903106.1.13880 WP_003903106.1.13899 WP_003903106.1.13909 WP_003903106.1.13910 WP_003903106.1.13919 WP_003903106.1.13920 WP_003903106.1.13952 WP_003903106.1.13953 WP_003903106.1.13962 WP_003903106.1.1398 WP_003903106.1.13988 WP_003903106.1.14027 WP_003903106.1.14046 WP_003903106.1.14115 WP_003903106.1.1415 WP_003903106.1.14152 WP_003903106.1.14158 WP_003903106.1.14162 WP_003903106.1.14175 WP_003903106.1.14178 WP_003903106.1.14194 WP_003903106.1.14195 WP_003903106.1.14208 WP_003903106.1.14238 WP_003903106.1.14266 WP_003903106.1.14273 WP_003903106.1.14303 WP_003903106.1.14306 WP_003903106.1.14307 WP_003903106.1.14310 WP_003903106.1.14382 WP_003903106.1.14416 WP_003903106.1.14428 WP_003903106.1.14441 WP_003903106.1.14469 WP_003903106.1.14477 WP_003903106.1.14504 WP_003903106.1.14514 WP_003903106.1.1452 WP_003903106.1.14527 WP_003903106.1.1454 WP_003903106.1.14544 WP_003903106.1.14548 WP_003903106.1.14551 WP_003903106.1.14561 WP_003903106.1.14573 WP_003903106.1.1462 WP_003903106.1.14667 WP_003903106.1.14668 WP_003903106.1.14675 WP_003903106.1.14694 WP_003903106.1.14695 WP_003903106.1.14709 WP_003903106.1.14766 WP_003903106.1.14783 WP_003903106.1.14865 WP_003903106.1.14872 WP_003903106.1.14905 WP_003903106.1.14926 WP_003903106.1.14951 WP_003903106.1.14955 WP_003903106.1.15003 WP_003903106.1.15009 WP_003903106.1.15028 WP_003903106.1.15040 WP_003903106.1.15052 WP_003903106.1.15065 WP_003903106.1.15072 WP_003903106.1.15089 WP_003903106.1.1509 WP_003903106.1.15126 WP_003903106.1.15131 WP_003903106.1.15168 WP_003903106.1.15172 WP_003903106.1.15174 WP_003903106.1.15187 WP_003903106.1.15196 WP_003903106.1.15210 WP_003903106.1.15216 WP_003903106.1.15217 WP_003903106.1.1523 WP_003903106.1.15232 WP_003903106.1.15238 WP_003903106.1.15240 WP_003903106.1.15253 WP_003903106.1.15267 WP_003903106.1.1527 WP_003903106.1.15292 WP_003903106.1.15299 WP_003903106.1.15302 WP_003903106.1.15322 WP_003903106.1.1534 WP_003903106.1.15365 WP_003903106.1.15372 WP_003903106.1.15386 WP_003903106.1.15387 WP_003903106.1.15442 WP_003903106.1.15447 WP_003903106.1.15449 WP_003903106.1.15477 WP_003903106.1.15481 WP_003903106.1.15492 WP_003903106.1.15511 WP_003903106.1.15512 WP_003903106.1.15558 WP_003903106.1.15559 WP_003903106.1.15566 WP_003903106.1.15599 WP_003903106.1.1560 WP_003903106.1.15611 WP_003903106.1.1563 WP_003903106.1.15633 WP_003903106.1.15643 WP_003903106.1.15688 WP_003903106.1.15755 WP_003903106.1.15763 WP_003903106.1.15774 WP_003903106.1.1578 WP_003903106.1.15780 WP_003903106.1.15827 WP_003903106.1.15834 WP_003903106.1.15842 WP_003903106.1.15848 WP_003903106.1.15853 WP_003903106.1.15870 WP_003903106.1.15877 WP_003903106.1.15893 WP_003903106.1.15896 WP_003903106.1.15926 WP_003903106.1.15933 WP_003903106.1.15946 WP_003903106.1.15958 WP_003903106.1.15973 WP_003903106.1.15987 WP_003903106.1.15993 WP_003903106.1.16009 WP_003903106.1.16025 WP_003903106.1.16043 WP_003903106.1.16055 WP_003903106.1.16066 WP_003903106.1.16069 WP_003903106.1.16077 WP_003903106.1.16106 WP_003903106.1.16108 WP_003903106.1.16110 WP_003903106.1.16130 WP_003903106.1.16136 WP_003903106.1.16139 WP_003903106.1.16141 WP_003903106.1.16143 WP_003903106.1.1630 WP_003903106.1.16318 WP_003903106.1.1632 WP_003903106.1.16327 WP_003903106.1.16334 WP_003903106.1.16341 WP_003903106.1.16345 WP_003903106.1.16374 WP_003903106.1.16384 WP_003903106.1.16386 WP_003903106.1.164 WP_003903106.1.1642 WP_003903106.1.16421 WP_003903106.1.16424 WP_003903106.1.16426 WP_003903106.1.16431 WP_003903106.1.1644 WP_003903106.1.16442 WP_003903106.1.16448 WP_003903106.1.16451 WP_003903106.1.16476 WP_003903106.1.16480 WP_003903106.1.16494 WP_003903106.1.1652 WP_003903106.1.16549 WP_003903106.1.16560 WP_003903106.1.16598 WP_003903106.1.16609 WP_003903106.1.16619 WP_003903106.1.16620 WP_003903106.1.16622 WP_003903106.1.16637 WP_003903106.1.1669 WP_003903106.1.16707 WP_003903106.1.16724 WP_003903106.1.16731 WP_003903106.1.16743 WP_003903106.1.1683 WP_003903106.1.16837 WP_003903106.1.16852 WP_003903106.1.16937 WP_003903106.1.16940 WP_003903106.1.16950 WP_003903106.1.16959 WP_003903106.1.16968 WP_003903106.1.1697 WP_003903106.1.16977 WP_003903106.1.16987 WP_003903106.1.17005 WP_003903106.1.17006 WP_003903106.1.17010 WP_003903106.1.17015 WP_003903106.1.17019 WP_003903106.1.17041 WP_003903106.1.17052 WP_003903106.1.17057 WP_003903106.1.17062 WP_003903106.1.1707 WP_003903106.1.17094 WP_003903106.1.17130 WP_003903106.1.17138 WP_003903106.1.17147 WP_003903106.1.17167 WP_003903106.1.17224 WP_003903106.1.17251 WP_003903106.1.17288 WP_003903106.1.17304 WP_003903106.1.17345 WP_003903106.1.17381 WP_003903106.1.17391 WP_003903106.1.17412 WP_003903106.1.1743 WP_003903106.1.17440 WP_003903106.1.17466 WP_003903106.1.17477 WP_003903106.1.17483 WP_003903106.1.17505 WP_003903106.1.17527 WP_003903106.1.17535 WP_003903106.1.17540 WP_003903106.1.17553 WP_003903106.1.17558 WP_003903106.1.17599 WP_003903106.1.17635 WP_003903106.1.17655 WP_003903106.1.17679 WP_003903106.1.1768 WP_003903106.1.17687 WP_003903106.1.17700 WP_003903106.1.17710 WP_003903106.1.17713 WP_003903106.1.17722 WP_003903106.1.17746 WP_003903106.1.17788 WP_003903106.1.17798 WP_003903106.1.17803 WP_003903106.1.17816 WP_003903106.1.17821 WP_003903106.1.17830 WP_003903106.1.17868 WP_003903106.1.17878 WP_003903106.1.1792 WP_003903106.1.17923 WP_003903106.1.1795 WP_003903106.1.17955 WP_003903106.1.17973 WP_003903106.1.18009 WP_003903106.1.18013 WP_003903106.1.18033 WP_003903106.1.18057 WP_003903106.1.18065 WP_003903106.1.18070 WP_003903106.1.18116 WP_003903106.1.18120 WP_003903106.1.18126 WP_003903106.1.1817 WP_003903106.1.18170 WP_003903106.1.18206 WP_003903106.1.18216 WP_003903106.1.18240 WP_003903106.1.18257 WP_003903106.1.18297 WP_003903106.1.18306 WP_003903106.1.18364 WP_003903106.1.18399 WP_003903106.1.18411 WP_003903106.1.18444 WP_003903106.1.18448 WP_003903106.1.18467 WP_003903106.1.18476 WP_003903106.1.18522 WP_003903106.1.18580 WP_003903106.1.18582 WP_003903106.1.18587 WP_003903106.1.186 WP_003903106.1.18601 WP_003903106.1.18639 WP_003903106.1.18646 WP_003903106.1.18647 WP_003903106.1.1868 WP_003903106.1.18694 WP_003903106.1.18710 WP_003903106.1.18751 WP_003903106.1.18781 WP_003903106.1.18793 WP_003903106.1.18804 WP_003903106.1.18816 WP_003903106.1.18823 WP_003903106.1.18827 WP_003903106.1.18838 WP_003903106.1.18849 WP_003903106.1.18856 WP_003903106.1.18945 WP_003903106.1.1898 WP_003903106.1.19005 WP_003903106.1.19056 WP_003903106.1.19063 WP_003903106.1.19066 WP_003903106.1.19071 WP_003903106.1.19085 WP_003903106.1.19094 WP_003903106.1.19144 WP_003903106.1.19159 WP_003903106.1.19193 WP_003903106.1.19231 WP_003903106.1.19243 WP_003903106.1.19264 WP_003903106.1.19295 WP_003903106.1.19307 WP_003903106.1.19326 WP_003903106.1.1933 WP_003903106.1.19364 WP_003903106.1.19382 WP_003903106.1.19400 WP_003903106.1.19426 WP_003903106.1.19429 WP_003903106.1.19464 WP_003903106.1.19480 WP_003903106.1.19512 WP_003903106.1.19553 WP_003903106.1.19562 WP_003903106.1.19564 WP_003903106.1.19568 WP_003903106.1.19572 WP_003903106.1.19595 WP_003903106.1.19596 WP_003903106.1.19600 WP_003903106.1.19630 WP_003903106.1.1967 WP_003903106.1.19694 WP_003903106.1.1970 WP_003903106.1.19707 WP_003903106.1.19742 WP_003903106.1.19785 WP_003903106.1.19820 WP_003903106.1.19868 WP_003903106.1.19874 WP_003903106.1.19890 WP_003903106.1.19900 WP_003903106.1.19922 WP_003903106.1.19936 WP_003903106.1.19946 WP_003903106.1.19949 WP_003903106.1.19960 WP_003903106.1.19964 WP_003903106.1.20007 WP_003903106.1.20016 WP_003903106.1.20028 WP_003903106.1.2003 WP_003903106.1.20037 WP_003903106.1.20039 WP_003903106.1.20082 WP_003903106.1.20085 WP_003903106.1.20097 WP_003903106.1.20116 WP_003903106.1.20130 WP_003903106.1.20140 WP_003903106.1.20141 WP_003903106.1.20142 WP_003903106.1.20158 WP_003903106.1.20239 WP_003903106.1.20243 WP_003903106.1.20259 WP_003903106.1.20262 WP_003903106.1.20268 WP_003903106.1.20272 WP_003903106.1.20273 WP_003903106.1.20280 WP_003903106.1.20294 WP_003903106.1.20300 WP_003903106.1.20309 WP_003903106.1.20322 WP_003903106.1.2037 WP_003903106.1.20372 WP_003903106.1.20381 WP_003903106.1.204 WP_003903106.1.20427 WP_003903106.1.20432 WP_003903106.1.20457 WP_003903106.1.20459 WP_003903106.1.20460 WP_003903106.1.20542 WP_003903106.1.20578 WP_003903106.1.20608 WP_003903106.1.20624 WP_003903106.1.20628 WP_003903106.1.2066 WP_003903106.1.20707 WP_003903106.1.20722 WP_003903106.1.20729 WP_003903106.1.20742 WP_003903106.1.20751 WP_003903106.1.20776 WP_003903106.1.20843 WP_003903106.1.20850 WP_003903106.1.2086 WP_003903106.1.20868 WP_003903106.1.20876 WP_003903106.1.20897 WP_003903106.1.20898 WP_003903106.1.2090 WP_003903106.1.20911 WP_003903106.1.20916 WP_003903106.1.20921 WP_003903106.1.20926 WP_003903106.1.20927 WP_003903106.1.20951 WP_003903106.1.20970 WP_003903106.1.2104 WP_003903106.1.21070 WP_003903106.1.21127 WP_003903106.1.21135 WP_003903106.1.21173 WP_003903106.1.21187 WP_003903106.1.212 WP_003903106.1.2120 WP_003903106.1.21218 WP_003903106.1.21219 WP_003903106.1.2123 WP_003903106.1.21231 WP_003903106.1.21234 WP_003903106.1.2126 WP_003903106.1.21292 WP_003903106.1.21307 WP_003903106.1.2131 WP_003903106.1.21311 WP_003903106.1.21321 WP_003903106.1.21365 WP_003903106.1.2137 WP_003903106.1.21392 WP_003903106.1.21397 WP_003903106.1.21403 WP_003903106.1.21415 WP_003903106.1.21418 WP_003903106.1.21430 WP_003903106.1.21434 WP_003903106.1.21444 WP_003903106.1.21468 WP_003903106.1.21498 WP_003903106.1.21509 WP_003903106.1.21513 WP_003903106.1.21560 WP_003903106.1.21565 WP_003903106.1.21586 WP_003903106.1.21591 WP_003903106.1.21594 WP_003903106.1.21602 WP_003903106.1.21615 WP_003903106.1.21638 WP_003903106.1.21639 WP_003903106.1.21655 WP_003903106.1.21658 WP_003903106.1.2168 WP_003903106.1.2174 WP_003903106.1.21741 WP_003903106.1.21777 WP_003903106.1.21786 WP_003903106.1.21795 WP_003903106.1.218 WP_003903106.1.21826 WP_003903106.1.21829 WP_003903106.1.21840 WP_003903106.1.21843 WP_003903106.1.21872 WP_003903106.1.21873 WP_003903106.1.2188 WP_003903106.1.21882 WP_003903106.1.21906 WP_003903106.1.21912 WP_003903106.1.2194 WP_003903106.1.21941 WP_003903106.1.21956 WP_003903106.1.21958 WP_003903106.1.21960 WP_003903106.1.21971 WP_003903106.1.21973 WP_003903106.1.21983 WP_003903106.1.22003 WP_003903106.1.22013 WP_003903106.1.22025 WP_003903106.1.22036 WP_003903106.1.22075 WP_003903106.1.22092 WP_003903106.1.2212 WP_003903106.1.22127 WP_003903106.1.22140 WP_003903106.1.22233 WP_003903106.1.22255 WP_003903106.1.22277 WP_003903106.1.22305 WP_003903106.1.22348 WP_003903106.1.22356 WP_003903106.1.22366 WP_003903106.1.2238 WP_003903106.1.22380 WP_003903106.1.22437 WP_003903106.1.22438 WP_003903106.1.22445 WP_003903106.1.22490 WP_003903106.1.22511 WP_003903106.1.22524 WP_003903106.1.2253 WP_003903106.1.22585 WP_003903106.1.22589 WP_003903106.1.22606 WP_003903106.1.22608 WP_003903106.1.22609 WP_003903106.1.22618 WP_003903106.1.2262 WP_003903106.1.22624 WP_003903106.1.22629 WP_003903106.1.22647 WP_003903106.1.22664 WP_003903106.1.22665 WP_003903106.1.22670 WP_003903106.1.22674 WP_003903106.1.22725 WP_003903106.1.22728 WP_003903106.1.22733 WP_003903106.1.22737 WP_003903106.1.2275 WP_003903106.1.22754 WP_003903106.1.22797 WP_003903106.1.22800 WP_003903106.1.22804 WP_003903106.1.22829 WP_003903106.1.22840 WP_003903106.1.22844 WP_003903106.1.22963 WP_003903106.1.22970 WP_003903106.1.22996 WP_003903106.1.22997 WP_003903106.1.22999 WP_003903106.1.23015 WP_003903106.1.23032 WP_003903106.1.231 WP_003903106.1.23101 WP_003903106.1.2312 WP_003903106.1.23153 WP_003903106.1.23171 WP_003903106.1.23199 WP_003903106.1.2320 WP_003903106.1.23204 WP_003903106.1.23216 WP_003903106.1.23229 WP_003903106.1.23233 WP_003903106.1.2326 WP_003903106.1.23261 WP_003903106.1.23272 WP_003903106.1.23289 WP_003903106.1.2329 WP_003903106.1.23308 WP_003903106.1.23316 WP_003903106.1.23321 WP_003903106.1.23325 WP_003903106.1.2339 WP_003903106.1.23406 WP_003903106.1.23438 WP_003903106.1.23445 WP_003903106.1.23447 WP_003903106.1.23452 WP_003903106.1.23461 WP_003903106.1.2349 WP_003903106.1.23496 WP_003903106.1.23506 WP_003903106.1.23530 WP_003903106.1.23539 WP_003903106.1.23546 WP_003903106.1.23551 WP_003903106.1.23573 WP_003903106.1.23583 WP_003903106.1.23588 WP_003903106.1.23628 WP_003903106.1.23677 WP_003903106.1.23683 WP_003903106.1.23692 WP_003903106.1.23694 WP_003903106.1.23699 WP_003903106.1.2371 WP_003903106.1.23807 WP_003903106.1.23825 WP_003903106.1.23832 WP_003903106.1.2384 WP_003903106.1.23843 WP_003903106.1.23863 WP_003903106.1.23894 WP_003903106.1.23993 WP_003903106.1.2400 WP_003903106.1.24007 WP_003903106.1.24008 WP_003903106.1.24046 WP_003903106.1.24057 WP_003903106.1.24113 WP_003903106.1.24119 WP_003903106.1.24128 WP_003903106.1.24140 WP_003903106.1.24176 WP_003903106.1.24190 WP_003903106.1.24202 WP_003903106.1.24261 WP_003903106.1.24284 WP_003903106.1.24294 WP_003903106.1.24357 WP_003903106.1.24396 WP_003903106.1.24414 WP_003903106.1.24423 WP_003903106.1.2443 