SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I6WZD7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I6WZD7
Domain Number 1 Region: 16-130
Classification Level Classification E-value
Superfamily NTF2-like 2.58e-27
Family Ketosteroid isomerase-like 0.00000171
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I6WZD7
Sequence length 139
Comment (tr|I6WZD7|I6WZD7_MYCTU) Conserved protein {ECO:0000313|EMBL:CCP43507.1} KW=Complete proteome; Reference proteome OX=83332 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv). GN=Rv0760c OC=Mycobacterium; Mycobacterium tuberculosis complex.
Sequence
MTQTTQSPALIASQSSWRCVQAHDREGWLALMADDVVIEDPIGKSVTNPDGSGIKGKEAV
GAFFDTHIAANRLTVTCEETFPSSSPDEIAHILVLHSEFDGGFTSEVRGVFTYRVNKAGL
ITNMRGYWNLDMMTFGNQE
Download sequence
Identical sequences A0A045IQB1 A0A083WI97 A0A089QMF5 A0A0H3L7B1 A0A0H3M4D0 A0A0K2HSY8 A0A109SL52 A0A109SUI2 A0A197IYQ4 A0A1R3XYG6 A5U0E8 F8M3Q5 I6WZD7 M8DJU6 P71817 R4LZY4 R4ME58
gi|15607900|ref|NP_215274.1| 2a15_A 2z76_A 2z76_B 2z77_A 2z77_B 2z77_C 2z77_D 2z7a_A 2z7a_B 2z7a_C 2z7a_D gi|386003789|ref|YP_005922068.1| gi|31791948|ref|NP_854441.1| gi|339630830|ref|YP_004722472.1| gi|449062788|ref|YP_007429871.1| gi|479054713|ref|YP_007350519.1| gi|392385479|ref|YP_005307108.1| gi|506925185|ref|YP_008005635.1| gi|253797706|ref|YP_003030707.1| NP_215274.1.84033 WP_003403880.1.100000 WP_003403880.1.100021 WP_003403880.1.100069 WP_003403880.1.100087 WP_003403880.1.10015 WP_003403880.1.100208 WP_003403880.1.100216 WP_003403880.1.10022 WP_003403880.1.100255 WP_003403880.1.100260 WP_003403880.1.100270 WP_003403880.1.100279 WP_003403880.1.100286 WP_003403880.1.100308 WP_003403880.1.100309 WP_003403880.1.100318 WP_003403880.1.100337 WP_003403880.1.100338 WP_003403880.1.10037 WP_003403880.1.100383 WP_003403880.1.100395 WP_003403880.1.100396 WP_003403880.1.1004 WP_003403880.1.100401 WP_003403880.1.100459 WP_003403880.1.100460 WP_003403880.1.100552 WP_003403880.1.100581 WP_003403880.1.100600 WP_003403880.1.100625 WP_003403880.1.10064 WP_003403880.1.100666 WP_003403880.1.100671 WP_003403880.1.100677 WP_003403880.1.100682 WP_003403880.1.100697 WP_003403880.1.100703 WP_003403880.1.100716 WP_003403880.1.100722 WP_003403880.1.100757 WP_003403880.1.100772 WP_003403880.1.1008 WP_003403880.1.100812 WP_003403880.1.100866 WP_003403880.1.10088 WP_003403880.1.100889 WP_003403880.1.10090 WP_003403880.1.100910 WP_003403880.1.100918 WP_003403880.1.100935 WP_003403880.1.100984 WP_003403880.1.100992 WP_003403880.1.100998 WP_003403880.1.101 WP_003403880.1.101025 WP_003403880.1.101028 WP_003403880.1.10104 WP_003403880.1.101048 WP_003403880.1.101054 WP_003403880.1.101075 WP_003403880.1.101143 WP_003403880.1.101146 WP_003403880.1.10116 WP_003403880.1.10117 WP_003403880.1.101209 WP_003403880.1.10125 WP_003403880.1.101290 WP_003403880.1.101323 WP_003403880.1.101324 WP_003403880.1.101350 WP_003403880.1.101367 WP_003403880.1.101398 WP_003403880.1.101403 WP_003403880.1.101421 WP_003403880.1.10144 WP_003403880.1.101442 WP_003403880.1.10145 WP_003403880.1.101452 WP_003403880.1.101456 WP_003403880.1.101481 WP_003403880.1.101493 WP_003403880.1.101496 WP_003403880.1.101525 WP_003403880.1.101533 WP_003403880.1.101535 WP_003403880.1.101553 WP_003403880.1.101558 WP_003403880.1.10156 WP_003403880.1.101573 WP_003403880.1.101576 WP_003403880.1.10159 WP_003403880.1.101592 WP_003403880.1.101604 WP_003403880.1.101607 WP_003403880.1.101622 WP_003403880.1.101644 WP_003403880.1.101659 WP_003403880.1.101671 WP_003403880.1.101687 WP_003403880.1.101698 WP_003403880.1.10170 WP_003403880.1.101713 WP_003403880.1.101722 WP_003403880.1.101733 WP_003403880.1.101743 WP_003403880.1.101754 WP_003403880.1.101764 WP_003403880.1.101773 WP_003403880.1.101795 WP_003403880.1.101797 WP_003403880.1.101798 WP_003403880.1.101802 WP_003403880.1.101826 WP_003403880.1.101836 WP_003403880.1.101858 WP_003403880.1.101859 WP_003403880.1.101862 WP_003403880.1.101888 WP_003403880.1.101894 WP_003403880.1.101899 WP_003403880.1.1019 WP_003403880.1.101923 WP_003403880.1.101925 WP_003403880.1.10193 WP_003403880.1.101996 WP_003403880.1.102008 WP_003403880.1.102017 WP_003403880.1.102053 WP_003403880.1.102055 WP_003403880.1.102099 WP_003403880.1.1021 WP_003403880.1.10211 WP_003403880.1.102119 WP_003403880.1.102121 WP_003403880.1.102143 WP_003403880.1.10216 WP_003403880.1.10224 WP_003403880.1.10253 WP_003403880.1.10262 WP_003403880.1.10272 WP_003403880.1.10277 WP_003403880.1.1033 WP_003403880.1.10350 WP_003403880.1.10362 WP_003403880.1.10366 WP_003403880.1.10376 WP_003403880.1.10396 WP_003403880.1.10410 WP_003403880.1.10414 WP_003403880.1.10421 WP_003403880.1.10430 WP_003403880.1.1044 WP_003403880.1.10440 WP_003403880.1.10445 WP_003403880.1.10471 WP_003403880.1.10472 WP_003403880.1.10489 WP_003403880.1.10518 WP_003403880.1.10523 WP_003403880.1.10594 WP_003403880.1.10603 WP_003403880.1.10606 WP_003403880.1.10615 WP_003403880.1.10623 WP_003403880.1.10635 WP_003403880.1.10643 WP_003403880.1.10648 WP_003403880.1.10662 WP_003403880.1.10709 WP_003403880.1.10735 WP_003403880.1.10740 WP_003403880.1.10756 WP_003403880.1.1078 WP_003403880.1.10791 WP_003403880.1.10799 WP_003403880.1.10825 WP_003403880.1.10848 WP_003403880.1.10863 WP_003403880.1.10879 WP_003403880.1.10912 WP_003403880.1.10916 WP_003403880.1.10923 WP_003403880.1.10927 WP_003403880.1.1095 WP_003403880.1.10956 WP_003403880.1.10958 WP_003403880.1.10962 WP_003403880.1.10980 WP_003403880.1.10981 WP_003403880.1.10993 WP_003403880.1.1100 WP_003403880.1.11040 WP_003403880.1.11061 WP_003403880.1.11070 WP_003403880.1.11141 WP_003403880.1.11171 WP_003403880.1.11175 WP_003403880.1.11176 WP_003403880.1.11222 WP_003403880.1.11236 WP_003403880.1.11329 WP_003403880.1.1133 WP_003403880.1.11342 WP_003403880.1.11373 WP_003403880.1.11376 WP_003403880.1.11390 WP_003403880.1.11402 WP_003403880.1.11481 WP_003403880.1.11487 WP_003403880.1.11491 WP_003403880.1.11514 WP_003403880.1.11587 WP_003403880.1.11589 WP_003403880.1.11596 WP_003403880.1.11604 WP_003403880.1.11610 WP_003403880.1.11697 WP_003403880.1.11707 WP_003403880.1.11752 WP_003403880.1.11758 WP_003403880.1.11775 WP_003403880.1.11804 WP_003403880.1.11822 WP_003403880.1.11826 WP_003403880.1.11856 WP_003403880.1.11898 WP_003403880.1.11906 WP_003403880.1.11939 WP_003403880.1.11960 WP_003403880.1.11961 WP_003403880.1.11972 WP_003403880.1.11984 WP_003403880.1.120 WP_003403880.1.12001 WP_003403880.1.12049 WP_003403880.1.12052 WP_003403880.1.12100 WP_003403880.1.12116 WP_003403880.1.12130 WP_003403880.1.12133 WP_003403880.1.12161 WP_003403880.1.12165 WP_003403880.1.12184 WP_003403880.1.12187 WP_003403880.1.12190 WP_003403880.1.12216 WP_003403880.1.12265 WP_003403880.1.12275 WP_003403880.1.12293 WP_003403880.1.12294 WP_003403880.1.123 WP_003403880.1.1231 WP_003403880.1.12314 WP_003403880.1.12327 WP_003403880.1.12338 WP_003403880.1.1236 WP_003403880.1.12371 WP_003403880.1.12372 WP_003403880.1.12389 WP_003403880.1.12406 WP_003403880.1.1241 WP_003403880.1.12421 WP_003403880.1.12424 WP_003403880.1.12446 WP_003403880.1.12464 WP_003403880.1.12479 WP_003403880.1.12519 WP_003403880.1.12523 WP_003403880.1.12526 WP_003403880.1.1255 WP_003403880.1.12550 WP_003403880.1.12551 WP_003403880.1.12563 WP_003403880.1.12611 WP_003403880.1.12669 WP_003403880.1.1267 WP_003403880.1.12672 WP_003403880.1.12692 WP_003403880.1.1271 WP_003403880.1.12710 WP_003403880.1.12768 WP_003403880.1.1279 WP_003403880.1.12794 WP_003403880.1.12801 WP_003403880.1.12821 WP_003403880.1.12841 WP_003403880.1.12854 WP_003403880.1.12871 WP_003403880.1.12901 WP_003403880.1.12941 WP_003403880.1.12957 WP_003403880.1.12972 WP_003403880.1.13028 WP_003403880.1.13043 WP_003403880.1.13086 WP_003403880.1.13087 WP_003403880.1.13163 WP_003403880.1.13183 WP_003403880.1.132 WP_003403880.1.13249 WP_003403880.1.13282 WP_003403880.1.13284 WP_003403880.1.13296 WP_003403880.1.13298 WP_003403880.1.13302 WP_003403880.1.13306 WP_003403880.1.13312 WP_003403880.1.13313 WP_003403880.1.13321 WP_003403880.1.13345 WP_003403880.1.13358 WP_003403880.1.13370 WP_003403880.1.13375 WP_003403880.1.1338 WP_003403880.1.13420 WP_003403880.1.13433 WP_003403880.1.13435 WP_003403880.1.13438 WP_003403880.1.13461 WP_003403880.1.13489 WP_003403880.1.13526 WP_003403880.1.13551 WP_003403880.1.13561 WP_003403880.1.13564 WP_003403880.1.13579 WP_003403880.1.13647 WP_003403880.1.13667 WP_003403880.1.13687 WP_003403880.1.13697 WP_003403880.1.13719 WP_003403880.1.13763 WP_003403880.1.1377 WP_003403880.1.13774 WP_003403880.1.13786 WP_003403880.1.13793 WP_003403880.1.13794 WP_003403880.1.13817 WP_003403880.1.13834 WP_003403880.1.13866 WP_003403880.1.13880 WP_003403880.1.13899 WP_003403880.1.13909 WP_003403880.1.13910 WP_003403880.1.13919 WP_003403880.1.13920 WP_003403880.1.13952 WP_003403880.1.13953 WP_003403880.1.13962 WP_003403880.1.1398 WP_003403880.1.14027 WP_003403880.1.14115 WP_003403880.1.1415 WP_003403880.1.14152 WP_003403880.1.14162 WP_003403880.1.14175 WP_003403880.1.14194 WP_003403880.1.14195 WP_003403880.1.14238 WP_003403880.1.14266 WP_003403880.1.14273 WP_003403880.1.14303 WP_003403880.1.14306 WP_003403880.1.14307 WP_003403880.1.14310 WP_003403880.1.14341 WP_003403880.1.14382 WP_003403880.1.14416 WP_003403880.1.14428 WP_003403880.1.14441 WP_003403880.1.14469 WP_003403880.1.14477 WP_003403880.1.14504 WP_003403880.1.14514 WP_003403880.1.1452 WP_003403880.1.14527 WP_003403880.1.1454 WP_003403880.1.14544 WP_003403880.1.14548 WP_003403880.1.14551 WP_003403880.1.14561 WP_003403880.1.14573 WP_003403880.1.1462 WP_003403880.1.14658 WP_003403880.1.14667 WP_003403880.1.14668 WP_003403880.1.14675 WP_003403880.1.14694 WP_003403880.1.14695 WP_003403880.1.14709 WP_003403880.1.14766 WP_003403880.1.14783 WP_003403880.1.14865 WP_003403880.1.14872 WP_003403880.1.14905 WP_003403880.1.14926 WP_003403880.1.14951 WP_003403880.1.14955 WP_003403880.1.15003 WP_003403880.1.15009 WP_003403880.1.15028 WP_003403880.1.15040 WP_003403880.1.15065 WP_003403880.1.15089 WP_003403880.1.1509 WP_003403880.1.15126 WP_003403880.1.15131 WP_003403880.1.15168 WP_003403880.1.15174 WP_003403880.1.15187 WP_003403880.1.15196 WP_003403880.1.15216 WP_003403880.1.15217 WP_003403880.1.1523 WP_003403880.1.15232 WP_003403880.1.15238 WP_003403880.1.15240 WP_003403880.1.15253 WP_003403880.1.15267 WP_003403880.1.1527 WP_003403880.1.15292 WP_003403880.1.15302 WP_003403880.1.15322 WP_003403880.1.1534 WP_003403880.1.15345 WP_003403880.1.15365 WP_003403880.1.15372 WP_003403880.1.15386 WP_003403880.1.15387 WP_003403880.1.15442 WP_003403880.1.15447 WP_003403880.1.15449 WP_003403880.1.15477 WP_003403880.1.15492 WP_003403880.1.15511 WP_003403880.1.15512 WP_003403880.1.15558 WP_003403880.1.15559 WP_003403880.1.15566 WP_003403880.1.15599 WP_003403880.1.1560 WP_003403880.1.15611 WP_003403880.1.1563 WP_003403880.1.15633 WP_003403880.1.15643 WP_003403880.1.15688 WP_003403880.1.15755 WP_003403880.1.15763 WP_003403880.1.15774 WP_003403880.1.1578 WP_003403880.1.15780 WP_003403880.1.15827 WP_003403880.1.15834 WP_003403880.1.15842 WP_003403880.1.15848 WP_003403880.1.15853 WP_003403880.1.15870 WP_003403880.1.15877 WP_003403880.1.15893 WP_003403880.1.15896 WP_003403880.1.15926 WP_003403880.1.15933 WP_003403880.1.15958 WP_003403880.1.15973 WP_003403880.1.15987 WP_003403880.1.15993 WP_003403880.1.16009 WP_003403880.1.16025 WP_003403880.1.16043 WP_003403880.1.16055 WP_003403880.1.16066 WP_003403880.1.16069 WP_003403880.1.16077 WP_003403880.1.16106 WP_003403880.1.16108 WP_003403880.1.16110 WP_003403880.1.16130 WP_003403880.1.16136 WP_003403880.1.16139 WP_003403880.1.16141 WP_003403880.1.16143 WP_003403880.1.1630 WP_003403880.1.16318 WP_003403880.1.1632 WP_003403880.1.16327 WP_003403880.1.16334 WP_003403880.1.16345 WP_003403880.1.16374 WP_003403880.1.16384 WP_003403880.1.16386 WP_003403880.1.1642 WP_003403880.1.16421 WP_003403880.1.16424 WP_003403880.1.16426 WP_003403880.1.16431 WP_003403880.1.16438 WP_003403880.1.1644 WP_003403880.1.16442 WP_003403880.1.16448 WP_003403880.1.16451 WP_003403880.1.16476 WP_003403880.1.16480 WP_003403880.1.16494 WP_003403880.1.1652 WP_003403880.1.16549 WP_003403880.1.16560 WP_003403880.1.16609 WP_003403880.1.16619 WP_003403880.1.16620 WP_003403880.1.16622 WP_003403880.1.16637 WP_003403880.1.1669 WP_003403880.1.16707 WP_003403880.1.16724 WP_003403880.1.16731 WP_003403880.1.16743 WP_003403880.1.1683 WP_003403880.1.16837 WP_003403880.1.16852 WP_003403880.1.16937 WP_003403880.1.16940 WP_003403880.1.16950 WP_003403880.1.16959 WP_003403880.1.16968 WP_003403880.1.1697 WP_003403880.1.16973 WP_003403880.1.16977 WP_003403880.1.17005 WP_003403880.1.17006 WP_003403880.1.17010 WP_003403880.1.17015 WP_003403880.1.17019 WP_003403880.1.17039 WP_003403880.1.17041 WP_003403880.1.17052 WP_003403880.1.17057 WP_003403880.1.17062 WP_003403880.1.1707 WP_003403880.1.17094 WP_003403880.1.17130 WP_003403880.1.17138 WP_003403880.1.17167 WP_003403880.1.17224 WP_003403880.1.17251 WP_003403880.1.17288 WP_003403880.1.17304 WP_003403880.1.17314 WP_003403880.1.17345 WP_003403880.1.17381 WP_003403880.1.17391 WP_003403880.1.17412 WP_003403880.1.1743 WP_003403880.1.17440 WP_003403880.1.17466 WP_003403880.1.17477 WP_003403880.1.17483 WP_003403880.1.17505 WP_003403880.1.17527 WP_003403880.1.17535 WP_003403880.1.17540 WP_003403880.1.17553 WP_003403880.1.17558 WP_003403880.1.17599 WP_003403880.1.17635 WP_003403880.1.17679 WP_003403880.1.1768 WP_003403880.1.17687 WP_003403880.1.17700 WP_003403880.1.17710 WP_003403880.1.17713 WP_003403880.1.17722 WP_003403880.1.17746 WP_003403880.1.17788 WP_003403880.1.17798 WP_003403880.1.17803 WP_003403880.1.17816 WP_003403880.1.17821 WP_003403880.1.17868 WP_003403880.1.17878 WP_003403880.1.1792 WP_003403880.1.17923 WP_003403880.1.1795 WP_003403880.1.17955 WP_003403880.1.17973 WP_003403880.1.18009 WP_003403880.1.18013 WP_003403880.1.18033 WP_003403880.1.18057 WP_003403880.1.18065 WP_003403880.1.18070 WP_003403880.1.18120 WP_003403880.1.18126 WP_003403880.1.1817 WP_003403880.1.18170 WP_003403880.1.18206 WP_003403880.1.18216 WP_003403880.1.18240 WP_003403880.1.18257 WP_003403880.1.18297 WP_003403880.1.18306 WP_003403880.1.18364 WP_003403880.1.18399 WP_003403880.1.18411 WP_003403880.1.18444 WP_003403880.1.18448 WP_003403880.1.18467 WP_003403880.1.18476 WP_003403880.1.18580 WP_003403880.1.18582 WP_003403880.1.18587 WP_003403880.1.186 WP_003403880.1.18639 WP_003403880.1.18646 WP_003403880.1.18647 WP_003403880.1.1868 WP_003403880.1.18694 WP_003403880.1.18710 WP_003403880.1.18751 WP_003403880.1.18781 WP_003403880.1.18793 WP_003403880.1.18804 WP_003403880.1.18816 WP_003403880.1.18823 WP_003403880.1.18827 WP_003403880.1.18838 WP_003403880.1.18856 WP_003403880.1.18945 WP_003403880.1.1898 WP_003403880.1.19005 WP_003403880.1.19056 WP_003403880.1.19063 WP_003403880.1.19066 WP_003403880.1.19071 WP_003403880.1.19085 WP_003403880.1.19094 WP_003403880.1.19144 WP_003403880.1.19159 WP_003403880.1.19193 WP_003403880.1.19231 WP_003403880.1.19243 WP_003403880.1.19264 WP_003403880.1.19295 WP_003403880.1.19307 WP_003403880.1.19326 WP_003403880.1.1933 WP_003403880.1.19364 WP_003403880.1.19382 WP_003403880.1.19400 WP_003403880.1.19426 WP_003403880.1.19429 WP_003403880.1.19464 WP_003403880.1.19480 WP_003403880.1.19512 WP_003403880.1.19553 WP_003403880.1.19562 WP_003403880.1.19564 WP_003403880.1.19568 WP_003403880.1.19572 WP_003403880.1.19595 WP_003403880.1.19596 WP_003403880.1.19600 WP_003403880.1.19630 WP_003403880.1.1967 WP_003403880.1.19694 WP_003403880.1.19707 WP_003403880.1.19742 WP_003403880.1.19785 WP_003403880.1.19820 WP_003403880.1.19868 WP_003403880.1.19874 WP_003403880.1.19890 WP_003403880.1.19900 WP_003403880.1.19922 WP_003403880.1.19936 WP_003403880.1.19946 WP_003403880.1.19949 WP_003403880.1.19960 WP_003403880.1.19964 WP_003403880.1.20007 WP_003403880.1.20016 