WP_003903106.1.24446 WP_003903106.1.24461 WP_003903106.1.24500 WP_003903106.1.24507 WP_003903106.1.24509 WP_003903106.1.24529 WP_003903106.1.24553 WP_003903106.1.24599 WP_003903106.1.24629 WP_003903106.1.24638 WP_003903106.1.24648 WP_003903106.1.2466 WP_003903106.1.24824 WP_003903106.1.24831 WP_003903106.1.24840 WP_003903106.1.24848 WP_003903106.1.24857 WP_003903106.1.2487 WP_003903106.1.24893 WP_003903106.1.24907 WP_003903106.1.24933 WP_003903106.1.24956 WP_003903106.1.24958 WP_003903106.1.24985 WP_003903106.1.2499 WP_003903106.1.25004 WP_003903106.1.2505 WP_003903106.1.25051 WP_003903106.1.2507 WP_003903106.1.25096 WP_003903106.1.25103 WP_003903106.1.25129 WP_003903106.1.25171 WP_003903106.1.25184 WP_003903106.1.25247 WP_003903106.1.25252 WP_003903106.1.25278 WP_003903106.1.25283 WP_003903106.1.25309 WP_003903106.1.25313 WP_003903106.1.25338 WP_003903106.1.25342 WP_003903106.1.25343 WP_003903106.1.25367 WP_003903106.1.25393 WP_003903106.1.25406 WP_003903106.1.25435 WP_003903106.1.25437 WP_003903106.1.25445 WP_003903106.1.25455 WP_003903106.1.25473 WP_003903106.1.25504 WP_003903106.1.25513 WP_003903106.1.25542 WP_003903106.1.25579 WP_003903106.1.25594 WP_003903106.1.25606 WP_003903106.1.25645 WP_003903106.1.2566 WP_003903106.1.25673 WP_003903106.1.25674 WP_003903106.1.25693 WP_003903106.1.25699 WP_003903106.1.25727 WP_003903106.1.25736 WP_003903106.1.25738 WP_003903106.1.25756 WP_003903106.1.25759 WP_003903106.1.2580 WP_003903106.1.25813 WP_003903106.1.25853 WP_003903106.1.25854 WP_003903106.1.25874 WP_003903106.1.25885 WP_003903106.1.25892 WP_003903106.1.25906 WP_003903106.1.25914 WP_003903106.1.25916 WP_003903106.1.2594 WP_003903106.1.25954 WP_003903106.1.25972 WP_003903106.1.26017 WP_003903106.1.26032 WP_003903106.1.26038 WP_003903106.1.26072 WP_003903106.1.26089 WP_003903106.1.26097 WP_003903106.1.26098 WP_003903106.1.26108 WP_003903106.1.26109 WP_003903106.1.26118 WP_003903106.1.26126 WP_003903106.1.2614 WP_003903106.1.26168 WP_003903106.1.26182 WP_003903106.1.26190 WP_003903106.1.2620 WP_003903106.1.26234 WP_003903106.1.26243 WP_003903106.1.26267 WP_003903106.1.26292 WP_003903106.1.26310 WP_003903106.1.26328 WP_003903106.1.26349 WP_003903106.1.26366 WP_003903106.1.26374 WP_003903106.1.26407 WP_003903106.1.26454 WP_003903106.1.26464 WP_003903106.1.2653 WP_003903106.1.26560 WP_003903106.1.26571 WP_003903106.1.2659 WP_003903106.1.26597 WP_003903106.1.26603 WP_003903106.1.26629 WP_003903106.1.26651 WP_003903106.1.26702 WP_003903106.1.26707 WP_003903106.1.26710 WP_003903106.1.26719 WP_003903106.1.26737 WP_003903106.1.26738 WP_003903106.1.26745 WP_003903106.1.26756 WP_003903106.1.2676 WP_003903106.1.2677 WP_003903106.1.26779 WP_003903106.1.26780 WP_003903106.1.26798 WP_003903106.1.26854 WP_003903106.1.26868 WP_003903106.1.26876 WP_003903106.1.26888 WP_003903106.1.26914 WP_003903106.1.26945 WP_003903106.1.26959 WP_003903106.1.26969 WP_003903106.1.26984 WP_003903106.1.26992 WP_003903106.1.27004 WP_003903106.1.27017 WP_003903106.1.27045 WP_003903106.1.27074 WP_003903106.1.27075 WP_003903106.1.27128 WP_003903106.1.27130 WP_003903106.1.27139 WP_003903106.1.27152 WP_003903106.1.27162 WP_003903106.1.27164 WP_003903106.1.27193 WP_003903106.1.27235 WP_003903106.1.27278 WP_003903106.1.27343 WP_003903106.1.27352 WP_003903106.1.27369 WP_003903106.1.27391 WP_003903106.1.27398 WP_003903106.1.27402 WP_003903106.1.27410 WP_003903106.1.27411 WP_003903106.1.27449 WP_003903106.1.27460 WP_003903106.1.27463 WP_003903106.1.2749 WP_003903106.1.27492 WP_003903106.1.27528 WP_003903106.1.27541 WP_003903106.1.27576 WP_003903106.1.27582 WP_003903106.1.27596 WP_003903106.1.27607 WP_003903106.1.2766 WP_003903106.1.277 WP_003903106.1.27724 WP_003903106.1.27730 WP_003903106.1.27736 WP_003903106.1.27743 WP_003903106.1.27750 WP_003903106.1.27771 WP_003903106.1.27779 WP_003903106.1.27795 WP_003903106.1.27803 WP_003903106.1.27819 WP_003903106.1.27835 WP_003903106.1.27915 WP_003903106.1.27935 WP_003903106.1.27962 WP_003903106.1.28053 WP_003903106.1.28092 WP_003903106.1.28106 WP_003903106.1.28131 WP_003903106.1.28142 WP_003903106.1.28159 WP_003903106.1.2816 WP_003903106.1.28161 WP_003903106.1.28192 WP_003903106.1.28202 WP_003903106.1.28241 WP_003903106.1.28242 WP_003903106.1.28251 WP_003903106.1.28255 WP_003903106.1.28269 WP_003903106.1.28276 WP_003903106.1.28293 WP_003903106.1.28331 WP_003903106.1.28367 WP_003903106.1.28378 WP_003903106.1.28391 WP_003903106.1.2842 WP_003903106.1.28448 WP_003903106.1.2847 WP_003903106.1.28471 WP_003903106.1.28473 WP_003903106.1.28493 WP_003903106.1.28497 WP_003903106.1.28530 WP_003903106.1.28545 WP_003903106.1.28561 WP_003903106.1.28567 WP_003903106.1.28585 WP_003903106.1.286 WP_003903106.1.28610 WP_003903106.1.28617 WP_003903106.1.28634 WP_003903106.1.28642 WP_003903106.1.28671 WP_003903106.1.28682 WP_003903106.1.28698 WP_003903106.1.28703 WP_003903106.1.28739 WP_003903106.1.28758 WP_003903106.1.28781 WP_003903106.1.28787 WP_003903106.1.28827 WP_003903106.1.28839 WP_003903106.1.28847 WP_003903106.1.28850 WP_003903106.1.28851 WP_003903106.1.28865 WP_003903106.1.28897 WP_003903106.1.28914 WP_003903106.1.28935 WP_003903106.1.28936 WP_003903106.1.28939 WP_003903106.1.28943 WP_003903106.1.28952 WP_003903106.1.28975 WP_003903106.1.2899 WP_003903106.1.28993 WP_003903106.1.29000 WP_003903106.1.2901 WP_003903106.1.29028 WP_003903106.1.29033 WP_003903106.1.29058 WP_003903106.1.29078 WP_003903106.1.29102 WP_003903106.1.29115 WP_003903106.1.2916 WP_003903106.1.29217 WP_003903106.1.29223 WP_003903106.1.29234 WP_003903106.1.29264 WP_003903106.1.29275 WP_003903106.1.29306 WP_003903106.1.29339 WP_003903106.1.29348 WP_003903106.1.29364 WP_003903106.1.29367 WP_003903106.1.2938 WP_003903106.1.29399 WP_003903106.1.29426 WP_003903106.1.2944 WP_003903106.1.29449 WP_003903106.1.29450 WP_003903106.1.29452 WP_003903106.1.2949 WP_003903106.1.29510 WP_003903106.1.29515 WP_003903106.1.29525 WP_003903106.1.2953 WP_003903106.1.29587 WP_003903106.1.2959 WP_003903106.1.29592 WP_003903106.1.29599 WP_003903106.1.29611 WP_003903106.1.29632 WP_003903106.1.29649 WP_003903106.1.2965 WP_003903106.1.29659 WP_003903106.1.2969 WP_003903106.1.29696 WP_003903106.1.29698 WP_003903106.1.29718 WP_003903106.1.29742 WP_003903106.1.29745 WP_003903106.1.29747 WP_003903106.1.29769 WP_003903106.1.29825 WP_003903106.1.29830 WP_003903106.1.29847 WP_003903106.1.29861 WP_003903106.1.29869 WP_003903106.1.29883 WP_003903106.1.29890 WP_003903106.1.299 WP_003903106.1.29931 WP_003903106.1.29960 WP_003903106.1.30014 WP_003903106.1.3004 WP_003903106.1.30040 WP_003903106.1.30043 WP_003903106.1.30074 WP_003903106.1.30097 WP_003903106.1.30101 WP_003903106.1.30106 WP_003903106.1.30114 WP_003903106.1.30126 WP_003903106.1.30131 WP_003903106.1.30138 WP_003903106.1.30139 WP_003903106.1.30145 WP_003903106.1.30211 WP_003903106.1.30224 WP_003903106.1.30235 WP_003903106.1.30237 WP_003903106.1.3027 WP_003903106.1.30279 WP_003903106.1.30282 WP_003903106.1.30283 WP_003903106.1.30288 WP_003903106.1.30291 WP_003903106.1.30363 WP_003903106.1.30374 WP_003903106.1.30404 WP_003903106.1.3043 WP_003903106.1.30433 WP_003903106.1.30438 WP_003903106.1.30462 WP_003903106.1.30464 WP_003903106.1.30468 WP_003903106.1.30500 WP_003903106.1.3057 WP_003903106.1.30574 WP_003903106.1.30628 WP_003903106.1.30641 WP_003903106.1.30642 WP_003903106.1.30661 WP_003903106.1.30683 WP_003903106.1.30699 WP_003903106.1.30709 WP_003903106.1.30713 WP_003903106.1.30716 WP_003903106.1.30719 WP_003903106.1.30730 WP_003903106.1.30736 WP_003903106.1.30745 WP_003903106.1.30760 WP_003903106.1.30791 WP_003903106.1.308 WP_003903106.1.30807 WP_003903106.1.30818 WP_003903106.1.30824 WP_003903106.1.30848 WP_003903106.1.30877 WP_003903106.1.30888 WP_003903106.1.30901 WP_003903106.1.30903 WP_003903106.1.30912 WP_003903106.1.30913 WP_003903106.1.30914 WP_003903106.1.30919 WP_003903106.1.30977 WP_003903106.1.3100 WP_003903106.1.31002 WP_003903106.1.3101 WP_003903106.1.31034 WP_003903106.1.31047 WP_003903106.1.31070 WP_003903106.1.31074 WP_003903106.1.31102 WP_003903106.1.31127 WP_003903106.1.31184 WP_003903106.1.31199 WP_003903106.1.31226 WP_003903106.1.31230 WP_003903106.1.31233 WP_003903106.1.31263 WP_003903106.1.31264 WP_003903106.1.31270 WP_003903106.1.31287 WP_003903106.1.31290 WP_003903106.1.31304 WP_003903106.1.31346 WP_003903106.1.31348 WP_003903106.1.31354 WP_003903106.1.31390 WP_003903106.1.31414 WP_003903106.1.31417 WP_003903106.1.31428 WP_003903106.1.3143 WP_003903106.1.31458 WP_003903106.1.31483 WP_003903106.1.3149 WP_003903106.1.31498 WP_003903106.1.31507 WP_003903106.1.31537 WP_003903106.1.31548 WP_003903106.1.31569 WP_003903106.1.31573 WP_003903106.1.316 WP_003903106.1.31629 WP_003903106.1.31666 WP_003903106.1.31693 WP_003903106.1.31703 WP_003903106.1.31744 WP_003903106.1.31745 WP_003903106.1.31770 WP_003903106.1.31776 WP_003903106.1.31783 WP_003903106.1.318 WP_003903106.1.3184 WP_003903106.1.31840 WP_003903106.1.31880 WP_003903106.1.31911 WP_003903106.1.31930 WP_003903106.1.31932 WP_003903106.1.31955 WP_003903106.1.31985 WP_003903106.1.31991 WP_003903106.1.31995 WP_003903106.1.32004 WP_003903106.1.32039 WP_003903106.1.3204 WP_003903106.1.32045 WP_003903106.1.32071 WP_003903106.1.32098 WP_003903106.1.32132 WP_003903106.1.32157 WP_003903106.1.32164 WP_003903106.1.32179 WP_003903106.1.32198 WP_003903106.1.32297 WP_003903106.1.32317 WP_003903106.1.32383 WP_003903106.1.32400 WP_003903106.1.32403 WP_003903106.1.32416 WP_003903106.1.32421 WP_003903106.1.32433 WP_003903106.1.32461 WP_003903106.1.32482 WP_003903106.1.32503 WP_003903106.1.32556 WP_003903106.1.32562 WP_003903106.1.32569 WP_003903106.1.32592 WP_003903106.1.32620 WP_003903106.1.32647 WP_003903106.1.32653 WP_003903106.1.32654 WP_003903106.1.3268 WP_003903106.1.32695 WP_003903106.1.32706 WP_003903106.1.32716 WP_003903106.1.32738 WP_003903106.1.32752 WP_003903106.1.32780 WP_003903106.1.32781 WP_003903106.1.32793 WP_003903106.1.32799 WP_003903106.1.32833 WP_003903106.1.32862 WP_003903106.1.32880 WP_003903106.1.32897 WP_003903106.1.32909 WP_003903106.1.32935 WP_003903106.1.32974 WP_003903106.1.33007 WP_003903106.1.3302 WP_003903106.1.33028 WP_003903106.1.33035 WP_003903106.1.33044 WP_003903106.1.33054 WP_003903106.1.33082 WP_003903106.1.33141 WP_003903106.1.33148 WP_003903106.1.33155 WP_003903106.1.33168 WP_003903106.1.3321 WP_003903106.1.33215 WP_003903106.1.3325 WP_003903106.1.3327 WP_003903106.1.33278 WP_003903106.1.33288 WP_003903106.1.33305 WP_003903106.1.3331 WP_003903106.1.33319 WP_003903106.1.3333 WP_003903106.1.33393 WP_003903106.1.33403 WP_003903106.1.33452 WP_003903106.1.33467 WP_003903106.1.33477 WP_003903106.1.3349 WP_003903106.1.33519 WP_003903106.1.33542 WP_003903106.1.33601 WP_003903106.1.33602 WP_003903106.1.33633 WP_003903106.1.33646 WP_003903106.1.33673 WP_003903106.1.3369 WP_003903106.1.33705 WP_003903106.1.33762 WP_003903106.1.33783 WP_003903106.1.33789 WP_003903106.1.3383 WP_003903106.1.33832 WP_003903106.1.33839 WP_003903106.1.33848 WP_003903106.1.3387 WP_003903106.1.33886 WP_003903106.1.33895 WP_003903106.1.33906 WP_003903106.1.33912 WP_003903106.1.33954 WP_003903106.1.3399 WP_003903106.1.34042 WP_003903106.1.3405 WP_003903106.1.34055 WP_003903106.1.34056 WP_003903106.1.34065 WP_003903106.1.3408 WP_003903106.1.34090 WP_003903106.1.34109 WP_003903106.1.34131 WP_003903106.1.34152 WP_003903106.1.34153 WP_003903106.1.34163 WP_003903106.1.34181 WP_003903106.1.34197 WP_003903106.1.34198 WP_003903106.1.34215 WP_003903106.1.34219 WP_003903106.1.34255 WP_003903106.1.34260 WP_003903106.1.34275 WP_003903106.1.343 WP_003903106.1.34347 WP_003903106.1.34392 WP_003903106.1.344 WP_003903106.1.34428 WP_003903106.1.3443 WP_003903106.1.34435 WP_003903106.1.34446 WP_003903106.1.34499 WP_003903106.1.34505 WP_003903106.1.34516 WP_003903106.1.34551 WP_003903106.1.34563 WP_003903106.1.34576 WP_003903106.1.34581 WP_003903106.1.34588 WP_003903106.1.34596 WP_003903106.1.34599 WP_003903106.1.34639 WP_003903106.1.34673 WP_003903106.1.34724 WP_003903106.1.34740 WP_003903106.1.34755 WP_003903106.1.34777 WP_003903106.1.34783 WP_003903106.1.34841 WP_003903106.1.34908 WP_003903106.1.34919 WP_003903106.1.3492 WP_003903106.1.34933 WP_003903106.1.34945 WP_003903106.1.34946 WP_003903106.1.34954 WP_003903106.1.34960 WP_003903106.1.34961 WP_003903106.1.34963 WP_003903106.1.34965 WP_003903106.1.34968 WP_003903106.1.35023 WP_003903106.1.35069 WP_003903106.1.35072 WP_003903106.1.35078 WP_003903106.1.35100 WP_003903106.1.35146 WP_003903106.1.35156 WP_003903106.1.35160 WP_003903106.1.35162 WP_003903106.1.35176 WP_003903106.1.3520 WP_003903106.1.35213 WP_003903106.1.35221 WP_003903106.1.35246 WP_003903106.1.35278 WP_003903106.1.35301 WP_003903106.1.35311 WP_003903106.1.35312 WP_003903106.1.35317 WP_003903106.1.35319 WP_003903106.1.35347 WP_003903106.1.35363 WP_003903106.1.35382 WP_003903106.1.35385 WP_003903106.1.35396 WP_003903106.1.35397 WP_003903106.1.35403 WP_003903106.1.35426 WP_003903106.1.35439 WP_003903106.1.35455 WP_003903106.1.3548 