WP_003403880.1.20028 WP_003403880.1.2003 WP_003403880.1.20037 WP_003403880.1.20039 WP_003403880.1.20082 WP_003403880.1.20085 WP_003403880.1.20097 WP_003403880.1.20116 WP_003403880.1.20130 WP_003403880.1.20140 WP_003403880.1.20141 WP_003403880.1.20142 WP_003403880.1.20158 WP_003403880.1.20239 WP_003403880.1.20243 WP_003403880.1.20259 WP_003403880.1.20262 WP_003403880.1.20268 WP_003403880.1.20272 WP_003403880.1.20273 WP_003403880.1.20280 WP_003403880.1.20294 WP_003403880.1.20300 WP_003403880.1.20309 WP_003403880.1.20322 WP_003403880.1.2037 WP_003403880.1.20372 WP_003403880.1.20381 WP_003403880.1.204 WP_003403880.1.20427 WP_003403880.1.20432 WP_003403880.1.20457 WP_003403880.1.20459 WP_003403880.1.20460 WP_003403880.1.20542 WP_003403880.1.20578 WP_003403880.1.20608 WP_003403880.1.20624 WP_003403880.1.20628 WP_003403880.1.2066 WP_003403880.1.20707 WP_003403880.1.20722 WP_003403880.1.20729 WP_003403880.1.20742 WP_003403880.1.20751 WP_003403880.1.20776 WP_003403880.1.20850 WP_003403880.1.2086 WP_003403880.1.20868 WP_003403880.1.20876 WP_003403880.1.20897 WP_003403880.1.20898 WP_003403880.1.2090 WP_003403880.1.20911 WP_003403880.1.20916 WP_003403880.1.20921 WP_003403880.1.20926 WP_003403880.1.20927 WP_003403880.1.20951 WP_003403880.1.20970 WP_003403880.1.2104 WP_003403880.1.21070 WP_003403880.1.21127 WP_003403880.1.21135 WP_003403880.1.21173 WP_003403880.1.21187 WP_003403880.1.212 WP_003403880.1.2120 WP_003403880.1.21218 WP_003403880.1.21219 WP_003403880.1.2123 WP_003403880.1.21231 WP_003403880.1.21234 WP_003403880.1.2126 WP_003403880.1.21292 WP_003403880.1.21307 WP_003403880.1.2131 WP_003403880.1.21311 WP_003403880.1.21365 WP_003403880.1.2137 WP_003403880.1.21392 WP_003403880.1.21397 WP_003403880.1.21403 WP_003403880.1.21415 WP_003403880.1.21418 WP_003403880.1.21430 WP_003403880.1.21434 WP_003403880.1.21444 WP_003403880.1.21468 WP_003403880.1.21498 WP_003403880.1.21509 WP_003403880.1.21513 WP_003403880.1.21560 WP_003403880.1.21565 WP_003403880.1.21586 WP_003403880.1.21591 WP_003403880.1.21594 WP_003403880.1.21602 WP_003403880.1.21615 WP_003403880.1.21639 WP_003403880.1.21655 WP_003403880.1.21658 WP_003403880.1.2168 WP_003403880.1.2174 WP_003403880.1.21741 WP_003403880.1.21742 WP_003403880.1.21777 WP_003403880.1.21786 WP_003403880.1.21795 WP_003403880.1.218 WP_003403880.1.21826 WP_003403880.1.21829 WP_003403880.1.21840 WP_003403880.1.21843 WP_003403880.1.21872 WP_003403880.1.21873 WP_003403880.1.2188 WP_003403880.1.21882 WP_003403880.1.21912 WP_003403880.1.2194 WP_003403880.1.21941 WP_003403880.1.21956 WP_003403880.1.21960 WP_003403880.1.21971 WP_003403880.1.21973 WP_003403880.1.21983 WP_003403880.1.22013 WP_003403880.1.22025 WP_003403880.1.22036 WP_003403880.1.22092 WP_003403880.1.22127 WP_003403880.1.22140 WP_003403880.1.22233 WP_003403880.1.22255 WP_003403880.1.22277 WP_003403880.1.22305 WP_003403880.1.22348 WP_003403880.1.22356 WP_003403880.1.22366 WP_003403880.1.2238 WP_003403880.1.22380 WP_003403880.1.22437 WP_003403880.1.22438 WP_003403880.1.22445 WP_003403880.1.22490 WP_003403880.1.22511 WP_003403880.1.22524 WP_003403880.1.2253 WP_003403880.1.22585 WP_003403880.1.22589 WP_003403880.1.22606 WP_003403880.1.22608 WP_003403880.1.22609 WP_003403880.1.22618 WP_003403880.1.2262 WP_003403880.1.22624 WP_003403880.1.22629 WP_003403880.1.22647 WP_003403880.1.22664 WP_003403880.1.22665 WP_003403880.1.22674 WP_003403880.1.22680 WP_003403880.1.22725 WP_003403880.1.22728 WP_003403880.1.22733 WP_003403880.1.22737 WP_003403880.1.2275 WP_003403880.1.22754 WP_003403880.1.22797 WP_003403880.1.22800 WP_003403880.1.22804 WP_003403880.1.22829 WP_003403880.1.22840 WP_003403880.1.22844 WP_003403880.1.22963 WP_003403880.1.22970 WP_003403880.1.22996 WP_003403880.1.22997 WP_003403880.1.22999 WP_003403880.1.23015 WP_003403880.1.23032 WP_003403880.1.231 WP_003403880.1.23101 WP_003403880.1.2312 WP_003403880.1.23140 WP_003403880.1.23153 WP_003403880.1.23171 WP_003403880.1.23199 WP_003403880.1.2320 WP_003403880.1.23204 WP_003403880.1.23216 WP_003403880.1.23229 WP_003403880.1.23233 WP_003403880.1.2326 WP_003403880.1.23261 WP_003403880.1.23272 WP_003403880.1.23289 WP_003403880.1.2329 WP_003403880.1.23308 WP_003403880.1.23316 WP_003403880.1.23325 WP_003403880.1.2339 WP_003403880.1.23406 WP_003403880.1.23438 WP_003403880.1.23445 WP_003403880.1.23447 WP_003403880.1.23452 WP_003403880.1.23461 WP_003403880.1.2349 WP_003403880.1.23496 WP_003403880.1.23497 WP_003403880.1.23506 WP_003403880.1.23530 WP_003403880.1.23539 WP_003403880.1.23546 WP_003403880.1.23573 WP_003403880.1.23583 WP_003403880.1.23588 WP_003403880.1.23628 WP_003403880.1.23683 WP_003403880.1.23692 WP_003403880.1.23694 WP_003403880.1.23699 WP_003403880.1.2371 WP_003403880.1.23803 WP_003403880.1.23825 WP_003403880.1.23832 WP_003403880.1.2384 WP_003403880.1.23843 WP_003403880.1.23863 WP_003403880.1.2387 WP_003403880.1.23894 WP_003403880.1.23993 WP_003403880.1.2400 WP_003403880.1.24007 WP_003403880.1.24008 WP_003403880.1.24046 WP_003403880.1.24057 WP_003403880.1.24062 WP_003403880.1.24113 WP_003403880.1.24119 WP_003403880.1.24128 WP_003403880.1.24140 WP_003403880.1.24176 WP_003403880.1.24190 WP_003403880.1.24202 WP_003403880.1.24244 WP_003403880.1.24261 WP_003403880.1.24294 WP_003403880.1.24357 WP_003403880.1.24396 WP_003403880.1.24414 WP_003403880.1.24423 WP_003403880.1.2443 WP_003403880.1.24446 WP_003403880.1.24461 WP_003403880.1.24500 WP_003403880.1.24507 WP_003403880.1.24509 WP_003403880.1.24529 WP_003403880.1.24553 WP_003403880.1.24599 WP_003403880.1.24629 WP_003403880.1.24638 WP_003403880.1.24648 WP_003403880.1.2466 WP_003403880.1.24767 WP_003403880.1.24824 WP_003403880.1.24831 WP_003403880.1.24840 WP_003403880.1.24848 WP_003403880.1.24857 WP_003403880.1.2487 WP_003403880.1.24893 WP_003403880.1.24907 WP_003403880.1.24933 WP_003403880.1.24956 WP_003403880.1.24958 WP_003403880.1.24985 WP_003403880.1.2499 WP_003403880.1.2505 WP_003403880.1.2507 WP_003403880.1.25096 WP_003403880.1.25103 WP_003403880.1.25129 WP_003403880.1.25171 WP_003403880.1.25184 WP_003403880.1.25247 WP_003403880.1.25252 WP_003403880.1.25278 WP_003403880.1.25283 WP_003403880.1.25313 WP_003403880.1.25338 WP_003403880.1.25342 WP_003403880.1.25343 WP_003403880.1.25367 WP_003403880.1.25393 WP_003403880.1.25406 WP_003403880.1.25435 WP_003403880.1.25437 WP_003403880.1.25445 WP_003403880.1.25455 WP_003403880.1.25473 WP_003403880.1.25504 WP_003403880.1.25513 WP_003403880.1.25542 WP_003403880.1.25579 WP_003403880.1.25594 WP_003403880.1.25606 WP_003403880.1.25645 WP_003403880.1.2566 WP_003403880.1.25673 WP_003403880.1.25674 WP_003403880.1.25693 WP_003403880.1.25699 WP_003403880.1.25727 WP_003403880.1.25736 WP_003403880.1.25738 WP_003403880.1.25756 WP_003403880.1.25759 WP_003403880.1.2580 WP_003403880.1.25813 WP_003403880.1.25853 WP_003403880.1.25854 WP_003403880.1.25874 WP_003403880.1.25885 WP_003403880.1.25892 WP_003403880.1.25906 WP_003403880.1.25914 WP_003403880.1.25916 WP_003403880.1.2594 WP_003403880.1.25954 WP_003403880.1.25965 WP_003403880.1.25972 WP_003403880.1.26017 WP_003403880.1.26032 WP_003403880.1.26038 WP_003403880.1.26072 WP_003403880.1.26089 WP_003403880.1.26097 WP_003403880.1.26098 WP_003403880.1.26108 WP_003403880.1.26109 WP_003403880.1.26118 WP_003403880.1.26126 WP_003403880.1.2614 WP_003403880.1.26182 WP_003403880.1.26190 WP_003403880.1.2620 WP_003403880.1.26234 WP_003403880.1.26243 WP_003403880.1.26265 WP_003403880.1.26267 WP_003403880.1.26292 WP_003403880.1.26310 WP_003403880.1.26328 WP_003403880.1.26349 WP_003403880.1.26366 WP_003403880.1.26374 WP_003403880.1.26407 WP_003403880.1.26412 WP_003403880.1.26454 WP_003403880.1.26464 WP_003403880.1.2653 WP_003403880.1.26560 WP_003403880.1.26571 WP_003403880.1.2659 WP_003403880.1.26597 WP_003403880.1.26603 WP_003403880.1.26629 WP_003403880.1.26651 WP_003403880.1.26702 WP_003403880.1.26707 WP_003403880.1.26710 