WP_003903106.1.35484 WP_003903106.1.35492 WP_003903106.1.3553 WP_003903106.1.35553 WP_003903106.1.35555 WP_003903106.1.35561 WP_003903106.1.35602 WP_003903106.1.35610 WP_003903106.1.35635 WP_003903106.1.35657 WP_003903106.1.35687 WP_003903106.1.35689 WP_003903106.1.35707 WP_003903106.1.35732 WP_003903106.1.35754 WP_003903106.1.35767 WP_003903106.1.35770 WP_003903106.1.35771 WP_003903106.1.35780 WP_003903106.1.35805 WP_003903106.1.35811 WP_003903106.1.35821 WP_003903106.1.3584 WP_003903106.1.35848 WP_003903106.1.35864 WP_003903106.1.35874 WP_003903106.1.35876 WP_003903106.1.35897 WP_003903106.1.35899 WP_003903106.1.35923 WP_003903106.1.3593 WP_003903106.1.35954 WP_003903106.1.36005 WP_003903106.1.36014 WP_003903106.1.36023 WP_003903106.1.36051 WP_003903106.1.36053 WP_003903106.1.36075 WP_003903106.1.36089 WP_003903106.1.36097 WP_003903106.1.36098 WP_003903106.1.36116 WP_003903106.1.36145 WP_003903106.1.36156 WP_003903106.1.36205 WP_003903106.1.36228 WP_003903106.1.36252 WP_003903106.1.36260 WP_003903106.1.36270 WP_003903106.1.36271 WP_003903106.1.36303 WP_003903106.1.36309 WP_003903106.1.36315 WP_003903106.1.36319 WP_003903106.1.36321 WP_003903106.1.36326 WP_003903106.1.3634 WP_003903106.1.36356 WP_003903106.1.36357 WP_003903106.1.3636 WP_003903106.1.36385 WP_003903106.1.36399 WP_003903106.1.36436 WP_003903106.1.36465 WP_003903106.1.36469 WP_003903106.1.36473 WP_003903106.1.36485 WP_003903106.1.36508 WP_003903106.1.36540 WP_003903106.1.36561 WP_003903106.1.36571 WP_003903106.1.36573 WP_003903106.1.36578 WP_003903106.1.36585 WP_003903106.1.36597 WP_003903106.1.36614 WP_003903106.1.36674 WP_003903106.1.36720 WP_003903106.1.36727 WP_003903106.1.36733 WP_003903106.1.36785 WP_003903106.1.36810 WP_003903106.1.36844 WP_003903106.1.36851 WP_003903106.1.36862 WP_003903106.1.36893 WP_003903106.1.36901 WP_003903106.1.36921 WP_003903106.1.36935 WP_003903106.1.36941 WP_003903106.1.3695 WP_003903106.1.36951 WP_003903106.1.36968 WP_003903106.1.3700 WP_003903106.1.37004 WP_003903106.1.37012 WP_003903106.1.37071 WP_003903106.1.37088 WP_003903106.1.37131 WP_003903106.1.37157 WP_003903106.1.37175 WP_003903106.1.37188 WP_003903106.1.37213 WP_003903106.1.37229 WP_003903106.1.3724 WP_003903106.1.37277 WP_003903106.1.37305 WP_003903106.1.37330 WP_003903106.1.37389 WP_003903106.1.37400 WP_003903106.1.37440 WP_003903106.1.37459 WP_003903106.1.37468 WP_003903106.1.37475 WP_003903106.1.37484 WP_003903106.1.37601 WP_003903106.1.37612 WP_003903106.1.37632 WP_003903106.1.37643 WP_003903106.1.37655 WP_003903106.1.37660 WP_003903106.1.37674 WP_003903106.1.37700 WP_003903106.1.37701 WP_003903106.1.37709 WP_003903106.1.37711 WP_003903106.1.37721 WP_003903106.1.37722 WP_003903106.1.37747 WP_003903106.1.37765 WP_003903106.1.37772 WP_003903106.1.37804 WP_003903106.1.37809 WP_003903106.1.37859 WP_003903106.1.37877 WP_003903106.1.37912 WP_003903106.1.37913 WP_003903106.1.37943 WP_003903106.1.37950 WP_003903106.1.37973 WP_003903106.1.37975 WP_003903106.1.37983 WP_003903106.1.38 WP_003903106.1.38002 WP_003903106.1.3802 WP_003903106.1.38039 WP_003903106.1.38040 WP_003903106.1.38067 WP_003903106.1.38068 WP_003903106.1.38138 WP_003903106.1.38144 WP_003903106.1.38158 WP_003903106.1.38159 WP_003903106.1.38210 WP_003903106.1.38233 WP_003903106.1.38240 WP_003903106.1.38299 WP_003903106.1.38332 WP_003903106.1.38347 WP_003903106.1.38354 WP_003903106.1.38380 WP_003903106.1.38384 WP_003903106.1.38389 WP_003903106.1.38398 WP_003903106.1.38402 WP_003903106.1.38418 WP_003903106.1.38421 WP_003903106.1.38466 WP_003903106.1.38477 WP_003903106.1.38483 WP_003903106.1.3849 WP_003903106.1.385 WP_003903106.1.38530 WP_003903106.1.38535 WP_003903106.1.38539 WP_003903106.1.38594 WP_003903106.1.38601 WP_003903106.1.38611 WP_003903106.1.38638 WP_003903106.1.38639 WP_003903106.1.38646 WP_003903106.1.38648 WP_003903106.1.38654 WP_003903106.1.38659 WP_003903106.1.38660 WP_003903106.1.38666 WP_003903106.1.38671 WP_003903106.1.38672 WP_003903106.1.38677 WP_003903106.1.38750 WP_003903106.1.38772 WP_003903106.1.38812 WP_003903106.1.38821 WP_003903106.1.38844 WP_003903106.1.38863 WP_003903106.1.38865 WP_003903106.1.38873 WP_003903106.1.3889 WP_003903106.1.38894 WP_003903106.1.38909 WP_003903106.1.38939 WP_003903106.1.38974 WP_003903106.1.38975 WP_003903106.1.38991 WP_003903106.1.39025 WP_003903106.1.39070 WP_003903106.1.39072 WP_003903106.1.39095 WP_003903106.1.39106 WP_003903106.1.39165 WP_003903106.1.39174 WP_003903106.1.39176 WP_003903106.1.39178 WP_003903106.1.39190 WP_003903106.1.39201 WP_003903106.1.39207 WP_003903106.1.39211 WP_003903106.1.39236 WP_003903106.1.39239 WP_003903106.1.39252 WP_003903106.1.39288 WP_003903106.1.39295 WP_003903106.1.39306 WP_003903106.1.39359 WP_003903106.1.39364 WP_003903106.1.39400 WP_003903106.1.39447 WP_003903106.1.3945 WP_003903106.1.39450 WP_003903106.1.39455 WP_003903106.1.3949 WP_003903106.1.39521 WP_003903106.1.39560 WP_003903106.1.39592 WP_003903106.1.39593 WP_003903106.1.396 WP_003903106.1.3960 WP_003903106.1.39616 WP_003903106.1.39654 WP_003903106.1.39657 WP_003903106.1.39661 WP_003903106.1.39674 WP_003903106.1.39678 WP_003903106.1.3968 WP_003903106.1.39694 WP_003903106.1.3971 WP_003903106.1.39728 WP_003903106.1.39739 WP_003903106.1.39748 WP_003903106.1.39751 WP_003903106.1.39759 WP_003903106.1.39801 WP_003903106.1.39804 WP_003903106.1.39848 WP_003903106.1.39877 WP_003903106.1.39925 WP_003903106.1.3994 WP_003903106.1.39959 WP_003903106.1.3996 WP_003903106.1.39960 WP_003903106.1.3997 WP_003903106.1.39980 WP_003903106.1.40000 WP_003903106.1.40028 WP_003903106.1.40029 WP_003903106.1.4003 WP_003903106.1.40094 WP_003903106.1.40096 WP_003903106.1.40150 WP_003903106.1.40156 WP_003903106.1.40174 WP_003903106.1.40186 WP_003903106.1.40276 WP_003903106.1.40277 WP_003903106.1.40323 WP_003903106.1.40336 WP_003903106.1.40353 WP_003903106.1.4036 WP_003903106.1.40372 WP_003903106.1.40402 WP_003903106.1.40413 WP_003903106.1.40440 WP_003903106.1.40446 WP_003903106.1.40451 WP_003903106.1.40455 WP_003903106.1.40523 WP_003903106.1.40543 WP_003903106.1.40641 WP_003903106.1.40646 WP_003903106.1.40651 WP_003903106.1.40653 WP_003903106.1.4067 WP_003903106.1.40705 WP_003903106.1.40723 WP_003903106.1.40731 WP_003903106.1.40735 WP_003903106.1.40795 WP_003903106.1.40799 WP_003903106.1.40852 WP_003903106.1.40876 WP_003903106.1.40881 WP_003903106.1.40922 WP_003903106.1.40948 WP_003903106.1.4095 WP_003903106.1.40956 WP_003903106.1.40957 WP_003903106.1.40964 WP_003903106.1.4097 WP_003903106.1.410 WP_003903106.1.41000 WP_003903106.1.41055 WP_003903106.1.41108 WP_003903106.1.41123 WP_003903106.1.41177 WP_003903106.1.41202 WP_003903106.1.41219 WP_003903106.1.41231 WP_003903106.1.41249 WP_003903106.1.4127 WP_003903106.1.41296 WP_003903106.1.41355 WP_003903106.1.41376 WP_003903106.1.41430 WP_003903106.1.41443 WP_003903106.1.41447 WP_003903106.1.41469 WP_003903106.1.41504 WP_003903106.1.41553 WP_003903106.1.41564 WP_003903106.1.41616 WP_003903106.1.41632 WP_003903106.1.41635 WP_003903106.1.41636 WP_003903106.1.41648 WP_003903106.1.41660 WP_003903106.1.41685 WP_003903106.1.41695 WP_003903106.1.41704 WP_003903106.1.4171 WP_003903106.1.41719 WP_003903106.1.41733 WP_003903106.1.41744 WP_003903106.1.41774 WP_003903106.1.41791 WP_003903106.1.41803 WP_003903106.1.41820 WP_003903106.1.41828 WP_003903106.1.41829 WP_003903106.1.41860 WP_003903106.1.41912 WP_003903106.1.41921 WP_003903106.1.41933 WP_003903106.1.41944 WP_003903106.1.42043 WP_003903106.1.42075 WP_003903106.1.42078 WP_003903106.1.42094 WP_003903106.1.42112 WP_003903106.1.4212 WP_003903106.1.42122 WP_003903106.1.42134 WP_003903106.1.42183 WP_003903106.1.42188 WP_003903106.1.42202 WP_003903106.1.42208 WP_003903106.1.42247 WP_003903106.1.42255 WP_003903106.1.42273 WP_003903106.1.42278 WP_003903106.1.42304 WP_003903106.1.42309 WP_003903106.1.42370 WP_003903106.1.42385 WP_003903106.1.42400 WP_003903106.1.42409 WP_003903106.1.42414 WP_003903106.1.42430 WP_003903106.1.42461 WP_003903106.1.42465 WP_003903106.1.42467 WP_003903106.1.42473 WP_003903106.1.42474 WP_003903106.1.4248 WP_003903106.1.42494 WP_003903106.1.42519 WP_003903106.1.42524 WP_003903106.1.42534 WP_003903106.1.4255 WP_003903106.1.42562 WP_003903106.1.42568 WP_003903106.1.42570 WP_003903106.1.42618 WP_003903106.1.42660 WP_003903106.1.42695 WP_003903106.1.42704 WP_003903106.1.42705 WP_003903106.1.42722 WP_003903106.1.42777 WP_003903106.1.42782 WP_003903106.1.42835 WP_003903106.1.42839 WP_003903106.1.42842 WP_003903106.1.42905 WP_003903106.1.42916 WP_003903106.1.42930 WP_003903106.1.42971 WP_003903106.1.43005 WP_003903106.1.43009 WP_003903106.1.43053 WP_003903106.1.43082 WP_003903106.1.43087 WP_003903106.1.43098 WP_003903106.1.43208 WP_003903106.1.43236 WP_003903106.1.43246 WP_003903106.1.43255 WP_003903106.1.43266 WP_003903106.1.43269 WP_003903106.1.43273 WP_003903106.1.43296 WP_003903106.1.43306 WP_003903106.1.4335 WP_003903106.1.43368 WP_003903106.1.43395 WP_003903106.1.43457 WP_003903106.1.43462 WP_003903106.1.43475 WP_003903106.1.43478 WP_003903106.1.43484 WP_003903106.1.43557 WP_003903106.1.43578 WP_003903106.1.43588 WP_003903106.1.43643 WP_003903106.1.43664 WP_003903106.1.43684 WP_003903106.1.43686 WP_003903106.1.43706 WP_003903106.1.43716 WP_003903106.1.4377 WP_003903106.1.43781 WP_003903106.1.43794 WP_003903106.1.43815 WP_003903106.1.43846 WP_003903106.1.43861 WP_003903106.1.43863 WP_003903106.1.43866 WP_003903106.1.43872 WP_003903106.1.43885 WP_003903106.1.43897 WP_003903106.1.4390 WP_003903106.1.43902 WP_003903106.1.43921 WP_003903106.1.43936 WP_003903106.1.43937 WP_003903106.1.43960 WP_003903106.1.43965 WP_003903106.1.4399 WP_003903106.1.43993 WP_003903106.1.43996 WP_003903106.1.44 WP_003903106.1.44001 WP_003903106.1.44008 WP_003903106.1.44033 WP_003903106.1.44037 WP_003903106.1.44041 WP_003903106.1.44070 WP_003903106.1.44071 WP_003903106.1.44076 WP_003903106.1.44104 WP_003903106.1.44111 WP_003903106.1.44124 WP_003903106.1.44169 WP_003903106.1.44219 WP_003903106.1.44237 WP_003903106.1.44277 WP_003903106.1.44279 WP_003903106.1.44336 WP_003903106.1.44355 WP_003903106.1.44358 WP_003903106.1.4438 WP_003903106.1.44390 WP_003903106.1.44392 WP_003903106.1.4441 WP_003903106.1.44415 WP_003903106.1.44464 WP_003903106.1.44466 WP_003903106.1.44489 WP_003903106.1.44492 WP_003903106.1.44494 WP_003903106.1.44500 WP_003903106.1.44519 WP_003903106.1.44526 WP_003903106.1.44532 WP_003903106.1.44534 WP_003903106.1.44562 WP_003903106.1.44589 WP_003903106.1.44597 WP_003903106.1.44600 WP_003903106.1.44602 WP_003903106.1.44615 WP_003903106.1.4464 WP_003903106.1.44651 WP_003903106.1.44659 WP_003903106.1.44665 WP_003903106.1.44694 WP_003903106.1.44700 WP_003903106.1.44713 WP_003903106.1.44735 WP_003903106.1.44740 WP_003903106.1.44757 WP_003903106.1.4476 WP_003903106.1.44761 WP_003903106.1.44767 WP_003903106.1.44776 WP_003903106.1.44779 WP_003903106.1.44786 WP_003903106.1.44808 WP_003903106.1.44864 WP_003903106.1.44901 WP_003903106.1.44908 WP_003903106.1.44913 WP_003903106.1.4492 WP_003903106.1.44939 WP_003903106.1.44979 WP_003903106.1.44981 WP_003903106.1.45002 WP_003903106.1.45011 WP_003903106.1.4504 WP_003903106.1.45062 WP_003903106.1.45066 WP_003903106.1.45081 WP_003903106.1.45113 WP_003903106.1.45129 WP_003903106.1.45135 WP_003903106.1.45147 WP_003903106.1.45168 WP_003903106.1.4517 WP_003903106.1.45181 WP_003903106.1.45185 WP_003903106.1.45192 WP_003903106.1.45200 WP_003903106.1.45205 WP_003903106.1.45211 WP_003903106.1.45249 WP_003903106.1.4526 WP_003903106.1.45286 WP_003903106.1.45326 WP_003903106.1.45347 WP_003903106.1.45374 WP_003903106.1.45390 WP_003903106.1.454 WP_003903106.1.45407 WP_003903106.1.45451 WP_003903106.1.45453 WP_003903106.1.45460 WP_003903106.1.45463 WP_003903106.1.45470 WP_003903106.1.45474 WP_003903106.1.45491 WP_003903106.1.45510 WP_003903106.1.45563 WP_003903106.1.45584 WP_003903106.1.45590 WP_003903106.1.45619 WP_003903106.1.45626 WP_003903106.1.45631 WP_003903106.1.45666 WP_003903106.1.45697 WP_003903106.1.4571 WP_003903106.1.45731 WP_003903106.1.45743 WP_003903106.1.45765 WP_003903106.1.45776 WP_003903106.1.45783 WP_003903106.1.45805 WP_003903106.1.45815 WP_003903106.1.45849 WP_003903106.1.45867 WP_003903106.1.45884 WP_003903106.1.4590 WP_003903106.1.45923 WP_003903106.1.45926 WP_003903106.1.45963 WP_003903106.1.45989 WP_003903106.1.45992 WP_003903106.1.46025 WP_003903106.1.46083 WP_003903106.1.46090 WP_003903106.1.46092 WP_003903106.1.46100 WP_003903106.1.46101 WP_003903106.1.46103 WP_003903106.1.46107 WP_003903106.1.46127 WP_003903106.1.46128 WP_003903106.1.46129 WP_003903106.1.46141 WP_003903106.1.46150 WP_003903106.1.46201 WP_003903106.1.46226 WP_003903106.1.4624 WP_003903106.1.46253 WP_003903106.1.46268 WP_003903106.1.46285 WP_003903106.1.46300 WP_003903106.1.46313 WP_003903106.1.46336 WP_003903106.1.46365 WP_003903106.1.46370 WP_003903106.1.46381 WP_003903106.1.46402 WP_003903106.1.46411 WP_003903106.1.4644 WP_003903106.1.46442 WP_003903106.1.46453 WP_003903106.1.46463 WP_003903106.1.46478 WP_003903106.1.46492 WP_003903106.1.46521 WP_003903106.1.4653 WP_003903106.1.46532 WP_003903106.1.46539 WP_003903106.1.46568 WP_003903106.1.46585 WP_003903106.1.46609 WP_003903106.1.46613 WP_003903106.1.46625 WP_003903106.1.46642 WP_003903106.1.46647 WP_003903106.1.46674 WP_003903106.1.46724 WP_003903106.1.46758 WP_003903106.1.46773 WP_003903106.1.46777 WP_003903106.1.46786 WP_003903106.1.46792 WP_003903106.1.46847 WP_003903106.1.46851 WP_003903106.1.4687 WP_003903106.1.46897 WP_003903106.1.46936 WP_003903106.1.46980 WP_003903106.1.47011 WP_003903106.1.47012 WP_003903106.1.47066 WP_003903106.1.47077 WP_003903106.1.47083 WP_003903106.1.47106 WP_003903106.1.47142 WP_003903106.1.47147 WP_003903106.1.47166 WP_003903106.1.47178 WP_003903106.1.47179 WP_003903106.1.47194 WP_003903106.1.47207 WP_003903106.1.47210 WP_003903106.1.47261 WP_003903106.1.47262 WP_003903106.1.47402 WP_003903106.1.47423 WP_003903106.1.47467 WP_003903106.1.47502 WP_003903106.1.4751 WP_003903106.1.47511 WP_003903106.1.47537 WP_003903106.1.47540 WP_003903106.1.47568 WP_003903106.1.47572 WP_003903106.1.47588 WP_003903106.1.47636 WP_003903106.1.4764 WP_003903106.1.47653 WP_003903106.1.47679 WP_003903106.1.47681 WP_003903106.1.47690 WP_003903106.1.4771 WP_003903106.1.47717 WP_003903106.1.47743 WP_003903106.1.47754 WP_003903106.1.47773 WP_003903106.1.47776 WP_003903106.1.47780 WP_003903106.1.47805 WP_003903106.1.47832 WP_003903106.1.47847 WP_003903106.1.47858 WP_003903106.1.47861 WP_003903106.1.47868 WP_003903106.1.47893 WP_003903106.1.47899 WP_003903106.1.479 WP_003903106.1.47912 WP_003903106.1.47913 WP_003903106.1.47926 WP_003903106.1.4794 WP_003903106.1.47943 WP_003903106.1.47944 WP_003903106.1.47959 WP_003903106.1.47974 WP_003903106.1.47993 WP_003903106.1.48004 WP_003903106.1.48039 WP_003903106.1.48050 WP_003903106.1.48084 WP_003903106.1.48097 WP_003903106.1.48101 WP_003903106.1.4813 WP_003903106.1.48130 WP_003903106.1.48135 WP_003903106.1.48143 WP_003903106.1.48152 WP_003903106.1.48155 WP_003903106.1.48170 WP_003903106.1.48173 WP_003903106.1.48177 WP_003903106.1.48185 WP_003903106.1.48204 WP_003903106.1.48219 WP_003903106.1.4823 WP_003903106.1.48240 WP_003903106.1.48256 WP_003903106.1.48264 WP_003903106.1.48287 WP_003903106.1.48330 WP_003903106.1.48333 WP_003903106.1.48348 WP_003903106.1.48354 WP_003903106.1.48372 WP_003903106.1.48383 WP_003903106.1.48388 WP_003903106.1.48419 WP_003903106.1.48423 WP_003903106.1.48443 WP_003903106.1.48450 WP_003903106.1.48462 WP_003903106.1.48543 WP_003903106.1.48550 WP_003903106.1.48605 WP_003903106.1.48618 WP_003903106.1.4863 WP_003903106.1.48648 WP_003903106.1.48658 WP_003903106.1.48666 WP_003903106.1.48687 WP_003903106.1.48779 WP_003903106.1.4878 WP_003903106.1.48798 WP_003903106.1.48802 WP_003903106.1.48826 WP_003903106.1.48831 WP_003903106.1.48843 WP_003903106.1.48857 WP_003903106.1.4890 WP_003903106.1.48946 WP_003903106.1.48979 WP_003903106.1.49017 WP_003903106.1.49048 WP_003903106.1.49059 WP_003903106.1.4906 WP_003903106.1.4907 WP_003903106.1.49103 WP_003903106.1.49110 WP_003903106.1.49111 WP_003903106.1.49112 WP_003903106.1.4919 WP_003903106.1.49251 WP_003903106.1.49254 WP_003903106.1.49263 WP_003903106.1.49291 WP_003903106.1.49296 WP_003903106.1.49335 WP_003903106.1.49337 WP_003903106.1.49419 WP_003903106.1.49426 WP_003903106.1.49437 WP_003903106.1.49439 WP_003903106.1.49474 WP_003903106.1.49506 WP_003903106.1.49516 WP_003903106.1.49523 WP_003903106.1.49526 WP_003903106.1.49532 WP_003903106.1.49588 WP_003903106.1.4959 WP_003903106.1.49678 WP_003903106.1.49687 WP_003903106.1.49699 WP_003903106.1.49709 WP_003903106.1.4971 WP_003903106.1.4972 WP_003903106.1.49736 WP_003903106.1.49746 WP_003903106.1.49764 WP_003903106.1.49773 WP_003903106.1.49796 WP_003903106.1.49814 WP_003903106.1.49815 WP_003903106.1.49816 WP_003903106.1.49839 WP_003903106.1.49857 WP_003903106.1.49878 WP_003903106.1.49880 WP_003903106.1.49944 WP_003903106.1.4999 WP_003903106.1.49990 WP_003903106.1.50068 WP_003903106.1.50077 WP_003903106.1.5008 WP_003903106.1.50081 WP_003903106.1.50122 WP_003903106.1.50126 WP_003903106.1.50149 WP_003903106.1.50162 WP_003903106.1.5018 WP_003903106.1.50194 WP_003903106.1.50218 WP_003903106.1.50235 WP_003903106.1.50249 WP_003903106.1.50265 WP_003903106.1.50271 WP_003903106.1.50324 WP_003903106.1.50347 WP_003903106.1.50372 WP_003903106.1.50398 WP_003903106.1.50407 WP_003903106.1.50444 WP_003903106.1.50466 WP_003903106.1.50472 WP_003903106.1.5048 WP_003903106.1.50498 WP_003903106.1.5050 WP_003903106.1.50540 WP_003903106.1.50554 WP_003903106.1.50557 WP_003903106.1.50601 WP_003903106.1.50610 WP_003903106.1.50632 WP_003903106.1.50633 WP_003903106.1.50642 WP_003903106.1.50655 WP_003903106.1.50659 WP_003903106.1.50683 WP_003903106.1.50689 WP_003903106.1.50692 WP_003903106.1.50714 WP_003903106.1.50729 WP_003903106.1.50756 WP_003903106.1.50784 WP_003903106.1.50794 WP_003903106.1.50841 WP_003903106.1.50860 WP_003903106.1.50877 WP_003903106.1.5096 WP_003903106.1.50981 WP_003903106.1.50987 WP_003903106.1.51003 WP_003903106.1.51009 WP_003903106.1.51037 WP_003903106.1.51074 WP_003903106.1.51082 WP_003903106.1.51101 WP_003903106.1.51116 WP_003903106.1.51149 WP_003903106.1.51156 WP_003903106.1.51157 WP_003903106.1.51213 WP_003903106.1.51232 WP_003903106.1.51239 WP_003903106.1.51247 WP_003903106.1.51266 WP_003903106.1.51279 WP_003903106.1.51291 WP_003903106.1.51294 WP_003903106.1.51301 WP_003903106.1.51329 WP_003903106.1.51391 WP_003903106.1.51422 WP_003903106.1.51445 WP_003903106.1.51455 WP_003903106.1.51466 WP_003903106.1.51468 WP_003903106.1.51478 WP_003903106.1.51497 WP_003903106.1.51520 WP_003903106.1.51593 WP_003903106.1.51628 WP_003903106.1.5164 WP_003903106.1.51647 WP_003903106.1.51660 WP_003903106.1.51696 WP_003903106.1.51721 WP_003903106.1.51788 WP_003903106.1.51795 WP_003903106.1.51801 WP_003903106.1.51817 WP_003903106.1.51819 WP_003903106.1.51854 WP_003903106.1.51923 WP_003903106.1.51942 WP_003903106.1.51948 WP_003903106.1.51963 WP_003903106.1.51969 WP_003903106.1.52000 WP_003903106.1.52001 WP_003903106.1.52003 WP_003903106.1.52006 WP_003903106.1.52036 WP_003903106.1.52038 WP_003903106.1.52046 WP_003903106.1.52059 WP_003903106.1.52069 WP_003903106.1.52082 WP_003903106.1.52102 WP_003903106.1.52106 WP_003903106.1.52166 WP_003903106.1.52168 WP_003903106.1.52173 WP_003903106.1.52178 WP_003903106.1.52206 WP_003903106.1.52216 WP_003903106.1.52238 WP_003903106.1.52241 WP_003903106.1.52280 WP_003903106.1.52314 WP_003903106.1.52385 WP_003903106.1.52390 WP_003903106.1.524 WP_003903106.1.52460 WP_003903106.1.52485 WP_003903106.1.52486 WP_003903106.1.52495 WP_003903106.1.52504 WP_003903106.1.52522 WP_003903106.1.52531 WP_003903106.1.52533 WP_003903106.1.52545 WP_003903106.1.52553 WP_003903106.1.52563 WP_003903106.1.52564 WP_003903106.1.52574 WP_003903106.1.52641 WP_003903106.1.52673 WP_003903106.1.52674 WP_003903106.1.52708 WP_003903106.1.52713 WP_003903106.1.52761 WP_003903106.1.52778 WP_003903106.1.52791 WP_003903106.1.52797 WP_003903106.1.52818 WP_003903106.1.52872 WP_003903106.1.52873 WP_003903106.1.52891 WP_003903106.1.52892 WP_003903106.1.52909 WP_003903106.1.52970 WP_003903106.1.52998 WP_003903106.1.53053 WP_003903106.1.53056 WP_003903106.1.5306 WP_003903106.1.53088 WP_003903106.1.5309 WP_003903106.1.531 WP_003903106.1.53117 WP_003903106.1.53118 WP_003903106.1.53142 WP_003903106.1.53143 WP_003903106.1.53157 WP_003903106.1.53167 WP_003903106.1.53200 WP_003903106.1.53204 WP_003903106.1.53213 WP_003903106.1.53217 WP_003903106.1.53226 WP_003903106.1.53229 WP_003903106.1.53230 WP_003903106.1.53237 WP_003903106.1.53254 WP_003903106.1.53257 WP_003903106.1.5327 WP_003903106.1.53276 WP_003903106.1.53278 WP_003903106.1.533 WP_003903106.1.53302 WP_003903106.1.53306 WP_003903106.1.5334 WP_003903106.1.5335 WP_003903106.1.53353 WP_003903106.1.53381 WP_003903106.1.53413 WP_003903106.1.53458 WP_003903106.1.53460 WP_003903106.1.53480 WP_003903106.1.53517 WP_003903106.1.53522 WP_003903106.1.53525 WP_003903106.1.53526 WP_003903106.1.53553 WP_003903106.1.53606 WP_003903106.1.53609 WP_003903106.1.53628 WP_003903106.1.53643 WP_003903106.1.53667 WP_003903106.1.53679 WP_003903106.1.53715 WP_003903106.1.53730 WP_003903106.1.53742 WP_003903106.1.53743 WP_003903106.1.53754 WP_003903106.1.53775 WP_003903106.1.53787 WP_003903106.1.53803 WP_003903106.1.53818 WP_003903106.1.53822 WP_003903106.1.53853 WP_003903106.1.53865 WP_003903106.1.53888 WP_003903106.1.53900 WP_003903106.1.53912 WP_003903106.1.53914 WP_003903106.1.53952 WP_003903106.1.53973 WP_003903106.1.5398 WP_003903106.1.5408 WP_003903106.1.54089 WP_003903106.1.54093 WP_003903106.1.54099 WP_003903106.1.54112 WP_003903106.1.54125 WP_003903106.1.54141 WP_003903106.1.54162 WP_003903106.1.54179 WP_003903106.1.54206 WP_003903106.1.54218 WP_003903106.1.54225 WP_003903106.1.54227 WP_003903106.1.54232 WP_003903106.1.54241 WP_003903106.1.54245 WP_003903106.1.54247 WP_003903106.1.54260 WP_003903106.1.54275 WP_003903106.1.54280 WP_003903106.1.5429 WP_003903106.1.54294 WP_003903106.1.54314 WP_003903106.1.54351 WP_003903106.1.54370 WP_003903106.1.54428 WP_003903106.1.54449 WP_003903106.1.54494 WP_003903106.1.54514 WP_003903106.1.54519 WP_003903106.1.5452 WP_003903106.1.54531 WP_003903106.1.54537 WP_003903106.1.54553 WP_003903106.1.54555 WP_003903106.1.54575 WP_003903106.1.54633 WP_003903106.1.54686 WP_003903106.1.54687 WP_003903106.1.54705 WP_003903106.1.54730 WP_003903106.1.54732 WP_003903106.1.5475 WP_003903106.1.54797 WP_003903106.1.54807 WP_003903106.1.54836 WP_003903106.1.54838 WP_003903106.1.54860 WP_003903106.1.54888 WP_003903106.1.54897 WP_003903106.1.54905 WP_003903106.1.54909 WP_003903106.1.54937 WP_003903106.1.54939 WP_003903106.1.54944 WP_003903106.1.54945 WP_003903106.1.54953 WP_003903106.1.54964 WP_003903106.1.55015 WP_003903106.1.55022 WP_003903106.1.55023 WP_003903106.1.55051 WP_003903106.1.55072 WP_003903106.1.55088 WP_003903106.1.55106 WP_003903106.1.55126 WP_003903106.1.55128 WP_003903106.1.55140 WP_003903106.1.55150 WP_003903106.1.55210 WP_003903106.1.55227 WP_003903106.1.55248 WP_003903106.1.55257 WP_003903106.1.55258 WP_003903106.1.55267 WP_003903106.1.55279 WP_003903106.1.55307 WP_003903106.1.55326 WP_003903106.1.55328 WP_003903106.1.5533 WP_003903106.1.55345 WP_003903106.1.55396 WP_003903106.1.55398 WP_003903106.1.55441 WP_003903106.1.55459 WP_003903106.1.55504 WP_003903106.1.55578 WP_003903106.1.55626 WP_003903106.1.55641 WP_003903106.1.5569 WP_003903106.1.55723 WP_003903106.1.55735 WP_003903106.1.5574 WP_003903106.1.55772 WP_003903106.1.55802 WP_003903106.1.55807 WP_003903106.1.55819 WP_003903106.1.55821 WP_003903106.1.5583 WP_003903106.1.55849 WP_003903106.1.55856 WP_003903106.1.55860 WP_003903106.1.55882 WP_003903106.1.55883 WP_003903106.1.55894 WP_003903106.1.55902 WP_003903106.1.55908 WP_003903106.1.55909 WP_003903106.1.5591 WP_003903106.1.55961 WP_003903106.1.55977 WP_003903106.1.55983 WP_003903106.1.56028 WP_003903106.1.56057 WP_003903106.1.56060 WP_003903106.1.56107 WP_003903106.1.56132 WP_003903106.1.56163 WP_003903106.1.56167 WP_003903106.1.56178 WP_003903106.1.56287 WP_003903106.1.56292 WP_003903106.1.56327 WP_003903106.1.56341 WP_003903106.1.56359 WP_003903106.1.56365 WP_003903106.1.56394 WP_003903106.1.56443 WP_003903106.1.56473 WP_003903106.1.56478 WP_003903106.1.56500 WP_003903106.1.56517 WP_003903106.1.56534 WP_003903106.1.5656 WP_003903106.1.56577 WP_003903106.1.56593 WP_003903106.1.56625 WP_003903106.1.56637 WP_003903106.1.56670 WP_003903106.1.56697 WP_003903106.1.567 WP_003903106.1.56701 WP_003903106.1.56709 WP_003903106.1.56743 WP_003903106.1.56755 WP_003903106.1.56764 WP_003903106.1.56769 WP_003903106.1.56770 WP_003903106.1.56795 WP_003903106.1.5681 WP_003903106.1.56827 WP_003903106.1.56839 WP_003903106.1.56863 WP_003903106.1.56868 WP_003903106.1.56869 WP_003903106.1.56915 WP_003903106.1.56926 WP_003903106.1.56961 WP_003903106.1.56971 WP_003903106.1.56972 WP_003903106.1.57023 WP_003903106.1.57035 WP_003903106.1.57077 WP_003903106.1.57087 WP_003903106.1.57094 WP_003903106.1.57134 WP_003903106.1.57151 WP_003903106.1.57169 WP_003903106.1.57208 WP_003903106.1.57212 WP_003903106.1.57230 WP_003903106.1.5724 WP_003903106.1.5725 WP_003903106.1.5727 WP_003903106.1.57273 WP_003903106.1.573 WP_003903106.1.57314 WP_003903106.1.57326 WP_003903106.1.57328 WP_003903106.1.57331 WP_003903106.1.57340 WP_003903106.1.57351 WP_003903106.1.57352 WP_003903106.1.57380 WP_003903106.1.57430 WP_003903106.1.5744 WP_003903106.1.57440 WP_003903106.1.5745 WP_003903106.1.57461 WP_003903106.1.57469 WP_003903106.1.57489 WP_003903106.1.575 WP_003903106.1.57509 WP_003903106.1.57519 WP_003903106.1.57525 WP_003903106.1.57551 WP_003903106.1.5758 WP_003903106.1.57596 WP_003903106.1.57604 WP_003903106.1.57617 WP_003903106.1.57619 WP_003903106.1.57627 WP_003903106.1.57642 WP_003903106.1.57658 WP_003903106.1.57667 WP_003903106.1.57675 WP_003903106.1.57689 WP_003903106.1.57708 WP_003903106.1.57794 WP_003903106.1.57821 