WP_003403880.1.26719 WP_003403880.1.26738 WP_003403880.1.26745 WP_003403880.1.26756 WP_003403880.1.2676 WP_003403880.1.2677 WP_003403880.1.26779 WP_003403880.1.26780 WP_003403880.1.26798 WP_003403880.1.26854 WP_003403880.1.26868 WP_003403880.1.26876 WP_003403880.1.26888 WP_003403880.1.26914 WP_003403880.1.26945 WP_003403880.1.26959 WP_003403880.1.26969 WP_003403880.1.26984 WP_003403880.1.26992 WP_003403880.1.27004 WP_003403880.1.27017 WP_003403880.1.27045 WP_003403880.1.27074 WP_003403880.1.27075 WP_003403880.1.27128 WP_003403880.1.27130 WP_003403880.1.27139 WP_003403880.1.27152 WP_003403880.1.27162 WP_003403880.1.27164 WP_003403880.1.27193 WP_003403880.1.27235 WP_003403880.1.27254 WP_003403880.1.27278 WP_003403880.1.27343 WP_003403880.1.27352 WP_003403880.1.27369 WP_003403880.1.27391 WP_003403880.1.27398 WP_003403880.1.27402 WP_003403880.1.27410 WP_003403880.1.27411 WP_003403880.1.27449 WP_003403880.1.27463 WP_003403880.1.2749 WP_003403880.1.27492 WP_003403880.1.27528 WP_003403880.1.27541 WP_003403880.1.27582 WP_003403880.1.27596 WP_003403880.1.27607 WP_003403880.1.2766 WP_003403880.1.277 WP_003403880.1.27724 WP_003403880.1.27730 WP_003403880.1.27736 WP_003403880.1.27743 WP_003403880.1.27750 WP_003403880.1.27771 WP_003403880.1.27779 WP_003403880.1.27795 WP_003403880.1.27803 WP_003403880.1.27819 WP_003403880.1.27835 WP_003403880.1.27915 WP_003403880.1.27935 WP_003403880.1.27962 WP_003403880.1.28053 WP_003403880.1.28092 WP_003403880.1.28106 WP_003403880.1.28131 WP_003403880.1.28142 WP_003403880.1.2816 WP_003403880.1.28161 WP_003403880.1.28192 WP_003403880.1.28202 WP_003403880.1.28241 WP_003403880.1.28242 WP_003403880.1.28251 WP_003403880.1.28255 WP_003403880.1.28269 WP_003403880.1.28276 WP_003403880.1.28293 WP_003403880.1.28331 WP_003403880.1.28367 WP_003403880.1.28378 WP_003403880.1.28391 WP_003403880.1.2842 WP_003403880.1.28448 WP_003403880.1.2847 WP_003403880.1.28471 WP_003403880.1.28473 WP_003403880.1.28493 WP_003403880.1.28497 WP_003403880.1.28530 WP_003403880.1.28545 WP_003403880.1.28561 WP_003403880.1.28567 WP_003403880.1.286 WP_003403880.1.28610 WP_003403880.1.28634 WP_003403880.1.28642 WP_003403880.1.28671 WP_003403880.1.28682 WP_003403880.1.28698 WP_003403880.1.28703 WP_003403880.1.28739 WP_003403880.1.28758 WP_003403880.1.28781 WP_003403880.1.28787 WP_003403880.1.28827 WP_003403880.1.28839 WP_003403880.1.28847 WP_003403880.1.28850 WP_003403880.1.28865 WP_003403880.1.28897 WP_003403880.1.28914 WP_003403880.1.28935 WP_003403880.1.28936 WP_003403880.1.28939 WP_003403880.1.28943 WP_003403880.1.28952 WP_003403880.1.28975 WP_003403880.1.2899 WP_003403880.1.28993 WP_003403880.1.29000 WP_003403880.1.2901 WP_003403880.1.29028 WP_003403880.1.29033 WP_003403880.1.29078 WP_003403880.1.29102 WP_003403880.1.29115 WP_003403880.1.2916 WP_003403880.1.29217 WP_003403880.1.29223 WP_003403880.1.29234 WP_003403880.1.29264 WP_003403880.1.29275 WP_003403880.1.29306 WP_003403880.1.29339 WP_003403880.1.29348 WP_003403880.1.29364 WP_003403880.1.29367 WP_003403880.1.2938 WP_003403880.1.29399 WP_003403880.1.2944 WP_003403880.1.29449 WP_003403880.1.29450 WP_003403880.1.29452 WP_003403880.1.2949 WP_003403880.1.29510 WP_003403880.1.29515 WP_003403880.1.2953 WP_003403880.1.29559 WP_003403880.1.2959 WP_003403880.1.29592 WP_003403880.1.29599 WP_003403880.1.29611 WP_003403880.1.29632 WP_003403880.1.29649 WP_003403880.1.2965 WP_003403880.1.29659 WP_003403880.1.2969 WP_003403880.1.29696 WP_003403880.1.29698 WP_003403880.1.29718 WP_003403880.1.29742 WP_003403880.1.29745 WP_003403880.1.29769 WP_003403880.1.29825 WP_003403880.1.29830 WP_003403880.1.29847 WP_003403880.1.29861 WP_003403880.1.29883 WP_003403880.1.29890 WP_003403880.1.299 WP_003403880.1.29931 WP_003403880.1.29960 WP_003403880.1.30014 WP_003403880.1.3004 WP_003403880.1.30040 WP_003403880.1.30043 WP_003403880.1.30074 WP_003403880.1.30097 WP_003403880.1.30101 WP_003403880.1.30106 WP_003403880.1.30114 WP_003403880.1.30126 WP_003403880.1.30131 WP_003403880.1.30138 WP_003403880.1.30139 WP_003403880.1.30145 WP_003403880.1.30211 WP_003403880.1.30224 WP_003403880.1.30235 WP_003403880.1.30237 WP_003403880.1.3027 WP_003403880.1.30279 WP_003403880.1.30282 WP_003403880.1.30283 WP_003403880.1.30288 WP_003403880.1.30291 WP_003403880.1.30363 WP_003403880.1.30374 WP_003403880.1.30404 WP_003403880.1.3043 WP_003403880.1.30433 WP_003403880.1.30438 WP_003403880.1.30462 WP_003403880.1.30464 WP_003403880.1.30468 WP_003403880.1.30500 WP_003403880.1.3057 WP_003403880.1.30574 WP_003403880.1.30628 WP_003403880.1.30641 WP_003403880.1.30642 WP_003403880.1.30661 WP_003403880.1.30669 WP_003403880.1.30683 WP_003403880.1.30699 WP_003403880.1.30709 WP_003403880.1.30713 WP_003403880.1.30716 WP_003403880.1.30719 WP_003403880.1.30730 WP_003403880.1.30732 WP_003403880.1.30736 WP_003403880.1.30745 WP_003403880.1.30760 WP_003403880.1.30791 WP_003403880.1.308 WP_003403880.1.30807 WP_003403880.1.30818 WP_003403880.1.30824 WP_003403880.1.30848 WP_003403880.1.30877 WP_003403880.1.30888 WP_003403880.1.30901 WP_003403880.1.30903 WP_003403880.1.30912 WP_003403880.1.30913 WP_003403880.1.30914 WP_003403880.1.30919 WP_003403880.1.30977 WP_003403880.1.31002 WP_003403880.1.3101 WP_003403880.1.31034 WP_003403880.1.31047 WP_003403880.1.31070 WP_003403880.1.31074 WP_003403880.1.31102 WP_003403880.1.31184 WP_003403880.1.31226 WP_003403880.1.31233 WP_003403880.1.31263 WP_003403880.1.31264 WP_003403880.1.31270 WP_003403880.1.31287 WP_003403880.1.31290 WP_003403880.1.31304 WP_003403880.1.31346 WP_003403880.1.31348 WP_003403880.1.31354 WP_003403880.1.31390 WP_003403880.1.31414 WP_003403880.1.31417 WP_003403880.1.31428 WP_003403880.1.3143 WP_003403880.1.31458 WP_003403880.1.31483 WP_003403880.1.3149 WP_003403880.1.31498 WP_003403880.1.31507 WP_003403880.1.31537 WP_003403880.1.31548 WP_003403880.1.31569 WP_003403880.1.31573 WP_003403880.1.316 WP_003403880.1.31629 WP_003403880.1.31666 WP_003403880.1.31693 WP_003403880.1.31703 WP_003403880.1.31744 WP_003403880.1.31745 WP_003403880.1.31770 WP_003403880.1.31776 WP_003403880.1.31783 WP_003403880.1.318 WP_003403880.1.3184 WP_003403880.1.31840 WP_003403880.1.31880 WP_003403880.1.31911 WP_003403880.1.31930 WP_003403880.1.31932 WP_003403880.1.31955 WP_003403880.1.31985 WP_003403880.1.31991 WP_003403880.1.32004 WP_003403880.1.32039 WP_003403880.1.3204 WP_003403880.1.32045 WP_003403880.1.32071 WP_003403880.1.32098 WP_003403880.1.32132 WP_003403880.1.32157 WP_003403880.1.32164 WP_003403880.1.32179 WP_003403880.1.32297 WP_003403880.1.32317 WP_003403880.1.32383 WP_003403880.1.32400 WP_003403880.1.32403 WP_003403880.1.32416 WP_003403880.1.32421 WP_003403880.1.32433 WP_003403880.1.32461 WP_003403880.1.32482 WP_003403880.1.32503 WP_003403880.1.32556 WP_003403880.1.32562 WP_003403880.1.32569 WP_003403880.1.32592 WP_003403880.1.32620 WP_003403880.1.32647 WP_003403880.1.32653 WP_003403880.1.32654 WP_003403880.1.3268 WP_003403880.1.32695 WP_003403880.1.32706 WP_003403880.1.32716 WP_003403880.1.32752 WP_003403880.1.32780 WP_003403880.1.32781 WP_003403880.1.32793 WP_003403880.1.32799 WP_003403880.1.32822 WP_003403880.1.32833 WP_003403880.1.32862 WP_003403880.1.32880 WP_003403880.1.32897 WP_003403880.1.32909 WP_003403880.1.32974 WP_003403880.1.33007 WP_003403880.1.3302 WP_003403880.1.33028 WP_003403880.1.33035 WP_003403880.1.33044 WP_003403880.1.33054 WP_003403880.1.33082 WP_003403880.1.33141 WP_003403880.1.33148 WP_003403880.1.33155 WP_003403880.1.33168 WP_003403880.1.3321 WP_003403880.1.33215 WP_003403880.1.3325 WP_003403880.1.3327 WP_003403880.1.33278 WP_003403880.1.33288 WP_003403880.1.33305 WP_003403880.1.3331 WP_003403880.1.3333 WP_003403880.1.33393 WP_003403880.1.33403 WP_003403880.1.33452 WP_003403880.1.33467 WP_003403880.1.33477 WP_003403880.1.3349 WP_003403880.1.33519 WP_003403880.1.33542 WP_003403880.1.33601 WP_003403880.1.33633 WP_003403880.1.33646 WP_003403880.1.33673 