WP_003903106.1.57825 WP_003903106.1.57843 WP_003903106.1.57906 WP_003903106.1.57924 WP_003903106.1.57926 WP_003903106.1.57930 WP_003903106.1.57957 WP_003903106.1.57960 WP_003903106.1.57964 WP_003903106.1.57991 WP_003903106.1.58086 WP_003903106.1.58103 WP_003903106.1.58108 WP_003903106.1.5811 WP_003903106.1.58121 WP_003903106.1.58145 WP_003903106.1.58164 WP_003903106.1.58174 WP_003903106.1.582 WP_003903106.1.58202 WP_003903106.1.58209 WP_003903106.1.58215 WP_003903106.1.5824 WP_003903106.1.58250 WP_003903106.1.58259 WP_003903106.1.58283 WP_003903106.1.58288 WP_003903106.1.5830 WP_003903106.1.58303 WP_003903106.1.58311 WP_003903106.1.58330 WP_003903106.1.58359 WP_003903106.1.58386 WP_003903106.1.58393 WP_003903106.1.58431 WP_003903106.1.5844 WP_003903106.1.58457 WP_003903106.1.58488 WP_003903106.1.58518 WP_003903106.1.58534 WP_003903106.1.58559 WP_003903106.1.58567 WP_003903106.1.58573 WP_003903106.1.58602 WP_003903106.1.58612 WP_003903106.1.58619 WP_003903106.1.58630 WP_003903106.1.5865 WP_003903106.1.58671 WP_003903106.1.58690 WP_003903106.1.58702 WP_003903106.1.58743 WP_003903106.1.58754 WP_003903106.1.5879 WP_003903106.1.5881 WP_003903106.1.58824 WP_003903106.1.58848 WP_003903106.1.58857 WP_003903106.1.58891 WP_003903106.1.58892 WP_003903106.1.5890 WP_003903106.1.58904 WP_003903106.1.58921 WP_003903106.1.58930 WP_003903106.1.58939 WP_003903106.1.58941 WP_003903106.1.58953 WP_003903106.1.58961 WP_003903106.1.5898 WP_003903106.1.59025 WP_003903106.1.59029 WP_003903106.1.59037 WP_003903106.1.59044 WP_003903106.1.59085 WP_003903106.1.59088 WP_003903106.1.59112 WP_003903106.1.59130 WP_003903106.1.5914 WP_003903106.1.59147 WP_003903106.1.59166 WP_003903106.1.59205 WP_003903106.1.59209 WP_003903106.1.59237 WP_003903106.1.59240 WP_003903106.1.59253 WP_003903106.1.59254 WP_003903106.1.59262 WP_003903106.1.59270 WP_003903106.1.5928 WP_003903106.1.59304 WP_003903106.1.59305 WP_003903106.1.59309 WP_003903106.1.59316 WP_003903106.1.59326 WP_003903106.1.59328 WP_003903106.1.59333 WP_003903106.1.59338 WP_003903106.1.59388 WP_003903106.1.59428 WP_003903106.1.59487 WP_003903106.1.59537 WP_003903106.1.59561 WP_003903106.1.59677 WP_003903106.1.59722 WP_003903106.1.59727 WP_003903106.1.59732 WP_003903106.1.59738 WP_003903106.1.59750 WP_003903106.1.59757 WP_003903106.1.59761 WP_003903106.1.59808 WP_003903106.1.59850 WP_003903106.1.59856 WP_003903106.1.59860 WP_003903106.1.59861 WP_003903106.1.5987 WP_003903106.1.59878 WP_003903106.1.59888 WP_003903106.1.59952 WP_003903106.1.5996 WP_003903106.1.59961 WP_003903106.1.59974 WP_003903106.1.6000 WP_003903106.1.60007 WP_003903106.1.60016 WP_003903106.1.6003 WP_003903106.1.60047 WP_003903106.1.6007 WP_003903106.1.60091 WP_003903106.1.60121 WP_003903106.1.60125 WP_003903106.1.60135 WP_003903106.1.60139 WP_003903106.1.60152 WP_003903106.1.60171 WP_003903106.1.60197 WP_003903106.1.6020 WP_003903106.1.60205 WP_003903106.1.60207 WP_003903106.1.60215 WP_003903106.1.60217 WP_003903106.1.60267 WP_003903106.1.60288 WP_003903106.1.60291 WP_003903106.1.60301 WP_003903106.1.60305 WP_003903106.1.60312 WP_003903106.1.60313 WP_003903106.1.60314 WP_003903106.1.60367 WP_003903106.1.60376 WP_003903106.1.60403 WP_003903106.1.60413 WP_003903106.1.60421 WP_003903106.1.60451 WP_003903106.1.60460 WP_003903106.1.60479 WP_003903106.1.60487 WP_003903106.1.60512 WP_003903106.1.60573 WP_003903106.1.60583 WP_003903106.1.60632 WP_003903106.1.60657 WP_003903106.1.60687 WP_003903106.1.60689 WP_003903106.1.60727 WP_003903106.1.60738 WP_003903106.1.60763 WP_003903106.1.6077 WP_003903106.1.60791 WP_003903106.1.60834 WP_003903106.1.60870 WP_003903106.1.60878 WP_003903106.1.60879 WP_003903106.1.60913 WP_003903106.1.60978 WP_003903106.1.61000 WP_003903106.1.61001 WP_003903106.1.61012 WP_003903106.1.61014 WP_003903106.1.61015 WP_003903106.1.61037 WP_003903106.1.61052 WP_003903106.1.61065 WP_003903106.1.61100 WP_003903106.1.61101 WP_003903106.1.61138 WP_003903106.1.61142 WP_003903106.1.61198 WP_003903106.1.612 WP_003903106.1.61234 WP_003903106.1.61281 WP_003903106.1.61314 WP_003903106.1.61321 WP_003903106.1.61326 WP_003903106.1.61328 WP_003903106.1.61368 WP_003903106.1.61391 WP_003903106.1.61406 WP_003903106.1.61409 WP_003903106.1.61420 WP_003903106.1.61422 WP_003903106.1.61425 WP_003903106.1.61428 WP_003903106.1.61469 WP_003903106.1.61494 WP_003903106.1.61522 WP_003903106.1.61552 WP_003903106.1.61557 WP_003903106.1.61567 WP_003903106.1.61571 WP_003903106.1.61573 WP_003903106.1.61584 WP_003903106.1.61586 WP_003903106.1.6159 WP_003903106.1.61592 WP_003903106.1.6160 WP_003903106.1.61614 WP_003903106.1.6163 WP_003903106.1.61655 WP_003903106.1.61665 WP_003903106.1.61669 WP_003903106.1.61682 WP_003903106.1.61692 WP_003903106.1.61719 WP_003903106.1.61728 WP_003903106.1.61750 WP_003903106.1.61754 WP_003903106.1.61755 WP_003903106.1.61757 WP_003903106.1.6179 WP_003903106.1.61793 WP_003903106.1.61816 WP_003903106.1.61842 WP_003903106.1.61850 WP_003903106.1.61862 WP_003903106.1.61865 WP_003903106.1.61868 WP_003903106.1.61911 WP_003903106.1.61925 WP_003903106.1.61941 WP_003903106.1.61953 WP_003903106.1.61979 WP_003903106.1.61986 WP_003903106.1.61987 WP_003903106.1.61998 WP_003903106.1.62021 WP_003903106.1.62087 WP_003903106.1.62089 WP_003903106.1.62101 WP_003903106.1.62104 WP_003903106.1.6211 WP_003903106.1.62132 WP_003903106.1.62162 WP_003903106.1.62225 WP_003903106.1.62230 WP_003903106.1.62238 WP_003903106.1.62249 WP_003903106.1.62270 WP_003903106.1.62281 WP_003903106.1.62307 WP_003903106.1.6231 WP_003903106.1.62359 WP_003903106.1.62371 WP_003903106.1.62379 WP_003903106.1.62395 WP_003903106.1.62408 WP_003903106.1.62449 WP_003903106.1.62468 WP_003903106.1.6248 WP_003903106.1.62508 WP_003903106.1.62565 WP_003903106.1.62594 WP_003903106.1.62606 WP_003903106.1.62616 WP_003903106.1.62666 WP_003903106.1.62687 WP_003903106.1.62715 WP_003903106.1.62730 WP_003903106.1.62738 WP_003903106.1.62761 WP_003903106.1.62766 WP_003903106.1.62786 WP_003903106.1.62813 WP_003903106.1.62839 WP_003903106.1.62841 WP_003903106.1.62909 WP_003903106.1.62936 WP_003903106.1.6294 WP_003903106.1.6295 WP_003903106.1.62962 WP_003903106.1.63007 WP_003903106.1.63019 WP_003903106.1.63032 WP_003903106.1.63037 WP_003903106.1.63064 WP_003903106.1.63066 WP_003903106.1.63072 WP_003903106.1.6308 WP_003903106.1.63081 WP_003903106.1.63096 WP_003903106.1.63106 WP_003903106.1.6314 WP_003903106.1.63144 WP_003903106.1.63154 WP_003903106.1.63160 WP_003903106.1.63166 WP_003903106.1.63194 WP_003903106.1.6322 WP_003903106.1.63222 WP_003903106.1.63247 WP_003903106.1.6328 WP_003903106.1.63291 WP_003903106.1.63312 WP_003903106.1.63317 WP_003903106.1.63331 WP_003903106.1.63373 WP_003903106.1.63384 WP_003903106.1.63403 WP_003903106.1.63424 WP_003903106.1.63428 WP_003903106.1.6345 WP_003903106.1.63464 WP_003903106.1.63483 WP_003903106.1.63502 WP_003903106.1.63504 WP_003903106.1.63522 WP_003903106.1.63530 WP_003903106.1.63538 WP_003903106.1.63564 WP_003903106.1.63567 WP_003903106.1.63596 WP_003903106.1.63600 WP_003903106.1.63623 WP_003903106.1.63624 WP_003903106.1.63625 WP_003903106.1.63627 WP_003903106.1.63654 WP_003903106.1.63662 WP_003903106.1.63711 WP_003903106.1.63734 WP_003903106.1.63807 WP_003903106.1.63819 WP_003903106.1.63844 WP_003903106.1.63888 WP_003903106.1.63913 WP_003903106.1.63915 WP_003903106.1.63918 WP_003903106.1.63961 WP_003903106.1.63970 WP_003903106.1.64000 WP_003903106.1.64027 WP_003903106.1.64058 WP_003903106.1.64065 WP_003903106.1.6407 WP_003903106.1.64082 WP_003903106.1.64091 WP_003903106.1.64102 WP_003903106.1.64104 WP_003903106.1.64119 WP_003903106.1.64169 WP_003903106.1.64219 WP_003903106.1.6422 WP_003903106.1.64222 WP_003903106.1.64223 WP_003903106.1.64228 WP_003903106.1.64235 WP_003903106.1.64249 WP_003903106.1.6427 WP_003903106.1.64278 WP_003903106.1.64287 WP_003903106.1.64414 WP_003903106.1.64419 WP_003903106.1.6443 WP_003903106.1.64463 WP_003903106.1.64480 WP_003903106.1.64497 WP_003903106.1.64506 WP_003903106.1.64511 WP_003903106.1.64513 WP_003903106.1.64514 WP_003903106.1.64515 WP_003903106.1.64522 WP_003903106.1.64526 WP_003903106.1.64543 WP_003903106.1.6456 WP_003903106.1.64567 WP_003903106.1.64588 WP_003903106.1.64589 WP_003903106.1.64594 WP_003903106.1.64595 WP_003903106.1.64608 WP_003903106.1.64619 WP_003903106.1.64629 WP_003903106.1.6464 WP_003903106.1.64664 WP_003903106.1.64669 WP_003903106.1.64672 WP_003903106.1.64680 WP_003903106.1.64682 WP_003903106.1.64727 WP_003903106.1.64729 WP_003903106.1.64774 WP_003903106.1.64776 WP_003903106.1.64802 WP_003903106.1.64832 WP_003903106.1.6486 WP_003903106.1.64870 WP_003903106.1.64898 WP_003903106.1.64922 WP_003903106.1.64924 WP_003903106.1.6493 WP_003903106.1.64937 WP_003903106.1.64941 WP_003903106.1.64973 WP_003903106.1.65001 WP_003903106.1.65026 WP_003903106.1.65053 WP_003903106.1.65070 WP_003903106.1.65079 WP_003903106.1.65102 WP_003903106.1.65157 WP_003903106.1.65181 WP_003903106.1.65212 WP_003903106.1.65229 WP_003903106.1.6523 WP_003903106.1.65253 WP_003903106.1.65289 WP_003903106.1.65291 WP_003903106.1.65315 WP_003903106.1.65329 WP_003903106.1.65359 WP_003903106.1.6536 WP_003903106.1.65374 WP_003903106.1.65386 WP_003903106.1.65414 WP_003903106.1.65416 WP_003903106.1.65433 WP_003903106.1.65455 WP_003903106.1.65467 WP_003903106.1.65488 WP_003903106.1.65529 WP_003903106.1.65539 WP_003903106.1.65583 WP_003903106.1.65612 WP_003903106.1.65623 WP_003903106.1.65635 WP_003903106.1.65637 WP_003903106.1.65648 WP_003903106.1.65683 WP_003903106.1.65686 WP_003903106.1.65688 WP_003903106.1.65707 WP_003903106.1.65733 WP_003903106.1.65746 WP_003903106.1.65747 WP_003903106.1.65759 WP_003903106.1.65816 WP_003903106.1.65830 WP_003903106.1.65858 WP_003903106.1.65862 WP_003903106.1.65869 WP_003903106.1.65893 WP_003903106.1.65929 WP_003903106.1.65958 WP_003903106.1.65974 WP_003903106.1.66004 WP_003903106.1.6606 WP_003903106.1.66089 WP_003903106.1.66149 WP_003903106.1.66151 WP_003903106.1.66229 WP_003903106.1.66276 WP_003903106.1.66293 WP_003903106.1.66297 WP_003903106.1.66323 WP_003903106.1.66325 WP_003903106.1.6633 WP_003903106.1.66334 WP_003903106.1.66355 WP_003903106.1.66367 WP_003903106.1.66394 WP_003903106.1.66396 WP_003903106.1.66451 WP_003903106.1.66455 WP_003903106.1.66457 WP_003903106.1.66464 WP_003903106.1.66466 WP_003903106.1.66487 WP_003903106.1.66504 WP_003903106.1.66544 WP_003903106.1.66558 WP_003903106.1.66580 WP_003903106.1.66582 WP_003903106.1.66612 WP_003903106.1.66615 WP_003903106.1.66617 WP_003903106.1.66635 WP_003903106.1.66656 WP_003903106.1.66663 WP_003903106.1.66675 WP_003903106.1.66715 WP_003903106.1.66718 WP_003903106.1.66762 WP_003903106.1.66776 WP_003903106.1.66808 WP_003903106.1.66817 WP_003903106.1.66819 WP_003903106.1.66826 WP_003903106.1.66830 WP_003903106.1.66842 WP_003903106.1.66868 WP_003903106.1.66878 WP_003903106.1.66880 WP_003903106.1.66893 WP_003903106.1.66961 WP_003903106.1.67005 WP_003903106.1.6704 WP_003903106.1.67044 WP_003903106.1.67061 WP_003903106.1.67098 WP_003903106.1.67146 WP_003903106.1.67197 WP_003903106.1.67198 WP_003903106.1.6720 WP_003903106.1.67207 WP_003903106.1.67218 WP_003903106.1.67220 WP_003903106.1.67225 WP_003903106.1.67231 WP_003903106.1.6724 WP_003903106.1.67257 WP_003903106.1.67298 WP_003903106.1.67307 WP_003903106.1.67324 WP_003903106.1.67332 WP_003903106.1.67346 WP_003903106.1.67354 WP_003903106.1.67360 WP_003903106.1.67381 WP_003903106.1.67396 WP_003903106.1.67417 WP_003903106.1.67422 WP_003903106.1.67453 WP_003903106.1.67459 WP_003903106.1.6746 WP_003903106.1.67473 WP_003903106.1.67481 WP_003903106.1.67482 WP_003903106.1.67496 WP_003903106.1.67499 WP_003903106.1.67516 WP_003903106.1.67523 WP_003903106.1.67536 WP_003903106.1.67575 WP_003903106.1.67587 WP_003903106.1.67598 WP_003903106.1.67600 WP_003903106.1.67602 WP_003903106.1.67630 WP_003903106.1.67679 WP_003903106.1.67692 WP_003903106.1.67744 WP_003903106.1.6775 WP_003903106.1.67750 WP_003903106.1.6777 WP_003903106.1.67809 WP_003903106.1.67816 WP_003903106.1.67844 WP_003903106.1.67848 WP_003903106.1.67870 WP_003903106.1.67888 WP_003903106.1.67915 WP_003903106.1.67945 WP_003903106.1.67949 WP_003903106.1.67980 WP_003903106.1.67982 WP_003903106.1.68022 WP_003903106.1.68029 WP_003903106.1.68037 WP_003903106.1.68038 WP_003903106.1.68045 WP_003903106.1.68057 WP_003903106.1.68083 WP_003903106.1.68088 WP_003903106.1.68106 WP_003903106.1.68110 WP_003903106.1.68153 WP_003903106.1.68164 WP_003903106.1.68169 WP_003903106.1.68193 WP_003903106.1.68212 WP_003903106.1.68227 WP_003903106.1.68243 WP_003903106.1.6825 WP_003903106.1.68297 WP_003903106.1.68309 WP_003903106.1.68325 WP_003903106.1.68329 WP_003903106.1.68340 WP_003903106.1.68384 WP_003903106.1.68388 WP_003903106.1.68429 WP_003903106.1.6843 WP_003903106.1.68433 WP_003903106.1.68444 WP_003903106.1.68465 WP_003903106.1.68484 WP_003903106.1.68518 WP_003903106.1.68569 WP_003903106.1.68576 WP_003903106.1.68580 WP_003903106.1.68586 WP_003903106.1.68623 WP_003903106.1.68624 WP_003903106.1.68637 WP_003903106.1.68646 WP_003903106.1.68667 WP_003903106.1.68669 WP_003903106.1.68672 WP_003903106.1.68684 WP_003903106.1.68704 WP_003903106.1.68708 WP_003903106.1.6872 WP_003903106.1.68730 WP_003903106.1.68734 WP_003903106.1.68748 WP_003903106.1.68754 WP_003903106.1.6876 WP_003903106.1.68761 WP_003903106.1.68763 WP_003903106.1.68766 WP_003903106.1.68774 WP_003903106.1.68796 WP_003903106.1.68824 WP_003903106.1.68832 WP_003903106.1.68833 WP_003903106.1.68841 WP_003903106.1.68859 WP_003903106.1.68876 WP_003903106.1.68906 WP_003903106.1.68916 WP_003903106.1.68923 WP_003903106.1.68945 WP_003903106.1.6896 WP_003903106.1.68981 WP_003903106.1.68984 WP_003903106.1.68997 WP_003903106.1.69008 WP_003903106.1.69076 WP_003903106.1.69079 WP_003903106.1.6908 WP_003903106.1.69082 WP_003903106.1.69178 WP_003903106.1.69208 WP_003903106.1.69231 WP_003903106.1.69256 WP_003903106.1.69311 WP_003903106.1.69315 WP_003903106.1.69322 WP_003903106.1.69342 WP_003903106.1.6935 WP_003903106.1.6936 WP_003903106.1.69369 WP_003903106.1.69374 WP_003903106.1.69398 WP_003903106.1.69401 WP_003903106.1.69426 WP_003903106.1.69427 WP_003903106.1.69429 WP_003903106.1.6949 WP_003903106.1.6951 WP_003903106.1.69511 WP_003903106.1.69526 WP_003903106.1.69528 WP_003903106.1.69547 WP_003903106.1.69573 WP_003903106.1.69581 WP_003903106.1.6960 WP_003903106.1.69617 WP_003903106.1.69634 WP_003903106.1.69647 WP_003903106.1.69659 WP_003903106.1.69673 WP_003903106.1.69682 WP_003903106.1.69684 WP_003903106.1.69686 WP_003903106.1.69707 WP_003903106.1.69709 WP_003903106.1.69723 WP_003903106.1.69736 WP_003903106.1.69778 WP_003903106.1.69800 WP_003903106.1.69802 WP_003903106.1.69845 WP_003903106.1.69870 WP_003903106.1.69873 WP_003903106.1.69898 WP_003903106.1.69913 WP_003903106.1.69925 WP_003903106.1.69931 WP_003903106.1.69938 WP_003903106.1.69955 WP_003903106.1.69957 WP_003903106.1.69981 WP_003903106.1.69990 WP_003903106.1.70 WP_003903106.1.70000 WP_003903106.1.70017 WP_003903106.1.70032 WP_003903106.1.70055 WP_003903106.1.70062 WP_003903106.1.70072 WP_003903106.1.70131 WP_003903106.1.70132 WP_003903106.1.7022 WP_003903106.1.70227 WP_003903106.1.70255 WP_003903106.1.70271 WP_003903106.1.70274 WP_003903106.1.7029 WP_003903106.1.70325 WP_003903106.1.70328 WP_003903106.1.70356 WP_003903106.1.70364 WP_003903106.1.70368 WP_003903106.1.70369 WP_003903106.1.70418 WP_003903106.1.70422 WP_003903106.1.70435 WP_003903106.1.70444 WP_003903106.1.70463 WP_003903106.1.70471 WP_003903106.1.70480 WP_003903106.1.70494 WP_003903106.1.70498 WP_003903106.1.70505 WP_003903106.1.70525 WP_003903106.1.70573 WP_003903106.1.70577 WP_003903106.1.70610 WP_003903106.1.70615 WP_003903106.1.70618 WP_003903106.1.70622 WP_003903106.1.70626 WP_003903106.1.70668 WP_003903106.1.70699 WP_003903106.1.70704 WP_003903106.1.70729 WP_003903106.1.70757 WP_003903106.1.70782 WP_003903106.1.70796 WP_003903106.1.70830 WP_003903106.1.70834 WP_003903106.1.7084 WP_003903106.1.70840 WP_003903106.1.70864 WP_003903106.1.70871 WP_003903106.1.70915 WP_003903106.1.70955 WP_003903106.1.70958 WP_003903106.1.70964 WP_003903106.1.70976 WP_003903106.1.71015 WP_003903106.1.71063 WP_003903106.1.71076 WP_003903106.1.71083 WP_003903106.1.7111 WP_003903106.1.71118 WP_003903106.1.71128 WP_003903106.1.7113 WP_003903106.1.71187 WP_003903106.1.71191 WP_003903106.1.71255 WP_003903106.1.71258 WP_003903106.1.71259 WP_003903106.1.71289 WP_003903106.1.71326 WP_003903106.1.71329 WP_003903106.1.71331 WP_003903106.1.71344 WP_003903106.1.71390 WP_003903106.1.71399 WP_003903106.1.71414 WP_003903106.1.71440 WP_003903106.1.71457 WP_003903106.1.7146 WP_003903106.1.71464 WP_003903106.1.71490 WP_003903106.1.71492 WP_003903106.1.71509 WP_003903106.1.71516 WP_003903106.1.71517 WP_003903106.1.71527 WP_003903106.1.71532 WP_003903106.1.71545 WP_003903106.1.71546 WP_003903106.1.71569 WP_003903106.1.71604 WP_003903106.1.71630 WP_003903106.1.71638 WP_003903106.1.71654 WP_003903106.1.71664 WP_003903106.1.71665 WP_003903106.1.71683 WP_003903106.1.71701 WP_003903106.1.71718 WP_003903106.1.71731 WP_003903106.1.71778 WP_003903106.1.71781 WP_003903106.1.71803 WP_003903106.1.71847 WP_003903106.1.7185 WP_003903106.1.71851 WP_003903106.1.71871 WP_003903106.1.71909 WP_003903106.1.71957 WP_003903106.1.71970 WP_003903106.1.72047 WP_003903106.1.72061 WP_003903106.1.72062 WP_003903106.1.72072 WP_003903106.1.72111 WP_003903106.1.72122 WP_003903106.1.72128 WP_003903106.1.72143 WP_003903106.1.7216 WP_003903106.1.72168 WP_003903106.1.72179 WP_003903106.1.72209 WP_003903106.1.72227 WP_003903106.1.7224 WP_003903106.1.72268 WP_003903106.1.72332 WP_003903106.1.72380 WP_003903106.1.72401 WP_003903106.1.72405 WP_003903106.1.72420 WP_003903106.1.72441 WP_003903106.1.72451 WP_003903106.1.72452 WP_003903106.1.72457 WP_003903106.1.72459 WP_003903106.1.72460 WP_003903106.1.72466 WP_003903106.1.72487 WP_003903106.1.72488 WP_003903106.1.72492 WP_003903106.1.72506 WP_003903106.1.72543 WP_003903106.1.7256 WP_003903106.1.72576 WP_003903106.1.72578 WP_003903106.1.72585 WP_003903106.1.72591 WP_003903106.1.72592 WP_003903106.1.72640 WP_003903106.1.72661 WP_003903106.1.72684 WP_003903106.1.72739 WP_003903106.1.72744 WP_003903106.1.72755 WP_003903106.1.72759 WP_003903106.1.72784 WP_003903106.1.72792 WP_003903106.1.72826 WP_003903106.1.72831 WP_003903106.1.72852 WP_003903106.1.72853 WP_003903106.1.72879 WP_003903106.1.72880 WP_003903106.1.72938 WP_003903106.1.72954 WP_003903106.1.72957 WP_003903106.1.72959 WP_003903106.1.72973 WP_003903106.1.7298 WP_003903106.1.72982 WP_003903106.1.72988 WP_003903106.1.72993 WP_003903106.1.73006 WP_003903106.1.73013 WP_003903106.1.73025 WP_003903106.1.73028 WP_003903106.1.73042 WP_003903106.1.73045 WP_003903106.1.73092 WP_003903106.1.73118 WP_003903106.1.7312 WP_003903106.1.73127 WP_003903106.1.73134 WP_003903106.1.73150 WP_003903106.1.73154 WP_003903106.1.73163 WP_003903106.1.73182 WP_003903106.1.73205 WP_003903106.1.7321 WP_003903106.1.73310 WP_003903106.1.73315 WP_003903106.1.73365 WP_003903106.1.73391 WP_003903106.1.73404 WP_003903106.1.73424 WP_003903106.1.73436 WP_003903106.1.73445 WP_003903106.1.73453 WP_003903106.1.73465 WP_003903106.1.73466 WP_003903106.1.73470 WP_003903106.1.73471 WP_003903106.1.73478 WP_003903106.1.73482 WP_003903106.1.73507 WP_003903106.1.73532 WP_003903106.1.73550 WP_003903106.1.73564 WP_003903106.1.73623 WP_003903106.1.73629 WP_003903106.1.73644 WP_003903106.1.7366 WP_003903106.1.73661 WP_003903106.1.7368 WP_003903106.1.73688 WP_003903106.1.73723 WP_003903106.1.73744 WP_003903106.1.73750 WP_003903106.1.73760 WP_003903106.1.73774 WP_003903106.1.7379 WP_003903106.1.73813 WP_003903106.1.73840 WP_003903106.1.73876 WP_003903106.1.7389 WP_003903106.1.73986 WP_003903106.1.74016 WP_003903106.1.74039 WP_003903106.1.74083 WP_003903106.1.74101 WP_003903106.1.74107 WP_003903106.1.74120 WP_003903106.1.74129 WP_003903106.1.74144 WP_003903106.1.7417 WP_003903106.1.74190 WP_003903106.1.74210 WP_003903106.1.7423 WP_003903106.1.74259 WP_003903106.1.74262 WP_003903106.1.74269 WP_003903106.1.74282 WP_003903106.1.74291 WP_003903106.1.74296 WP_003903106.1.74304 WP_003903106.1.7432 WP_003903106.1.74347 WP_003903106.1.7436 WP_003903106.1.74378 WP_003903106.1.74382 WP_003903106.1.74395 WP_003903106.1.74400 WP_003903106.1.74401 WP_003903106.1.74432 WP_003903106.1.74442 WP_003903106.1.74487 WP_003903106.1.74499 WP_003903106.1.74504 WP_003903106.1.74511 WP_003903106.1.74523 WP_003903106.1.74525 WP_003903106.1.74551 WP_003903106.1.74555 WP_003903106.1.74628 WP_003903106.1.74641 WP_003903106.1.74653 WP_003903106.1.74660 WP_003903106.1.74683 WP_003903106.1.7469 WP_003903106.1.74725 WP_003903106.1.74760 WP_003903106.1.74786 WP_003903106.1.74809 WP_003903106.1.74820 WP_003903106.1.74870 WP_003903106.1.74881 WP_003903106.1.74888 WP_003903106.1.74952 WP_003903106.1.7496 WP_003903106.1.74988 WP_003903106.1.75043 WP_003903106.1.75045 WP_003903106.1.75055 WP_003903106.1.75078 WP_003903106.1.75081 WP_003903106.1.75120 WP_003903106.1.75163 WP_003903106.1.75188 WP_003903106.1.75200 WP_003903106.1.75202 WP_003903106.1.75234 WP_003903106.1.75239 WP_003903106.1.75250 WP_003903106.1.75263 WP_003903106.1.75281 WP_003903106.1.75342 WP_003903106.1.7535 WP_003903106.1.75376 WP_003903106.1.75391 WP_003903106.1.75395 WP_003903106.1.75441 WP_003903106.1.75510 WP_003903106.1.75581 WP_003903106.1.75598 WP_003903106.1.75635 WP_003903106.1.75645 WP_003903106.1.75665 WP_003903106.1.75671 WP_003903106.1.75741 WP_003903106.1.75749 WP_003903106.1.75772 WP_003903106.1.75774 WP_003903106.1.75811 WP_003903106.1.75833 WP_003903106.1.7585 WP_003903106.1.75864 WP_003903106.1.75868 WP_003903106.1.75878 WP_003903106.1.75927 WP_003903106.1.75946 WP_003903106.1.75968 WP_003903106.1.75974 WP_003903106.1.76007 WP_003903106.1.76016 WP_003903106.1.76032 WP_003903106.1.76037 WP_003903106.1.7604 WP_003903106.1.76045 WP_003903106.1.76052 WP_003903106.1.76058 WP_003903106.1.76064 WP_003903106.1.76110 WP_003903106.1.76126 WP_003903106.1.76133 WP_003903106.1.76138 WP_003903106.1.76157 WP_003903106.1.76172 WP_003903106.1.76177 WP_003903106.1.76183 WP_003903106.1.76209 WP_003903106.1.76239 WP_003903106.1.76272 WP_003903106.1.76277 WP_003903106.1.76280 WP_003903106.1.76281 WP_003903106.1.76291 WP_003903106.1.76297 WP_003903106.1.76360 WP_003903106.1.76379 WP_003903106.1.76403 WP_003903106.1.76414 WP_003903106.1.76427 WP_003903106.1.76436 WP_003903106.1.76442 WP_003903106.1.76443 WP_003903106.1.76456 WP_003903106.1.76521 WP_003903106.1.76533 WP_003903106.1.76616 WP_003903106.1.76625 WP_003903106.1.76629 WP_003903106.1.76635 WP_003903106.1.76638 WP_003903106.1.76639 WP_003903106.1.76640 WP_003903106.1.76644 WP_003903106.1.76677 WP_003903106.1.76678 WP_003903106.1.76679 WP_003903106.1.76734 WP_003903106.1.76744 WP_003903106.1.76750 WP_003903106.1.76754 WP_003903106.1.76757 WP_003903106.1.76781 WP_003903106.1.76818 WP_003903106.1.76824 WP_003903106.1.76835 WP_003903106.1.76873 WP_003903106.1.76881 WP_003903106.1.76888 WP_003903106.1.76900 WP_003903106.1.7691 WP_003903106.1.76947 WP_003903106.1.76954 WP_003903106.1.76955 WP_003903106.1.76963 WP_003903106.1.770 WP_003903106.1.77000 WP_003903106.1.77008 WP_003903106.1.77021 WP_003903106.1.77056 WP_003903106.1.77065 WP_003903106.1.77075 WP_003903106.1.77107 WP_003903106.1.77115 WP_003903106.1.77118 WP_003903106.1.77125 WP_003903106.1.77141 WP_003903106.1.77142 WP_003903106.1.77250 WP_003903106.1.77252 WP_003903106.1.77260 WP_003903106.1.77266 WP_003903106.1.77280 WP_003903106.1.77285 WP_003903106.1.77312 WP_003903106.1.77348 WP_003903106.1.77351 WP_003903106.1.77352 WP_003903106.1.77361 WP_003903106.1.774 WP_003903106.1.7740 WP_003903106.1.77404 WP_003903106.1.77425 WP_003903106.1.77463 WP_003903106.1.77474 WP_003903106.1.7748 WP_003903106.1.77484 WP_003903106.1.77491 WP_003903106.1.77499 WP_003903106.1.77510 WP_003903106.1.77530 WP_003903106.1.77554 WP_003903106.1.77559 WP_003903106.1.77599 WP_003903106.1.77605 WP_003903106.1.7762 WP_003903106.1.77627 WP_003903106.1.77649 WP_003903106.1.77654 WP_003903106.1.7766 WP_003903106.1.77667 WP_003903106.1.77704 WP_003903106.1.77706 WP_003903106.1.77726 WP_003903106.1.77774 WP_003903106.1.7778 WP_003903106.1.77790 WP_003903106.1.77809 WP_003903106.1.77820 WP_003903106.1.77843 WP_003903106.1.77855 WP_003903106.1.77865 WP_003903106.1.77868 WP_003903106.1.77890 WP_003903106.1.77909 WP_003903106.1.77911 WP_003903106.1.77931 WP_003903106.1.77984 WP_003903106.1.78020 WP_003903106.1.78024 WP_003903106.1.78075 WP_003903106.1.78084 WP_003903106.1.78086 WP_003903106.1.7809 WP_003903106.1.78098 WP_003903106.1.78105 WP_003903106.1.78113 WP_003903106.1.78136 WP_003903106.1.78162 WP_003903106.1.7817 WP_003903106.1.78200 WP_003903106.1.78216 WP_003903106.1.78236 WP_003903106.1.78238 WP_003903106.1.78322 WP_003903106.1.78338 WP_003903106.1.7836 WP_003903106.1.78360 WP_003903106.1.78386 WP_003903106.1.78435 WP_003903106.1.7844 WP_003903106.1.78459 WP_003903106.1.78488 WP_003903106.1.7849 WP_003903106.1.78499 WP_003903106.1.785 WP_003903106.1.78516 WP_003903106.1.78524 WP_003903106.1.78526 WP_003903106.1.78538 WP_003903106.1.78545 WP_003903106.1.78547 WP_003903106.1.78574 WP_003903106.1.78580 WP_003903106.1.7860 WP_003903106.1.78620 WP_003903106.1.78646 WP_003903106.1.78648 WP_003903106.1.78649 WP_003903106.1.78655 WP_003903106.1.78657 WP_003903106.1.78659 WP_003903106.1.7869 WP_003903106.1.78692 WP_003903106.1.78760 WP_003903106.1.78766 WP_003903106.1.78776 WP_003903106.1.78778 WP_003903106.1.78784 WP_003903106.1.78788 WP_003903106.1.78790 WP_003903106.1.78793 WP_003903106.1.78860 WP_003903106.1.7887 WP_003903106.1.78884 WP_003903106.1.78932 WP_003903106.1.78969 WP_003903106.1.78977 WP_003903106.1.78980 WP_003903106.1.79005 WP_003903106.1.79016 WP_003903106.1.79064 WP_003903106.1.79066 WP_003903106.1.79068 WP_003903106.1.79077 WP_003903106.1.79095 WP_003903106.1.79112 WP_003903106.1.79122 WP_003903106.1.79145 WP_003903106.1.79152 WP_003903106.1.79163 WP_003903106.1.79182 WP_003903106.1.79198 