WP_003403880.1.3369 WP_003403880.1.33705 WP_003403880.1.33762 WP_003403880.1.33783 WP_003403880.1.33789 WP_003403880.1.3383 WP_003403880.1.33832 WP_003403880.1.33839 WP_003403880.1.33848 WP_003403880.1.3387 WP_003403880.1.33886 WP_003403880.1.33895 WP_003403880.1.33906 WP_003403880.1.33912 WP_003403880.1.33954 WP_003403880.1.3399 WP_003403880.1.34042 WP_003403880.1.3405 WP_003403880.1.34055 WP_003403880.1.34056 WP_003403880.1.34065 WP_003403880.1.3408 WP_003403880.1.34090 WP_003403880.1.34109 WP_003403880.1.34111 WP_003403880.1.34131 WP_003403880.1.34152 WP_003403880.1.34153 WP_003403880.1.34163 WP_003403880.1.34181 WP_003403880.1.34197 WP_003403880.1.34198 WP_003403880.1.34215 WP_003403880.1.34219 WP_003403880.1.34255 WP_003403880.1.34260 WP_003403880.1.34275 WP_003403880.1.343 WP_003403880.1.34358 WP_003403880.1.34392 WP_003403880.1.344 WP_003403880.1.34428 WP_003403880.1.3443 WP_003403880.1.34435 WP_003403880.1.34446 WP_003403880.1.34499 WP_003403880.1.34505 WP_003403880.1.34516 WP_003403880.1.34529 WP_003403880.1.34551 WP_003403880.1.34563 WP_003403880.1.34576 WP_003403880.1.34581 WP_003403880.1.34588 WP_003403880.1.34596 WP_003403880.1.34599 WP_003403880.1.34639 WP_003403880.1.34673 WP_003403880.1.34724 WP_003403880.1.34740 WP_003403880.1.34755 WP_003403880.1.34777 WP_003403880.1.34783 WP_003403880.1.34841 WP_003403880.1.34908 WP_003403880.1.34919 WP_003403880.1.3492 WP_003403880.1.34933 WP_003403880.1.34946 WP_003403880.1.34954 WP_003403880.1.34961 WP_003403880.1.34963 WP_003403880.1.34965 WP_003403880.1.34968 WP_003403880.1.35023 WP_003403880.1.35069 WP_003403880.1.35072 WP_003403880.1.35078 WP_003403880.1.35100 WP_003403880.1.35146 WP_003403880.1.35160 WP_003403880.1.35162 WP_003403880.1.35173 WP_003403880.1.35176 WP_003403880.1.3520 WP_003403880.1.35213 WP_003403880.1.35221 WP_003403880.1.35246 WP_003403880.1.35278 WP_003403880.1.35301 WP_003403880.1.35311 WP_003403880.1.35312 WP_003403880.1.35319 WP_003403880.1.35347 WP_003403880.1.35363 WP_003403880.1.35382 WP_003403880.1.35385 WP_003403880.1.35396 WP_003403880.1.35397 WP_003403880.1.35426 WP_003403880.1.35439 WP_003403880.1.35455 WP_003403880.1.3548 WP_003403880.1.35484 WP_003403880.1.35492 WP_003403880.1.3553 WP_003403880.1.35553 WP_003403880.1.35555 WP_003403880.1.35561 WP_003403880.1.35602 WP_003403880.1.35610 WP_003403880.1.35635 WP_003403880.1.35657 WP_003403880.1.35680 WP_003403880.1.35689 WP_003403880.1.35732 WP_003403880.1.35767 WP_003403880.1.35770 WP_003403880.1.35780 WP_003403880.1.35805 WP_003403880.1.35811 WP_003403880.1.35821 WP_003403880.1.3584 WP_003403880.1.35848 WP_003403880.1.35864 WP_003403880.1.35874 WP_003403880.1.35876 WP_003403880.1.35897 WP_003403880.1.35899 WP_003403880.1.35923 WP_003403880.1.3593 WP_003403880.1.35954 WP_003403880.1.36005 WP_003403880.1.36014 WP_003403880.1.36023 WP_003403880.1.36051 WP_003403880.1.36053 WP_003403880.1.36075 WP_003403880.1.36089 WP_003403880.1.36097 WP_003403880.1.36098 WP_003403880.1.36116 WP_003403880.1.36145 WP_003403880.1.36156 WP_003403880.1.36205 WP_003403880.1.36228 WP_003403880.1.36246 WP_003403880.1.36252 WP_003403880.1.36260 WP_003403880.1.36270 WP_003403880.1.36271 WP_003403880.1.36303 WP_003403880.1.36309 WP_003403880.1.36315 WP_003403880.1.36319 WP_003403880.1.36321 WP_003403880.1.36326 WP_003403880.1.3634 WP_003403880.1.36356 WP_003403880.1.36357 WP_003403880.1.3636 WP_003403880.1.36385 WP_003403880.1.36399 WP_003403880.1.36436 WP_003403880.1.36465 WP_003403880.1.36469 WP_003403880.1.36473 WP_003403880.1.36485 WP_003403880.1.36508 WP_003403880.1.36540 WP_003403880.1.36561 WP_003403880.1.36571 WP_003403880.1.36573 WP_003403880.1.36578 WP_003403880.1.36585 WP_003403880.1.36597 WP_003403880.1.36614 WP_003403880.1.36657 WP_003403880.1.36674 WP_003403880.1.36720 WP_003403880.1.36727 WP_003403880.1.36733 WP_003403880.1.36785 WP_003403880.1.36810 WP_003403880.1.36844 WP_003403880.1.36851 WP_003403880.1.36862 WP_003403880.1.36893 WP_003403880.1.36901 WP_003403880.1.36921 WP_003403880.1.36935 WP_003403880.1.36941 WP_003403880.1.3695 WP_003403880.1.36951 WP_003403880.1.3700 WP_003403880.1.37004 WP_003403880.1.37012 WP_003403880.1.37071 WP_003403880.1.37088 WP_003403880.1.37131 WP_003403880.1.37157 WP_003403880.1.37175 WP_003403880.1.37188 WP_003403880.1.37213 WP_003403880.1.37229 WP_003403880.1.3724 WP_003403880.1.37277 WP_003403880.1.37305 WP_003403880.1.37330 WP_003403880.1.37389 WP_003403880.1.37400 WP_003403880.1.37440 WP_003403880.1.37468 WP_003403880.1.37475 WP_003403880.1.37484 WP_003403880.1.37601 WP_003403880.1.37612 WP_003403880.1.37632 WP_003403880.1.37643 WP_003403880.1.37655 WP_003403880.1.37660 WP_003403880.1.37674 WP_003403880.1.37700 WP_003403880.1.37701 WP_003403880.1.37709 WP_003403880.1.37711 WP_003403880.1.37721 WP_003403880.1.37722 WP_003403880.1.37747 WP_003403880.1.37765 WP_003403880.1.37772 WP_003403880.1.37804 WP_003403880.1.37859 WP_003403880.1.37877 WP_003403880.1.37912 WP_003403880.1.37913 WP_003403880.1.37943 WP_003403880.1.37950 WP_003403880.1.37973 WP_003403880.1.37975 WP_003403880.1.37983 WP_003403880.1.38 WP_003403880.1.38002 WP_003403880.1.3802 WP_003403880.1.38039 WP_003403880.1.38040 WP_003403880.1.38067 WP_003403880.1.38068 WP_003403880.1.38135 WP_003403880.1.38138 WP_003403880.1.38144 WP_003403880.1.38158 WP_003403880.1.38159 WP_003403880.1.38210 WP_003403880.1.38233 WP_003403880.1.38240 WP_003403880.1.38299 WP_003403880.1.38332 WP_003403880.1.38347 WP_003403880.1.38354 WP_003403880.1.38380 WP_003403880.1.38384 WP_003403880.1.38389 WP_003403880.1.38398 WP_003403880.1.38402 WP_003403880.1.38418 WP_003403880.1.38421 WP_003403880.1.38466 WP_003403880.1.38477 WP_003403880.1.38483 WP_003403880.1.3849 WP_003403880.1.385 WP_003403880.1.38530 WP_003403880.1.38535 WP_003403880.1.38539 WP_003403880.1.38594 WP_003403880.1.38601 WP_003403880.1.38611 WP_003403880.1.38638 WP_003403880.1.38639 WP_003403880.1.38646 WP_003403880.1.38648 WP_003403880.1.38654 WP_003403880.1.38659 WP_003403880.1.38660 WP_003403880.1.38666 WP_003403880.1.38671 WP_003403880.1.38677 WP_003403880.1.38750 WP_003403880.1.38772 WP_003403880.1.38812 WP_003403880.1.38821 WP_003403880.1.38844 WP_003403880.1.38863 WP_003403880.1.38865 WP_003403880.1.38873 WP_003403880.1.3889 WP_003403880.1.38894 WP_003403880.1.38909 WP_003403880.1.38939 WP_003403880.1.38974 WP_003403880.1.38975 WP_003403880.1.38991 WP_003403880.1.39025 WP_003403880.1.39070 WP_003403880.1.39072 WP_003403880.1.39095 WP_003403880.1.39106 WP_003403880.1.39165 WP_003403880.1.39174 WP_003403880.1.39176 WP_003403880.1.39178 WP_003403880.1.39190 WP_003403880.1.39201 WP_003403880.1.39207 WP_003403880.1.39211 WP_003403880.1.39236 WP_003403880.1.39239 WP_003403880.1.39252 WP_003403880.1.39288 WP_003403880.1.39295 WP_003403880.1.39306 WP_003403880.1.39359 WP_003403880.1.39364 WP_003403880.1.39400 WP_003403880.1.39447 WP_003403880.1.3945 WP_003403880.1.39450 WP_003403880.1.39455 WP_003403880.1.3949 WP_003403880.1.39521 WP_003403880.1.39560 WP_003403880.1.39592 WP_003403880.1.39593 WP_003403880.1.396 WP_003403880.1.3960 WP_003403880.1.39654 WP_003403880.1.39657 WP_003403880.1.39661 WP_003403880.1.39674 WP_003403880.1.39678 WP_003403880.1.3968 WP_003403880.1.39694 WP_003403880.1.3971 WP_003403880.1.39718 WP_003403880.1.39728 WP_003403880.1.39739 WP_003403880.1.39748 WP_003403880.1.39751 WP_003403880.1.39759 WP_003403880.1.39801 WP_003403880.1.39804 WP_003403880.1.39848 WP_003403880.1.39877 WP_003403880.1.39925 WP_003403880.1.3994 WP_003403880.1.39959 WP_003403880.1.3996 WP_003403880.1.39960 WP_003403880.1.3997 WP_003403880.1.39980 WP_003403880.1.40000 WP_003403880.1.40028 WP_003403880.1.40029 WP_003403880.1.4003 WP_003403880.1.40094 WP_003403880.1.40096 WP_003403880.1.40150 WP_003403880.1.40174 WP_003403880.1.40186 WP_003403880.1.40276 WP_003403880.1.40323 WP_003403880.1.40336 WP_003403880.1.40353 WP_003403880.1.40413 WP_003403880.1.40440 WP_003403880.1.40446 WP_003403880.1.40451 WP_003403880.1.40455 WP_003403880.1.40523 WP_003403880.1.40543 WP_003403880.1.40641 WP_003403880.1.40646 WP_003403880.1.40651 WP_003403880.1.40653 WP_003403880.1.4067 WP_003403880.1.40705 WP_003403880.1.40723 WP_003403880.1.40731 WP_003403880.1.40735 WP_003403880.1.40795 WP_003403880.1.40799 WP_003403880.1.40852 WP_003403880.1.40876 WP_003403880.1.40881 WP_003403880.1.40922 WP_003403880.1.40948 WP_003403880.1.4095 WP_003403880.1.40956 WP_003403880.1.40957 WP_003403880.1.40964 WP_003403880.1.4097 WP_003403880.1.410 WP_003403880.1.41000 WP_003403880.1.41055 WP_003403880.1.41108 WP_003403880.1.41123 WP_003403880.1.41177 WP_003403880.1.41202 WP_003403880.1.41219 WP_003403880.1.41231 WP_003403880.1.41249 WP_003403880.1.4127 WP_003403880.1.41296 WP_003403880.1.41355 WP_003403880.1.41376 WP_003403880.1.41430 WP_003403880.1.41447 WP_003403880.1.41469 WP_003403880.1.41504 WP_003403880.1.41553 WP_003403880.1.41564 WP_003403880.1.41583 WP_003403880.1.41616 WP_003403880.1.41635 WP_003403880.1.41636 WP_003403880.1.41648 WP_003403880.1.41660 WP_003403880.1.41685 WP_003403880.1.41695 WP_003403880.1.41704 WP_003403880.1.4171 WP_003403880.1.41719 WP_003403880.1.41733 WP_003403880.1.41744 WP_003403880.1.41774 WP_003403880.1.41791 WP_003403880.1.41820 WP_003403880.1.41828 WP_003403880.1.41829 WP_003403880.1.41860 WP_003403880.1.41912 WP_003403880.1.41933 WP_003403880.1.41944 WP_003403880.1.42043 WP_003403880.1.42075 WP_003403880.1.42078 WP_003403880.1.42094 WP_003403880.1.42112 WP_003403880.1.4212 WP_003403880.1.42134 WP_003403880.1.42183 WP_003403880.1.42188 WP_003403880.1.42201 WP_003403880.1.42202 WP_003403880.1.42208 WP_003403880.1.42247 WP_003403880.1.42255 WP_003403880.1.42273 WP_003403880.1.42278 WP_003403880.1.42304 WP_003403880.1.42370 WP_003403880.1.42385 WP_003403880.1.42400 WP_003403880.1.42409 WP_003403880.1.42414 WP_003403880.1.42417 WP_003403880.1.42430 WP_003403880.1.42461 WP_003403880.1.42465 WP_003403880.1.42467 WP_003403880.1.42473 WP_003403880.1.42474 WP_003403880.1.4248 WP_003403880.1.42494 WP_003403880.1.42519 WP_003403880.1.42524 WP_003403880.1.42534 WP_003403880.1.4255 WP_003403880.1.42562 WP_003403880.1.42568 WP_003403880.1.42570 WP_003403880.1.42618 WP_003403880.1.42660 WP_003403880.1.42695 WP_003403880.1.42704 WP_003403880.1.42705 WP_003403880.1.42777 WP_003403880.1.42782 WP_003403880.1.42835 WP_003403880.1.42839 WP_003403880.1.42842 WP_003403880.1.42905 WP_003403880.1.42916 WP_003403880.1.42930 WP_003403880.1.42971 WP_003403880.1.43005 WP_003403880.1.43009 WP_003403880.1.43053 WP_003403880.1.43082 WP_003403880.1.43087 WP_003403880.1.43098 WP_003403880.1.43208 WP_003403880.1.43236 WP_003403880.1.43246 WP_003403880.1.43255 WP_003403880.1.43266 WP_003403880.1.43269 WP_003403880.1.43273 WP_003403880.1.43296 WP_003403880.1.43306 WP_003403880.1.4335 WP_003403880.1.43368 WP_003403880.1.43395 WP_003403880.1.43457 WP_003403880.1.43462 WP_003403880.1.43475 WP_003403880.1.43478 WP_003403880.1.43484 WP_003403880.1.43557 WP_003403880.1.43578 WP_003403880.1.43588 WP_003403880.1.43643 WP_003403880.1.43664 WP_003403880.1.43684 WP_003403880.1.43686 WP_003403880.1.43706 WP_003403880.1.43716 WP_003403880.1.4377 WP_003403880.1.43781 WP_003403880.1.43794 WP_003403880.1.43815 WP_003403880.1.43846 WP_003403880.1.43861 WP_003403880.1.43863 WP_003403880.1.43866 WP_003403880.1.43872 WP_003403880.1.43885 WP_003403880.1.43897 WP_003403880.1.4390 WP_003403880.1.43902 WP_003403880.1.43921 WP_003403880.1.43936 WP_003403880.1.43937 WP_003403880.1.43960 WP_003403880.1.43965 WP_003403880.1.4399 WP_003403880.1.43993 WP_003403880.1.43996 WP_003403880.1.44 WP_003403880.1.44001 WP_003403880.1.44008 WP_003403880.1.44016 WP_003403880.1.44033 WP_003403880.1.44037 WP_003403880.1.44041 WP_003403880.1.44070 WP_003403880.1.44071 WP_003403880.1.44076 WP_003403880.1.44104 WP_003403880.1.44111 WP_003403880.1.44124 WP_003403880.1.44169 WP_003403880.1.44219 WP_003403880.1.44237 WP_003403880.1.44277 WP_003403880.1.44279 WP_003403880.1.44336 WP_003403880.1.44355 WP_003403880.1.44358 WP_003403880.1.4438 WP_003403880.1.44390 WP_003403880.1.44392 WP_003403880.1.4441 WP_003403880.1.44415 WP_003403880.1.44464 WP_003403880.1.44466 WP_003403880.1.44489 WP_003403880.1.44492 WP_003403880.1.44494 WP_003403880.1.44500 WP_003403880.1.44519 WP_003403880.1.44526 WP_003403880.1.44532 WP_003403880.1.44534 WP_003403880.1.44589 WP_003403880.1.44597 WP_003403880.1.44600 WP_003403880.1.44615 WP_003403880.1.4464 WP_003403880.1.44651 WP_003403880.1.44659 WP_003403880.1.44665 WP_003403880.1.44694 WP_003403880.1.44713 WP_003403880.1.44735 WP_003403880.1.44740 WP_003403880.1.44757 WP_003403880.1.4476 WP_003403880.1.44761 WP_003403880.1.44767 WP_003403880.1.44776 WP_003403880.1.44779 WP_003403880.1.44786 WP_003403880.1.44808 WP_003403880.1.44864 WP_003403880.1.44901 WP_003403880.1.44908 WP_003403880.1.44913 WP_003403880.1.44939 WP_003403880.1.44981 WP_003403880.1.45002 WP_003403880.1.45011 WP_003403880.1.4504 WP_003403880.1.45066 WP_003403880.1.45081 WP_003403880.1.45113 WP_003403880.1.45129 WP_003403880.1.45135 WP_003403880.1.45147 WP_003403880.1.45168 WP_003403880.1.4517 WP_003403880.1.45181 WP_003403880.1.45185 WP_003403880.1.45192 WP_003403880.1.45200 WP_003403880.1.45205 WP_003403880.1.45211 WP_003403880.1.45249 WP_003403880.1.4526 WP_003403880.1.45286 WP_003403880.1.45347 WP_003403880.1.45374 WP_003403880.1.45390 WP_003403880.1.454 WP_003403880.1.45407 WP_003403880.1.45451 WP_003403880.1.45453 WP_003403880.1.45460 WP_003403880.1.45463 WP_003403880.1.45470 WP_003403880.1.45474 WP_003403880.1.45491 WP_003403880.1.45510 WP_003403880.1.45563 WP_003403880.1.45584 WP_003403880.1.45590 WP_003403880.1.45619 WP_003403880.1.45626 WP_003403880.1.45666 WP_003403880.1.45697 WP_003403880.1.4571 WP_003403880.1.45731 WP_003403880.1.45743 WP_003403880.1.45765 WP_003403880.1.45776 WP_003403880.1.45783 WP_003403880.1.45805 WP_003403880.1.45815 WP_003403880.1.45849 WP_003403880.1.45867 WP_003403880.1.45884 WP_003403880.1.4590 WP_003403880.1.45923 WP_003403880.1.45926 WP_003403880.1.45963 WP_003403880.1.45989 WP_003403880.1.45992 WP_003403880.1.46025 WP_003403880.1.46083 WP_003403880.1.46090 WP_003403880.1.46092 WP_003403880.1.46100 WP_003403880.1.46101 WP_003403880.1.46103 WP_003403880.1.46107 WP_003403880.1.46127 WP_003403880.1.46128 WP_003403880.1.46129 WP_003403880.1.46141 WP_003403880.1.46150 WP_003403880.1.46201 WP_003403880.1.46226 WP_003403880.1.4624 WP_003403880.1.46253 WP_003403880.1.46268 WP_003403880.1.46285 WP_003403880.1.46300 WP_003403880.1.46313 WP_003403880.1.46336 WP_003403880.1.46365 WP_003403880.1.46370 WP_003403880.1.46381 WP_003403880.1.46402 WP_003403880.1.46411 WP_003403880.1.4644 WP_003403880.1.46453 WP_003403880.1.46463 WP_003403880.1.46478 WP_003403880.1.46492 WP_003403880.1.46521 WP_003403880.1.4653 WP_003403880.1.46532 WP_003403880.1.46539 WP_003403880.1.46568 WP_003403880.1.46585 WP_003403880.1.46609 WP_003403880.1.46613 WP_003403880.1.46625 WP_003403880.1.46642 WP_003403880.1.46647 WP_003403880.1.46674 WP_003403880.1.46724 WP_003403880.1.46758 WP_003403880.1.46773 WP_003403880.1.46777 WP_003403880.1.46786 WP_003403880.1.46792 WP_003403880.1.46847 WP_003403880.1.46851 WP_003403880.1.4687 WP_003403880.1.46897 WP_003403880.1.46936 WP_003403880.1.46980 WP_003403880.1.47011 WP_003403880.1.47012 WP_003403880.1.47066 WP_003403880.1.47077 WP_003403880.1.47083 WP_003403880.1.47106 WP_003403880.1.47142 WP_003403880.1.47147 WP_003403880.1.47166 WP_003403880.1.47178 WP_003403880.1.47179 WP_003403880.1.47194 WP_003403880.1.47207 WP_003403880.1.47210 WP_003403880.1.47261 WP_003403880.1.47262 WP_003403880.1.47402 WP_003403880.1.47423 WP_003403880.1.47467 WP_003403880.1.47502 WP_003403880.1.4751 WP_003403880.1.47511 WP_003403880.1.47537 WP_003403880.1.47540 