WP_003903106.1.79213 WP_003903106.1.79218 WP_003903106.1.79268 WP_003903106.1.79273 WP_003903106.1.79278 WP_003903106.1.79290 WP_003903106.1.79319 WP_003903106.1.79326 WP_003903106.1.7933 WP_003903106.1.79330 WP_003903106.1.79339 WP_003903106.1.79394 WP_003903106.1.79399 WP_003903106.1.79413 WP_003903106.1.79422 WP_003903106.1.79445 WP_003903106.1.79447 WP_003903106.1.79455 WP_003903106.1.79471 WP_003903106.1.79480 WP_003903106.1.79482 WP_003903106.1.79488 WP_003903106.1.79500 WP_003903106.1.79502 WP_003903106.1.79508 WP_003903106.1.79514 WP_003903106.1.79561 WP_003903106.1.79565 WP_003903106.1.79578 WP_003903106.1.79588 WP_003903106.1.79598 WP_003903106.1.79615 WP_003903106.1.79684 WP_003903106.1.79698 WP_003903106.1.797 WP_003903106.1.79744 WP_003903106.1.79784 WP_003903106.1.79802 WP_003903106.1.79806 WP_003903106.1.79819 WP_003903106.1.79826 WP_003903106.1.79828 WP_003903106.1.79851 WP_003903106.1.79853 WP_003903106.1.79863 WP_003903106.1.79881 WP_003903106.1.79885 WP_003903106.1.79898 WP_003903106.1.7990 WP_003903106.1.79900 WP_003903106.1.79913 WP_003903106.1.79918 WP_003903106.1.79947 WP_003903106.1.79948 WP_003903106.1.7995 WP_003903106.1.7997 WP_003903106.1.80004 WP_003903106.1.80015 WP_003903106.1.80022 WP_003903106.1.80030 WP_003903106.1.80054 WP_003903106.1.80084 WP_003903106.1.80099 WP_003903106.1.80129 WP_003903106.1.80177 WP_003903106.1.80234 WP_003903106.1.8026 WP_003903106.1.80275 WP_003903106.1.8029 WP_003903106.1.80299 WP_003903106.1.80300 WP_003903106.1.80304 WP_003903106.1.80326 WP_003903106.1.80351 WP_003903106.1.8037 WP_003903106.1.80370 WP_003903106.1.80387 WP_003903106.1.80399 WP_003903106.1.8044 WP_003903106.1.80451 WP_003903106.1.80458 WP_003903106.1.80461 WP_003903106.1.80490 WP_003903106.1.80503 WP_003903106.1.80507 WP_003903106.1.80552 WP_003903106.1.80576 WP_003903106.1.80599 WP_003903106.1.8060 WP_003903106.1.80624 WP_003903106.1.80636 WP_003903106.1.80669 WP_003903106.1.80673 WP_003903106.1.80711 WP_003903106.1.80714 WP_003903106.1.80743 WP_003903106.1.80784 WP_003903106.1.80815 WP_003903106.1.80853 WP_003903106.1.80918 WP_003903106.1.8093 WP_003903106.1.80967 WP_003903106.1.8097 WP_003903106.1.80988 WP_003903106.1.81007 WP_003903106.1.81013 WP_003903106.1.8105 WP_003903106.1.81059 WP_003903106.1.81063 WP_003903106.1.81066 WP_003903106.1.81075 WP_003903106.1.81091 WP_003903106.1.81119 WP_003903106.1.81125 WP_003903106.1.81136 WP_003903106.1.8114 WP_003903106.1.81189 WP_003903106.1.81192 WP_003903106.1.812 WP_003903106.1.81230 WP_003903106.1.81249 WP_003903106.1.81250 WP_003903106.1.81264 WP_003903106.1.8128 WP_003903106.1.81287 WP_003903106.1.81297 WP_003903106.1.8138 WP_003903106.1.81407 WP_003903106.1.8143 WP_003903106.1.81439 WP_003903106.1.81465 WP_003903106.1.81505 WP_003903106.1.81529 WP_003903106.1.81538 WP_003903106.1.81541 WP_003903106.1.81560 WP_003903106.1.81561 WP_003903106.1.81567 WP_003903106.1.81583 WP_003903106.1.81686 WP_003903106.1.81712 WP_003903106.1.81720 WP_003903106.1.81731 WP_003903106.1.81774 WP_003903106.1.81788 WP_003903106.1.81820 WP_003903106.1.81850 WP_003903106.1.81883 WP_003903106.1.81891 WP_003903106.1.81911 WP_003903106.1.81918 WP_003903106.1.82011 WP_003903106.1.82048 WP_003903106.1.82069 WP_003903106.1.82071 WP_003903106.1.82108 WP_003903106.1.82136 WP_003903106.1.82142 WP_003903106.1.8215 WP_003903106.1.82158 WP_003903106.1.8217 WP_003903106.1.82209 WP_003903106.1.82210 WP_003903106.1.82228 WP_003903106.1.82236 WP_003903106.1.82251 WP_003903106.1.82271 WP_003903106.1.82305 WP_003903106.1.82307 WP_003903106.1.82309 WP_003903106.1.82317 WP_003903106.1.8232 WP_003903106.1.82346 WP_003903106.1.82374 WP_003903106.1.82385 WP_003903106.1.82429 WP_003903106.1.82460 WP_003903106.1.82462 WP_003903106.1.82483 WP_003903106.1.82494 WP_003903106.1.82531 WP_003903106.1.82546 WP_003903106.1.82547 WP_003903106.1.82549 WP_003903106.1.82577 WP_003903106.1.82592 WP_003903106.1.82597 WP_003903106.1.82598 WP_003903106.1.82625 WP_003903106.1.82642 WP_003903106.1.82651 WP_003903106.1.82653 WP_003903106.1.82681 WP_003903106.1.82685 WP_003903106.1.8271 WP_003903106.1.82712 WP_003903106.1.8273 WP_003903106.1.82743 WP_003903106.1.82757 WP_003903106.1.82774 WP_003903106.1.82803 WP_003903106.1.82836 WP_003903106.1.82860 WP_003903106.1.82871 WP_003903106.1.82892 WP_003903106.1.82935 WP_003903106.1.82957 WP_003903106.1.82973 WP_003903106.1.82981 WP_003903106.1.82983 WP_003903106.1.83004 WP_003903106.1.83009 WP_003903106.1.83044 WP_003903106.1.83074 WP_003903106.1.83110 WP_003903106.1.83146 WP_003903106.1.83149 WP_003903106.1.83159 WP_003903106.1.8317 WP_003903106.1.83173 WP_003903106.1.83181 WP_003903106.1.83182 WP_003903106.1.83191 WP_003903106.1.83197 WP_003903106.1.83212 WP_003903106.1.8326 WP_003903106.1.83262 WP_003903106.1.83273 WP_003903106.1.83309 WP_003903106.1.83332 WP_003903106.1.83334 WP_003903106.1.83341 WP_003903106.1.83349 WP_003903106.1.8335 WP_003903106.1.83353 WP_003903106.1.83367 WP_003903106.1.83380 WP_003903106.1.83381 WP_003903106.1.83389 WP_003903106.1.83408 WP_003903106.1.83409 WP_003903106.1.83435 WP_003903106.1.83470 WP_003903106.1.83524 WP_003903106.1.83526 WP_003903106.1.8358 WP_003903106.1.83589 WP_003903106.1.83601 WP_003903106.1.83611 WP_003903106.1.83638 WP_003903106.1.83656 WP_003903106.1.83667 WP_003903106.1.83689 WP_003903106.1.83692 WP_003903106.1.83705 WP_003903106.1.83766 WP_003903106.1.83793 WP_003903106.1.83794 WP_003903106.1.83802 WP_003903106.1.83805 WP_003903106.1.83839 WP_003903106.1.83842 WP_003903106.1.83850 WP_003903106.1.83861 WP_003903106.1.83884 WP_003903106.1.83920 WP_003903106.1.83929 WP_003903106.1.83930 WP_003903106.1.83975 WP_003903106.1.83991 WP_003903106.1.8400 WP_003903106.1.84027 WP_003903106.1.8404 WP_003903106.1.84057 WP_003903106.1.84070 WP_003903106.1.8409 WP_003903106.1.84112 WP_003903106.1.84146 WP_003903106.1.8415 WP_003903106.1.84176 WP_003903106.1.84186 WP_003903106.1.84192 WP_003903106.1.84228 WP_003903106.1.8424 WP_003903106.1.84244 WP_003903106.1.84259 WP_003903106.1.8426 WP_003903106.1.84277 WP_003903106.1.84287 WP_003903106.1.8434 WP_003903106.1.84388 WP_003903106.1.84408 WP_003903106.1.84409 WP_003903106.1.84438 WP_003903106.1.84460 WP_003903106.1.84488 WP_003903106.1.84504 WP_003903106.1.84525 WP_003903106.1.84620 WP_003903106.1.84623 WP_003903106.1.84641 WP_003903106.1.84655 WP_003903106.1.84666 WP_003903106.1.84670 WP_003903106.1.84739 WP_003903106.1.84748 WP_003903106.1.84766 WP_003903106.1.84772 WP_003903106.1.84774 WP_003903106.1.848 WP_003903106.1.84812 WP_003903106.1.84836 WP_003903106.1.84839 WP_003903106.1.84846 WP_003903106.1.84873 WP_003903106.1.84938 WP_003903106.1.84968 WP_003903106.1.84973 WP_003903106.1.84981 WP_003903106.1.84985 WP_003903106.1.8503 WP_003903106.1.85038 WP_003903106.1.85041 WP_003903106.1.85043 WP_003903106.1.8505 WP_003903106.1.85074 WP_003903106.1.8509 WP_003903106.1.8512 WP_003903106.1.85148 WP_003903106.1.8518 WP_003903106.1.8522 WP_003903106.1.85242 WP_003903106.1.85276 WP_003903106.1.85281 WP_003903106.1.85284 WP_003903106.1.85314 WP_003903106.1.85319 WP_003903106.1.85330 WP_003903106.1.85341 WP_003903106.1.85346 WP_003903106.1.8535 WP_003903106.1.85363 WP_003903106.1.85371 WP_003903106.1.85377 WP_003903106.1.85387 WP_003903106.1.85399 WP_003903106.1.85458 WP_003903106.1.8546 WP_003903106.1.85464 WP_003903106.1.85478 WP_003903106.1.85480 WP_003903106.1.85488 WP_003903106.1.85495 WP_003903106.1.85551 WP_003903106.1.85557 WP_003903106.1.85577 WP_003903106.1.85597 WP_003903106.1.85599 WP_003903106.1.85610 WP_003903106.1.8563 WP_003903106.1.85648 WP_003903106.1.85679 WP_003903106.1.85704 WP_003903106.1.85717 WP_003903106.1.85727 WP_003903106.1.85737 WP_003903106.1.85763 WP_003903106.1.85808 WP_003903106.1.85819 WP_003903106.1.85820 WP_003903106.1.85823 WP_003903106.1.85832 WP_003903106.1.8586 WP_003903106.1.85872 WP_003903106.1.85894 WP_003903106.1.85909 WP_003903106.1.85913 WP_003903106.1.85953 WP_003903106.1.85986 WP_003903106.1.86000 WP_003903106.1.86024 WP_003903106.1.86025 WP_003903106.1.86032 WP_003903106.1.86048 WP_003903106.1.86052 WP_003903106.1.86067 WP_003903106.1.86103 WP_003903106.1.86122 WP_003903106.1.86124 WP_003903106.1.86160 WP_003903106.1.86164 WP_003903106.1.86168 WP_003903106.1.86190 WP_003903106.1.86204 WP_003903106.1.86208 WP_003903106.1.86235 WP_003903106.1.86249 WP_003903106.1.86260 WP_003903106.1.86290 WP_003903106.1.863 WP_003903106.1.86327 WP_003903106.1.86334 WP_003903106.1.86337 WP_003903106.1.86368 WP_003903106.1.86377 WP_003903106.1.86425 WP_003903106.1.86459 WP_003903106.1.8649 WP_003903106.1.86499 WP_003903106.1.86520 WP_003903106.1.86561 WP_003903106.1.86568 WP_003903106.1.86575 WP_003903106.1.86584 WP_003903106.1.86605 WP_003903106.1.86626 WP_003903106.1.86648 WP_003903106.1.8666 WP_003903106.1.86684 WP_003903106.1.86696 WP_003903106.1.86705 WP_003903106.1.86718 WP_003903106.1.86725 WP_003903106.1.86757 WP_003903106.1.86766 WP_003903106.1.86801 WP_003903106.1.86814 WP_003903106.1.86820 WP_003903106.1.86825 WP_003903106.1.86834 WP_003903106.1.8685 WP_003903106.1.86851 WP_003903106.1.86855 WP_003903106.1.86867 WP_003903106.1.86877 WP_003903106.1.86883 WP_003903106.1.8689 WP_003903106.1.86892 WP_003903106.1.86933 WP_003903106.1.86941 WP_003903106.1.86950 WP_003903106.1.86962 WP_003903106.1.86963 WP_003903106.1.86979 WP_003903106.1.8700 WP_003903106.1.87001 WP_003903106.1.87002 WP_003903106.1.87031 WP_003903106.1.87116 WP_003903106.1.87117 WP_003903106.1.8714 WP_003903106.1.87162 WP_003903106.1.87178 WP_003903106.1.87191 WP_003903106.1.87201 WP_003903106.1.87209 WP_003903106.1.87240 WP_003903106.1.87266 WP_003903106.1.87273 WP_003903106.1.87275 WP_003903106.1.8733 WP_003903106.1.87345 WP_003903106.1.87369 WP_003903106.1.8737 WP_003903106.1.87401 WP_003903106.1.87404 WP_003903106.1.87406 WP_003903106.1.87409 WP_003903106.1.87444 WP_003903106.1.87446 WP_003903106.1.87459 WP_003903106.1.87472 WP_003903106.1.87489 WP_003903106.1.87494 WP_003903106.1.87496 WP_003903106.1.87582 WP_003903106.1.87588 WP_003903106.1.87617 WP_003903106.1.87619 WP_003903106.1.87620 WP_003903106.1.87634 WP_003903106.1.87643 WP_003903106.1.8765 WP_003903106.1.87650 WP_003903106.1.87654 WP_003903106.1.87658 WP_003903106.1.87665 WP_003903106.1.87676 WP_003903106.1.87677 WP_003903106.1.87684 WP_003903106.1.87692 WP_003903106.1.87707 WP_003903106.1.87732 WP_003903106.1.87784 WP_003903106.1.87796 WP_003903106.1.87809 WP_003903106.1.87817 WP_003903106.1.87827 WP_003903106.1.87831 WP_003903106.1.87835 WP_003903106.1.87837 WP_003903106.1.87866 WP_003903106.1.8789 WP_003903106.1.87911 WP_003903106.1.87924 WP_003903106.1.87951 WP_003903106.1.87955 WP_003903106.1.87956 WP_003903106.1.87991 WP_003903106.1.88 WP_003903106.1.88002 WP_003903106.1.88037 WP_003903106.1.88039 WP_003903106.1.88072 WP_003903106.1.88077 WP_003903106.1.88121 WP_003903106.1.88180 WP_003903106.1.88191 WP_003903106.1.88205 WP_003903106.1.88217 WP_003903106.1.88219 WP_003903106.1.88245 WP_003903106.1.88253 WP_003903106.1.88294 WP_003903106.1.88315 WP_003903106.1.88316 WP_003903106.1.88320 WP_003903106.1.88338 WP_003903106.1.8840 WP_003903106.1.88437 WP_003903106.1.88453 WP_003903106.1.88469 WP_003903106.1.88489 WP_003903106.1.88507 WP_003903106.1.88521 WP_003903106.1.88530 WP_003903106.1.88537 WP_003903106.1.88541 WP_003903106.1.88592 WP_003903106.1.88616 WP_003903106.1.88618 WP_003903106.1.8862 WP_003903106.1.88625 WP_003903106.1.88632 WP_003903106.1.88634 WP_003903106.1.88649 WP_003903106.1.8870 WP_003903106.1.88737 WP_003903106.1.88756 WP_003903106.1.888 WP_003903106.1.88824 WP_003903106.1.88886 WP_003903106.1.88965 WP_003903106.1.88985 WP_003903106.1.8902 WP_003903106.1.89025 WP_003903106.1.89041 WP_003903106.1.89046 WP_003903106.1.89082 WP_003903106.1.89162 WP_003903106.1.89168 WP_003903106.1.8917 WP_003903106.1.89193 WP_003903106.1.89205 WP_003903106.1.89207 WP_003903106.1.89225 WP_003903106.1.8925 WP_003903106.1.89277 WP_003903106.1.89286 WP_003903106.1.89293 WP_003903106.1.89320 WP_003903106.1.8935 WP_003903106.1.89371 WP_003903106.1.89378 WP_003903106.1.89392 WP_003903106.1.89406 WP_003903106.1.89451 WP_003903106.1.89453 WP_003903106.1.89473 WP_003903106.1.89475 WP_003903106.1.89483 WP_003903106.1.895 WP_003903106.1.89513 WP_003903106.1.89517 WP_003903106.1.89522 WP_003903106.1.8954 WP_003903106.1.89543 WP_003903106.1.89567 WP_003903106.1.8957 WP_003903106.1.89572 WP_003903106.1.89589 WP_003903106.1.89607 WP_003903106.1.89613 WP_003903106.1.89625 WP_003903106.1.89648 WP_003903106.1.8967 WP_003903106.1.89670 WP_003903106.1.89676 WP_003903106.1.89729 WP_003903106.1.89739 WP_003903106.1.89762 WP_003903106.1.8977 WP_003903106.1.89808 WP_003903106.1.8982 WP_003903106.1.89829 WP_003903106.1.89831 WP_003903106.1.89844 WP_003903106.1.89849 WP_003903106.1.8989 WP_003903106.1.89901 WP_003903106.1.89903 WP_003903106.1.89909 WP_003903106.1.8992 WP_003903106.1.89922 WP_003903106.1.89926 WP_003903106.1.89963 WP_003903106.1.89971 