WP_003403880.1.47568 WP_003403880.1.47588 WP_003403880.1.47636 WP_003403880.1.4764 WP_003403880.1.47653 WP_003403880.1.47679 WP_003403880.1.47681 WP_003403880.1.47690 WP_003403880.1.4771 WP_003403880.1.47717 WP_003403880.1.47743 WP_003403880.1.47754 WP_003403880.1.47773 WP_003403880.1.47776 WP_003403880.1.47780 WP_003403880.1.47805 WP_003403880.1.47832 WP_003403880.1.47847 WP_003403880.1.47858 WP_003403880.1.47861 WP_003403880.1.47868 WP_003403880.1.47893 WP_003403880.1.47899 WP_003403880.1.479 WP_003403880.1.47912 WP_003403880.1.47913 WP_003403880.1.47926 WP_003403880.1.4794 WP_003403880.1.47943 WP_003403880.1.47944 WP_003403880.1.47959 WP_003403880.1.47974 WP_003403880.1.47993 WP_003403880.1.48004 WP_003403880.1.48039 WP_003403880.1.48050 WP_003403880.1.48084 WP_003403880.1.48097 WP_003403880.1.48101 WP_003403880.1.48109 WP_003403880.1.4813 WP_003403880.1.48130 WP_003403880.1.48135 WP_003403880.1.48143 WP_003403880.1.48152 WP_003403880.1.48155 WP_003403880.1.48170 WP_003403880.1.48173 WP_003403880.1.48177 WP_003403880.1.48185 WP_003403880.1.48219 WP_003403880.1.4823 WP_003403880.1.48240 WP_003403880.1.48256 WP_003403880.1.48264 WP_003403880.1.48287 WP_003403880.1.48330 WP_003403880.1.48348 WP_003403880.1.48354 WP_003403880.1.48372 WP_003403880.1.48383 WP_003403880.1.48388 WP_003403880.1.48419 WP_003403880.1.48423 WP_003403880.1.48443 WP_003403880.1.48450 WP_003403880.1.48462 WP_003403880.1.48543 WP_003403880.1.48550 WP_003403880.1.48605 WP_003403880.1.48618 WP_003403880.1.4863 WP_003403880.1.48648 WP_003403880.1.48658 WP_003403880.1.48666 WP_003403880.1.48687 WP_003403880.1.48779 WP_003403880.1.48798 WP_003403880.1.48802 WP_003403880.1.48826 WP_003403880.1.48831 WP_003403880.1.48843 WP_003403880.1.48857 WP_003403880.1.48946 WP_003403880.1.48979 WP_003403880.1.49017 WP_003403880.1.49048 WP_003403880.1.49059 WP_003403880.1.4906 WP_003403880.1.4907 WP_003403880.1.49103 WP_003403880.1.49110 WP_003403880.1.49111 WP_003403880.1.49112 WP_003403880.1.4919 WP_003403880.1.49254 WP_003403880.1.49263 WP_003403880.1.49291 WP_003403880.1.49296 WP_003403880.1.49335 WP_003403880.1.49337 WP_003403880.1.49419 WP_003403880.1.49426 WP_003403880.1.49437 WP_003403880.1.49439 WP_003403880.1.49474 WP_003403880.1.49506 WP_003403880.1.49516 WP_003403880.1.49523 WP_003403880.1.49526 WP_003403880.1.49532 WP_003403880.1.49588 WP_003403880.1.4959 WP_003403880.1.49678 WP_003403880.1.49687 WP_003403880.1.49699 WP_003403880.1.49709 WP_003403880.1.4971 WP_003403880.1.4972 WP_003403880.1.49736 WP_003403880.1.49746 WP_003403880.1.49764 WP_003403880.1.49773 WP_003403880.1.49796 WP_003403880.1.49814 WP_003403880.1.49815 WP_003403880.1.49816 WP_003403880.1.49839 WP_003403880.1.49857 WP_003403880.1.49878 WP_003403880.1.49880 WP_003403880.1.49944 WP_003403880.1.4999 WP_003403880.1.49990 WP_003403880.1.50068 WP_003403880.1.50077 WP_003403880.1.5008 WP_003403880.1.50081 WP_003403880.1.50122 WP_003403880.1.50126 WP_003403880.1.50149 WP_003403880.1.5018 WP_003403880.1.50194 WP_003403880.1.50218 WP_003403880.1.50235 WP_003403880.1.50249 WP_003403880.1.50265 WP_003403880.1.50271 WP_003403880.1.50324 WP_003403880.1.50372 WP_003403880.1.50398 WP_003403880.1.50407 WP_003403880.1.50444 WP_003403880.1.50466 WP_003403880.1.50472 WP_003403880.1.5048 WP_003403880.1.50498 WP_003403880.1.5050 WP_003403880.1.50540 WP_003403880.1.50554 WP_003403880.1.50557 WP_003403880.1.50601 WP_003403880.1.50610 WP_003403880.1.50632 WP_003403880.1.50633 WP_003403880.1.50642 WP_003403880.1.50655 WP_003403880.1.50659 WP_003403880.1.50683 WP_003403880.1.50689 WP_003403880.1.50692 WP_003403880.1.50714 WP_003403880.1.50729 WP_003403880.1.50756 WP_003403880.1.50784 WP_003403880.1.50794 WP_003403880.1.50841 WP_003403880.1.50860 WP_003403880.1.50868 WP_003403880.1.50877 WP_003403880.1.5096 WP_003403880.1.50981 WP_003403880.1.50987 WP_003403880.1.51003 WP_003403880.1.51037 WP_003403880.1.51074 WP_003403880.1.51082 WP_003403880.1.51101 WP_003403880.1.51116 WP_003403880.1.51149 WP_003403880.1.51157 WP_003403880.1.51213 WP_003403880.1.51232 WP_003403880.1.51239 WP_003403880.1.51247 WP_003403880.1.51266 WP_003403880.1.51279 WP_003403880.1.51291 WP_003403880.1.51294 WP_003403880.1.51301 WP_003403880.1.51329 WP_003403880.1.51391 WP_003403880.1.51422 WP_003403880.1.51455 WP_003403880.1.51466 WP_003403880.1.51468 WP_003403880.1.51478 WP_003403880.1.51497 WP_003403880.1.51520 WP_003403880.1.51593 WP_003403880.1.51628 WP_003403880.1.5164 WP_003403880.1.51647 WP_003403880.1.51660 WP_003403880.1.51721 WP_003403880.1.51788 WP_003403880.1.51795 WP_003403880.1.51801 WP_003403880.1.51817 WP_003403880.1.51819 WP_003403880.1.51854 WP_003403880.1.51923 WP_003403880.1.51942 WP_003403880.1.51948 WP_003403880.1.51963 WP_003403880.1.51969 WP_003403880.1.52000 WP_003403880.1.52001 WP_003403880.1.52006 WP_003403880.1.52036 WP_003403880.1.52038 WP_003403880.1.52046 WP_003403880.1.52059 WP_003403880.1.52069 WP_003403880.1.52082 WP_003403880.1.52102 WP_003403880.1.52106 WP_003403880.1.52166 WP_003403880.1.52168 WP_003403880.1.52173 WP_003403880.1.52178 WP_003403880.1.52206 WP_003403880.1.52216 WP_003403880.1.52238 WP_003403880.1.52241 WP_003403880.1.52280 WP_003403880.1.52314 WP_003403880.1.52385 WP_003403880.1.52390 WP_003403880.1.524 WP_003403880.1.52460 WP_003403880.1.52485 WP_003403880.1.52486 WP_003403880.1.52495 WP_003403880.1.52504 WP_003403880.1.52522 WP_003403880.1.52531 WP_003403880.1.52533 WP_003403880.1.52545 WP_003403880.1.52563 WP_003403880.1.52564 WP_003403880.1.52574 WP_003403880.1.52641 WP_003403880.1.52673 WP_003403880.1.52674 WP_003403880.1.52708 WP_003403880.1.52761 WP_003403880.1.52778 WP_003403880.1.52791 WP_003403880.1.52797 WP_003403880.1.52818 WP_003403880.1.52872 WP_003403880.1.52873 WP_003403880.1.52891 WP_003403880.1.52892 WP_003403880.1.52909 WP_003403880.1.52970 WP_003403880.1.52998 WP_003403880.1.53053 WP_003403880.1.53056 WP_003403880.1.5306 WP_003403880.1.53088 WP_003403880.1.5309 WP_003403880.1.531 WP_003403880.1.53117 WP_003403880.1.53118 WP_003403880.1.53142 WP_003403880.1.53143 WP_003403880.1.53157 WP_003403880.1.53167 WP_003403880.1.53200 WP_003403880.1.53204 WP_003403880.1.53217 WP_003403880.1.53226 WP_003403880.1.53229 WP_003403880.1.53230 WP_003403880.1.53237 WP_003403880.1.53254 WP_003403880.1.53257 WP_003403880.1.5327 WP_003403880.1.53276 WP_003403880.1.53278 WP_003403880.1.533 WP_003403880.1.53302 WP_003403880.1.53306 WP_003403880.1.5334 WP_003403880.1.5335 WP_003403880.1.53353 WP_003403880.1.53413 WP_003403880.1.53458 WP_003403880.1.53460 WP_003403880.1.53480 WP_003403880.1.53517 WP_003403880.1.53522 WP_003403880.1.53525 WP_003403880.1.53526 WP_003403880.1.53553 WP_003403880.1.53606 WP_003403880.1.53609 WP_003403880.1.53628 WP_003403880.1.53643 WP_003403880.1.53667 WP_003403880.1.53679 WP_003403880.1.53715 WP_003403880.1.53730 WP_003403880.1.53742 WP_003403880.1.53743 WP_003403880.1.53775 WP_003403880.1.53787 WP_003403880.1.53818 WP_003403880.1.53822 WP_003403880.1.53853 WP_003403880.1.53865 WP_003403880.1.53888 WP_003403880.1.53900 WP_003403880.1.53912 WP_003403880.1.53914 WP_003403880.1.53952 WP_003403880.1.5398 WP_003403880.1.5408 WP_003403880.1.54089 WP_003403880.1.54093 WP_003403880.1.54099 WP_003403880.1.54112 WP_003403880.1.54125 WP_003403880.1.54162 WP_003403880.1.54179 WP_003403880.1.54206 WP_003403880.1.54218 WP_003403880.1.54225 WP_003403880.1.54227 WP_003403880.1.54232 WP_003403880.1.54241 WP_003403880.1.54245 WP_003403880.1.54247 WP_003403880.1.54260 WP_003403880.1.54280 WP_003403880.1.5429 WP_003403880.1.54294 WP_003403880.1.54314 WP_003403880.1.54347 WP_003403880.1.54351 WP_003403880.1.54370 WP_003403880.1.54428 WP_003403880.1.54449 WP_003403880.1.54494 WP_003403880.1.54502 WP_003403880.1.54514 WP_003403880.1.54519 WP_003403880.1.5452 WP_003403880.1.54531 WP_003403880.1.54537 WP_003403880.1.54553 WP_003403880.1.54555 