WP_003903106.1.8998 WP_003903106.1.89987 WP_003903106.1.900 WP_003903106.1.90048 WP_003903106.1.9007 WP_003903106.1.90080 WP_003903106.1.90130 WP_003903106.1.90134 WP_003903106.1.90137 WP_003903106.1.90157 WP_003903106.1.90184 WP_003903106.1.90199 WP_003903106.1.90231 WP_003903106.1.90245 WP_003903106.1.90308 WP_003903106.1.90322 WP_003903106.1.90328 WP_003903106.1.90372 WP_003903106.1.90439 WP_003903106.1.90481 WP_003903106.1.90499 WP_003903106.1.9050 WP_003903106.1.90527 WP_003903106.1.90550 WP_003903106.1.90560 WP_003903106.1.90612 WP_003903106.1.90640 WP_003903106.1.90672 WP_003903106.1.90687 WP_003903106.1.90691 WP_003903106.1.90711 WP_003903106.1.90722 WP_003903106.1.90744 WP_003903106.1.9075 WP_003903106.1.90756 WP_003903106.1.90767 WP_003903106.1.90771 WP_003903106.1.90785 WP_003903106.1.90788 WP_003903106.1.90800 WP_003903106.1.90810 WP_003903106.1.90816 WP_003903106.1.90819 WP_003903106.1.9082 WP_003903106.1.90831 WP_003903106.1.90884 WP_003903106.1.90899 WP_003903106.1.90906 WP_003903106.1.90958 WP_003903106.1.90976 WP_003903106.1.90977 WP_003903106.1.90987 WP_003903106.1.9102 WP_003903106.1.91026 WP_003903106.1.91032 WP_003903106.1.91043 WP_003903106.1.91053 WP_003903106.1.91082 WP_003903106.1.91106 WP_003903106.1.91112 WP_003903106.1.91144 WP_003903106.1.91151 WP_003903106.1.91157 WP_003903106.1.91167 WP_003903106.1.91169 WP_003903106.1.91192 WP_003903106.1.91201 WP_003903106.1.91207 WP_003903106.1.91208 WP_003903106.1.91211 WP_003903106.1.91214 WP_003903106.1.91230 WP_003903106.1.91244 WP_003903106.1.91251 WP_003903106.1.91260 WP_003903106.1.91265 WP_003903106.1.91284 WP_003903106.1.91294 WP_003903106.1.91303 WP_003903106.1.91322 WP_003903106.1.91352 WP_003903106.1.91386 WP_003903106.1.9139 WP_003903106.1.91398 WP_003903106.1.91430 WP_003903106.1.91436 WP_003903106.1.91483 WP_003903106.1.91496 WP_003903106.1.91507 WP_003903106.1.91576 WP_003903106.1.91589 WP_003903106.1.91694 WP_003903106.1.91695 WP_003903106.1.91713 WP_003903106.1.91716 WP_003903106.1.91717 WP_003903106.1.91728 WP_003903106.1.91743 WP_003903106.1.91759 WP_003903106.1.91784 WP_003903106.1.91785 WP_003903106.1.91786 WP_003903106.1.91802 WP_003903106.1.91822 WP_003903106.1.91828 WP_003903106.1.9189 WP_003903106.1.91896 WP_003903106.1.9190 WP_003903106.1.91915 WP_003903106.1.91931 WP_003903106.1.91937 WP_003903106.1.91944 WP_003903106.1.91953 WP_003903106.1.91957 WP_003903106.1.91976 WP_003903106.1.91978 WP_003903106.1.92021 WP_003903106.1.92083 WP_003903106.1.92127 WP_003903106.1.92144 WP_003903106.1.92150 WP_003903106.1.92153 WP_003903106.1.92190 WP_003903106.1.92192 WP_003903106.1.92200 WP_003903106.1.92220 WP_003903106.1.92221 WP_003903106.1.92222 WP_003903106.1.92273 WP_003903106.1.92289 WP_003903106.1.9229 WP_003903106.1.92294 WP_003903106.1.92300 WP_003903106.1.92317 WP_003903106.1.92334 WP_003903106.1.92338 WP_003903106.1.92345 WP_003903106.1.92356 WP_003903106.1.92364 WP_003903106.1.92380 WP_003903106.1.92416 WP_003903106.1.92428 WP_003903106.1.92447 WP_003903106.1.92456 WP_003903106.1.92467 WP_003903106.1.92471 WP_003903106.1.92490 WP_003903106.1.92508 WP_003903106.1.9251 WP_003903106.1.92511 WP_003903106.1.92523 WP_003903106.1.92527 WP_003903106.1.92536 WP_003903106.1.92592 WP_003903106.1.92603 WP_003903106.1.92606 WP_003903106.1.92610 WP_003903106.1.92613 WP_003903106.1.9263 WP_003903106.1.9265 WP_003903106.1.92650 WP_003903106.1.92660 WP_003903106.1.92677 WP_003903106.1.92685 WP_003903106.1.92689 WP_003903106.1.92690 WP_003903106.1.92706 WP_003903106.1.92714 WP_003903106.1.92736 WP_003903106.1.9274 WP_003903106.1.92752 WP_003903106.1.92760 WP_003903106.1.92777 WP_003903106.1.92803 WP_003903106.1.92833 WP_003903106.1.92856 WP_003903106.1.92881 WP_003903106.1.92892 WP_003903106.1.92907 WP_003903106.1.92908 WP_003903106.1.9291 WP_003903106.1.92917 WP_003903106.1.92996 WP_003903106.1.93006 WP_003903106.1.93009 WP_003903106.1.93015 WP_003903106.1.93043 WP_003903106.1.9307 WP_003903106.1.93083 WP_003903106.1.93097 WP_003903106.1.93137 WP_003903106.1.93192 WP_003903106.1.93199 WP_003903106.1.93203 WP_003903106.1.93212 WP_003903106.1.93234 WP_003903106.1.93245 WP_003903106.1.93257 WP_003903106.1.93265 WP_003903106.1.93297 WP_003903106.1.93320 WP_003903106.1.93328 WP_003903106.1.93337 WP_003903106.1.93343 WP_003903106.1.93349 WP_003903106.1.93363 WP_003903106.1.93377 WP_003903106.1.9338 WP_003903106.1.93407 WP_003903106.1.93417 WP_003903106.1.93419 WP_003903106.1.93426 WP_003903106.1.9344 WP_003903106.1.93443 WP_003903106.1.93447 WP_003903106.1.93470 WP_003903106.1.93483 WP_003903106.1.93487 WP_003903106.1.93495 WP_003903106.1.93499 WP_003903106.1.93516 WP_003903106.1.93536 WP_003903106.1.93544 WP_003903106.1.93555 WP_003903106.1.93560 WP_003903106.1.93564 WP_003903106.1.9357 WP_003903106.1.93573 WP_003903106.1.93576 WP_003903106.1.93588 WP_003903106.1.9363 WP_003903106.1.93645 WP_003903106.1.93649 WP_003903106.1.93659 WP_003903106.1.93677 WP_003903106.1.9368 WP_003903106.1.93689 WP_003903106.1.93693 WP_003903106.1.93698 WP_003903106.1.93706 WP_003903106.1.9371 WP_003903106.1.93792 WP_003903106.1.93823 WP_003903106.1.93871 WP_003903106.1.9388 WP_003903106.1.93894 WP_003903106.1.93903 WP_003903106.1.93907 WP_003903106.1.93913 WP_003903106.1.93946 WP_003903106.1.93950 WP_003903106.1.93953 WP_003903106.1.93954 WP_003903106.1.93988 WP_003903106.1.9407 WP_003903106.1.94143 WP_003903106.1.94154 WP_003903106.1.94204 WP_003903106.1.94205 WP_003903106.1.94226 WP_003903106.1.94231 WP_003903106.1.94256 WP_003903106.1.94261 WP_003903106.1.94281 WP_003903106.1.94292 WP_003903106.1.94297 WP_003903106.1.9431 WP_003903106.1.94326 WP_003903106.1.94339 WP_003903106.1.94392 WP_003903106.1.94416 WP_003903106.1.94421 WP_003903106.1.94456 WP_003903106.1.94470 WP_003903106.1.94480 WP_003903106.1.94495 WP_003903106.1.94511 WP_003903106.1.94512 WP_003903106.1.94525 WP_003903106.1.94528 WP_003903106.1.94564 WP_003903106.1.946 WP_003903106.1.94602 WP_003903106.1.94623 WP_003903106.1.94629 WP_003903106.1.9465 WP_003903106.1.94673 WP_003903106.1.94714 WP_003903106.1.94730 WP_003903106.1.94736 WP_003903106.1.94776 WP_003903106.1.9478 WP_003903106.1.94834 WP_003903106.1.94852 WP_003903106.1.94872 WP_003903106.1.9488 WP_003903106.1.94902 WP_003903106.1.94916 WP_003903106.1.94979 WP_003903106.1.94994 WP_003903106.1.94996 WP_003903106.1.94998 WP_003903106.1.95007 WP_003903106.1.95010 WP_003903106.1.95015 WP_003903106.1.95034 WP_003903106.1.95068 WP_003903106.1.95081 WP_003903106.1.95082 WP_003903106.1.9509 WP_003903106.1.95096 WP_003903106.1.95112 WP_003903106.1.95138 WP_003903106.1.9514 WP_003903106.1.95179 WP_003903106.1.95188 WP_003903106.1.95190 WP_003903106.1.95234 WP_003903106.1.95241 WP_003903106.1.95245 WP_003903106.1.95257 WP_003903106.1.95279 WP_003903106.1.9531 WP_003903106.1.95335 WP_003903106.1.95344 WP_003903106.1.9535 WP_003903106.1.95370 WP_003903106.1.95392 WP_003903106.1.95416 WP_003903106.1.95417 WP_003903106.1.95454 WP_003903106.1.95455 WP_003903106.1.95491 WP_003903106.1.95497 WP_003903106.1.95508 WP_003903106.1.95509 WP_003903106.1.95529 WP_003903106.1.95556 WP_003903106.1.95557 WP_003903106.1.95565 WP_003903106.1.95578 WP_003903106.1.95580 WP_003903106.1.95585 WP_003903106.1.95643 WP_003903106.1.95679 WP_003903106.1.95685 WP_003903106.1.957 WP_003903106.1.95724 WP_003903106.1.95727 WP_003903106.1.95730 WP_003903106.1.95735 WP_003903106.1.95758 WP_003903106.1.95772 WP_003903106.1.95797 WP_003903106.1.95839 WP_003903106.1.9585 WP_003903106.1.9590 WP_003903106.1.95902 WP_003903106.1.95924 WP_003903106.1.95926 WP_003903106.1.95953 WP_003903106.1.95958 WP_003903106.1.95964 WP_003903106.1.95973 WP_003903106.1.96006 WP_003903106.1.9602 WP_003903106.1.96036 WP_003903106.1.96062 WP_003903106.1.96098 WP_003903106.1.96146 WP_003903106.1.96166 WP_003903106.1.96171 WP_003903106.1.96182 WP_003903106.1.96204 WP_003903106.1.96230 WP_003903106.1.96235 WP_003903106.1.96242 WP_003903106.1.96245 WP_003903106.1.96254 WP_003903106.1.96259 WP_003903106.1.96286 WP_003903106.1.96313 WP_003903106.1.96318 WP_003903106.1.96345 WP_003903106.1.96360 WP_003903106.1.96373 WP_003903106.1.96456 WP_003903106.1.96486 WP_003903106.1.96560 WP_003903106.1.96569 WP_003903106.1.96573 WP_003903106.1.96575 WP_003903106.1.96576 WP_003903106.1.96611 WP_003903106.1.96621 WP_003903106.1.9667 WP_003903106.1.96681 WP_003903106.1.96726 WP_003903106.1.96733 WP_003903106.1.96742 WP_003903106.1.96754 WP_003903106.1.9678 WP_003903106.1.96832 WP_003903106.1.9685 WP_003903106.1.97008 WP_003903106.1.97009 WP_003903106.1.97056 WP_003903106.1.97084 WP_003903106.1.97087 WP_003903106.1.97094 WP_003903106.1.97096 WP_003903106.1.97099 WP_003903106.1.97108 WP_003903106.1.97113 WP_003903106.1.97122 WP_003903106.1.97127 WP_003903106.1.97129 WP_003903106.1.97136 WP_003903106.1.9716 WP_003903106.1.97176 WP_003903106.1.97222 WP_003903106.1.97223 WP_003903106.1.97237 WP_003903106.1.97242 WP_003903106.1.97270 WP_003903106.1.97283 WP_003903106.1.97296 WP_003903106.1.97321 WP_003903106.1.97325 WP_003903106.1.97366 WP_003903106.1.97376 WP_003903106.1.97380 WP_003903106.1.9739 WP_003903106.1.97462 WP_003903106.1.97517 WP_003903106.1.97519 WP_003903106.1.97535 WP_003903106.1.97540 WP_003903106.1.97545 WP_003903106.1.97546 WP_003903106.1.97550 WP_003903106.1.97577 WP_003903106.1.97584 WP_003903106.1.9759 WP_003903106.1.97591 WP_003903106.1.97609 WP_003903106.1.97618 WP_003903106.1.9763 WP_003903106.1.97669 WP_003903106.1.97673 WP_003903106.1.97700 WP_003903106.1.97701 WP_003903106.1.9773 WP_003903106.1.97730 WP_003903106.1.97740 WP_003903106.1.97751 WP_003903106.1.97754 WP_003903106.1.97797 WP_003903106.1.9782 WP_003903106.1.9784 WP_003903106.1.97888 WP_003903106.1.9790 WP_003903106.1.9795 WP_003903106.1.97951 WP_003903106.1.97958 WP_003903106.1.97966 WP_003903106.1.97977 WP_003903106.1.97979 WP_003903106.1.97995 WP_003903106.1.98018 WP_003903106.1.98034 WP_003903106.1.98052 WP_003903106.1.98071 WP_003903106.1.98072 WP_003903106.1.98113 WP_003903106.1.98114 WP_003903106.1.98128 WP_003903106.1.98181 WP_003903106.1.98188 WP_003903106.1.98189 WP_003903106.1.98213 WP_003903106.1.98225 WP_003903106.1.98291 WP_003903106.1.98335 WP_003903106.1.98350 WP_003903106.1.98395 WP_003903106.1.98412 WP_003903106.1.98441 WP_003903106.1.98443 WP_003903106.1.98462 WP_003903106.1.9848 WP_003903106.1.98482 WP_003903106.1.98486 WP_003903106.1.98488 WP_003903106.1.98503 WP_003903106.1.98516 WP_003903106.1.98524 WP_003903106.1.98536 WP_003903106.1.98541 WP_003903106.1.98566 WP_003903106.1.98576 WP_003903106.1.98590 WP_003903106.1.98594 WP_003903106.1.98599 WP_003903106.1.98629 WP_003903106.1.98645 WP_003903106.1.98646 WP_003903106.1.98649 WP_003903106.1.98656 WP_003903106.1.9867 WP_003903106.1.98674 WP_003903106.1.98697 WP_003903106.1.98701 WP_003903106.1.98739 WP_003903106.1.98749 WP_003903106.1.98765 WP_003903106.1.98770 WP_003903106.1.98777 WP_003903106.1.98778 WP_003903106.1.98802 WP_003903106.1.98838 WP_003903106.1.98850 WP_003903106.1.98906 WP_003903106.1.98935 WP_003903106.1.98948 WP_003903106.1.98953 WP_003903106.1.98984 WP_003903106.1.99000 WP_003903106.1.99023 WP_003903106.1.99030 WP_003903106.1.99055 WP_003903106.1.99062 WP_003903106.1.99086 WP_003903106.1.99115 WP_003903106.1.99117 WP_003903106.1.99161 WP_003903106.1.99176 WP_003903106.1.99205 WP_003903106.1.99211 WP_003903106.1.99216 WP_003903106.1.99222 WP_003903106.1.99251 WP_003903106.1.99294 WP_003903106.1.99312 WP_003903106.1.99315 WP_003903106.1.99316 WP_003903106.1.99322 WP_003903106.1.99328 WP_003903106.1.99365 WP_003903106.1.99368 WP_003903106.1.99379 WP_003903106.1.99396 WP_003903106.1.99402 WP_003903106.1.99404 WP_003903106.1.99419 WP_003903106.1.99438 WP_003903106.1.99460 WP_003903106.1.99468 WP_003903106.1.99473 WP_003903106.1.99513 WP_003903106.1.99529 WP_003903106.1.99548 WP_003903106.1.99572 WP_003903106.1.99575 WP_003903106.1.99578 WP_003903106.1.99605 WP_003903106.1.99609 WP_003903106.1.99617 WP_003903106.1.99635 WP_003903106.1.99650 WP_003903106.1.99672 WP_003903106.1.99701 WP_003903106.1.99711 WP_003903106.1.99716 WP_003903106.1.99740 WP_003903106.1.99745 WP_003903106.1.99749 WP_003903106.1.9976 WP_003903106.1.99798 WP_003903106.1.99817 WP_003903106.1.99832 WP_003903106.1.99847 WP_003903106.1.99852 WP_003903106.1.99886 WP_003903106.1.99897 WP_003903106.1.99899 WP_003903106.1.99915 WP_003903106.1.9993 WP_003903106.1.99982 WP_003903106.1.99991 gi|15840039|ref|NP_335076.1| gi|494695042|ref|YP_007960545.1| IPRv0636PALZ Rv0636 gi|471336481|ref|YP_007609194.1| gi|15607776|ref|NP_215150.1| gi|148660410|ref|YP_001281933.1| gi|339630706|ref|YP_004722348.1| gi|385997415|ref|YP_005915713.1| gi|525673451|ref|YP_008224733.1| gi|433629721|ref|YP_007263349.1| gi|392385356|ref|YP_005306985.1| gi|506925054|ref|YP_008005504.1| gi|433640759|ref|YP_007286518.1| gi|479054586|ref|YP_007350392.1| gi|479313509|ref|YP_007853561.1| gi|506925054|ref|YP_008005504.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]