WP_003403880.1.54575 WP_003403880.1.54633 WP_003403880.1.54686 WP_003403880.1.54687 WP_003403880.1.54705 WP_003403880.1.54730 WP_003403880.1.54732 WP_003403880.1.5475 WP_003403880.1.54797 WP_003403880.1.54807 WP_003403880.1.54836 WP_003403880.1.54838 WP_003403880.1.54888 WP_003403880.1.54897 WP_003403880.1.54905 WP_003403880.1.54937 WP_003403880.1.54939 WP_003403880.1.54944 WP_003403880.1.54945 WP_003403880.1.54953 WP_003403880.1.54964 WP_003403880.1.55015 WP_003403880.1.55022 WP_003403880.1.55023 WP_003403880.1.55051 WP_003403880.1.55072 WP_003403880.1.55088 WP_003403880.1.55106 WP_003403880.1.55126 WP_003403880.1.55128 WP_003403880.1.55150 WP_003403880.1.55227 WP_003403880.1.55248 WP_003403880.1.55257 WP_003403880.1.55258 WP_003403880.1.55267 WP_003403880.1.55279 WP_003403880.1.55307 WP_003403880.1.55326 WP_003403880.1.55328 WP_003403880.1.5533 WP_003403880.1.55345 WP_003403880.1.55396 WP_003403880.1.55398 WP_003403880.1.55441 WP_003403880.1.55459 WP_003403880.1.55501 WP_003403880.1.55504 WP_003403880.1.55578 WP_003403880.1.55626 WP_003403880.1.55641 WP_003403880.1.5569 WP_003403880.1.55723 WP_003403880.1.55735 WP_003403880.1.5574 WP_003403880.1.55772 WP_003403880.1.55802 WP_003403880.1.55807 WP_003403880.1.55819 WP_003403880.1.55821 WP_003403880.1.5583 WP_003403880.1.55856 WP_003403880.1.55860 WP_003403880.1.55883 WP_003403880.1.55902 WP_003403880.1.55908 WP_003403880.1.55909 WP_003403880.1.5591 WP_003403880.1.55961 WP_003403880.1.55977 WP_003403880.1.55983 WP_003403880.1.56028 WP_003403880.1.56057 WP_003403880.1.56060 WP_003403880.1.56107 WP_003403880.1.56132 WP_003403880.1.56163 WP_003403880.1.56167 WP_003403880.1.56178 WP_003403880.1.56287 WP_003403880.1.56292 WP_003403880.1.56327 WP_003403880.1.56341 WP_003403880.1.56359 WP_003403880.1.56365 WP_003403880.1.56394 WP_003403880.1.56443 WP_003403880.1.56473 WP_003403880.1.56478 WP_003403880.1.56500 WP_003403880.1.56517 WP_003403880.1.56534 WP_003403880.1.5656 WP_003403880.1.56577 WP_003403880.1.56593 WP_003403880.1.56625 WP_003403880.1.56637 WP_003403880.1.56670 WP_003403880.1.56697 WP_003403880.1.567 WP_003403880.1.56701 WP_003403880.1.56709 WP_003403880.1.56729 WP_003403880.1.56743 WP_003403880.1.56755 WP_003403880.1.56764 WP_003403880.1.56769 WP_003403880.1.56770 WP_003403880.1.56795 WP_003403880.1.5681 WP_003403880.1.56827 WP_003403880.1.56839 WP_003403880.1.56868 WP_003403880.1.56915 WP_003403880.1.56926 WP_003403880.1.56961 WP_003403880.1.56971 WP_003403880.1.56972 WP_003403880.1.57023 WP_003403880.1.57035 WP_003403880.1.57077 WP_003403880.1.57087 WP_003403880.1.57094 WP_003403880.1.57134 WP_003403880.1.57151 WP_003403880.1.57169 WP_003403880.1.57208 WP_003403880.1.57212 WP_003403880.1.57230 WP_003403880.1.5724 WP_003403880.1.5725 WP_003403880.1.5727 WP_003403880.1.57273 WP_003403880.1.573 WP_003403880.1.57314 WP_003403880.1.57326 WP_003403880.1.57331 WP_003403880.1.57340 WP_003403880.1.57351 WP_003403880.1.57352 WP_003403880.1.57380 WP_003403880.1.57430 WP_003403880.1.5744 WP_003403880.1.57440 WP_003403880.1.5745 WP_003403880.1.57461 WP_003403880.1.57469 WP_003403880.1.57489 WP_003403880.1.575 WP_003403880.1.57509 WP_003403880.1.57519 WP_003403880.1.57525 WP_003403880.1.57551 WP_003403880.1.5758 WP_003403880.1.57596 WP_003403880.1.57604 WP_003403880.1.57616 WP_003403880.1.57617 WP_003403880.1.57619 WP_003403880.1.57627 WP_003403880.1.57642 WP_003403880.1.57658 WP_003403880.1.57667 WP_003403880.1.57675 WP_003403880.1.57689 WP_003403880.1.57708 WP_003403880.1.57794 WP_003403880.1.57821 WP_003403880.1.57825 WP_003403880.1.57843 WP_003403880.1.57906 WP_003403880.1.57924 WP_003403880.1.57926 WP_003403880.1.57930 WP_003403880.1.57957 WP_003403880.1.57960 WP_003403880.1.57964 WP_003403880.1.57991 WP_003403880.1.58000 WP_003403880.1.58086 WP_003403880.1.58101 WP_003403880.1.58103 WP_003403880.1.58108 WP_003403880.1.5811 WP_003403880.1.58121 WP_003403880.1.58145 WP_003403880.1.58164 WP_003403880.1.58174 WP_003403880.1.582 WP_003403880.1.58202 WP_003403880.1.58209 WP_003403880.1.58215 WP_003403880.1.5824 WP_003403880.1.58250 WP_003403880.1.58259 WP_003403880.1.58283 WP_003403880.1.58288 WP_003403880.1.5830 WP_003403880.1.58303 WP_003403880.1.58311 WP_003403880.1.58330 WP_003403880.1.58359 WP_003403880.1.58386 WP_003403880.1.58393 WP_003403880.1.58431 WP_003403880.1.5844 WP_003403880.1.58457 WP_003403880.1.58488 WP_003403880.1.58518 WP_003403880.1.58534 WP_003403880.1.58559 WP_003403880.1.58567 WP_003403880.1.58573 WP_003403880.1.58602 WP_003403880.1.58612 WP_003403880.1.58619 WP_003403880.1.58630 WP_003403880.1.5865 WP_003403880.1.58671 WP_003403880.1.58690 WP_003403880.1.58702 WP_003403880.1.58743 WP_003403880.1.58754 WP_003403880.1.5881 WP_003403880.1.58824 WP_003403880.1.58848 WP_003403880.1.58857 WP_003403880.1.58891 WP_003403880.1.58892 WP_003403880.1.5890 WP_003403880.1.58921 WP_003403880.1.58930 WP_003403880.1.58939 WP_003403880.1.58941 WP_003403880.1.58953 WP_003403880.1.58961 WP_003403880.1.5898 WP_003403880.1.59025 WP_003403880.1.59029 WP_003403880.1.59037 WP_003403880.1.59044 WP_003403880.1.59085 WP_003403880.1.59088 WP_003403880.1.59112 WP_003403880.1.59130 WP_003403880.1.5914 WP_003403880.1.59147 WP_003403880.1.59166 WP_003403880.1.59205 WP_003403880.1.59209 WP_003403880.1.59237 WP_003403880.1.59240 WP_003403880.1.59253 WP_003403880.1.59254 WP_003403880.1.59262 WP_003403880.1.59270 WP_003403880.1.5928 WP_003403880.1.59304 WP_003403880.1.59305 WP_003403880.1.59309 WP_003403880.1.59316 WP_003403880.1.59326 WP_003403880.1.59328 WP_003403880.1.59333 WP_003403880.1.59338 WP_003403880.1.59388 WP_003403880.1.59428 WP_003403880.1.59487 WP_003403880.1.59537 WP_003403880.1.59561 WP_003403880.1.59677 WP_003403880.1.59722 WP_003403880.1.59727 WP_003403880.1.59732 WP_003403880.1.59738 WP_003403880.1.59750 WP_003403880.1.59757 WP_003403880.1.59761 WP_003403880.1.59850 WP_003403880.1.59856 WP_003403880.1.59861 WP_003403880.1.5987 WP_003403880.1.59878 WP_003403880.1.59888 WP_003403880.1.59952 WP_003403880.1.5996 WP_003403880.1.59961 WP_003403880.1.59974 WP_003403880.1.6000 WP_003403880.1.60007 WP_003403880.1.60016 WP_003403880.1.6003 WP_003403880.1.60047 WP_003403880.1.6007 WP_003403880.1.60091 WP_003403880.1.60125 WP_003403880.1.60135 WP_003403880.1.60139 WP_003403880.1.60152 WP_003403880.1.60171 WP_003403880.1.60197 WP_003403880.1.6020 WP_003403880.1.60205 WP_003403880.1.60207 WP_003403880.1.60215 WP_003403880.1.60217 WP_003403880.1.60267 WP_003403880.1.60288 WP_003403880.1.60291 WP_003403880.1.60301 WP_003403880.1.60305 WP_003403880.1.60312 WP_003403880.1.60313 WP_003403880.1.60314 WP_003403880.1.60367 WP_003403880.1.60376 WP_003403880.1.60403 WP_003403880.1.60413 WP_003403880.1.60421 WP_003403880.1.60451 WP_003403880.1.60460 WP_003403880.1.60479 WP_003403880.1.60487 WP_003403880.1.60512 WP_003403880.1.60573 WP_003403880.1.60583 WP_003403880.1.60632 WP_003403880.1.60657 WP_003403880.1.60687 WP_003403880.1.60689 WP_003403880.1.60727 WP_003403880.1.60738 WP_003403880.1.60763 WP_003403880.1.60791 WP_003403880.1.60834 WP_003403880.1.60870 WP_003403880.1.60878 WP_003403880.1.60879 WP_003403880.1.60913 WP_003403880.1.60978 WP_003403880.1.61000 WP_003403880.1.61001 WP_003403880.1.61012 WP_003403880.1.61014 WP_003403880.1.61015 WP_003403880.1.61037 WP_003403880.1.61052 WP_003403880.1.61065 WP_003403880.1.61100 WP_003403880.1.61101 WP_003403880.1.61138 WP_003403880.1.61142 WP_003403880.1.61198 WP_003403880.1.612 WP_003403880.1.61234 WP_003403880.1.61256 WP_003403880.1.61281 WP_003403880.1.61314 WP_003403880.1.61321 WP_003403880.1.61328 WP_003403880.1.61368 WP_003403880.1.61391 WP_003403880.1.61409 WP_003403880.1.61420 WP_003403880.1.61422 WP_003403880.1.61428 WP_003403880.1.61469 WP_003403880.1.61494 WP_003403880.1.61522 WP_003403880.1.61552 WP_003403880.1.61567 WP_003403880.1.61573 WP_003403880.1.61584 WP_003403880.1.61586 WP_003403880.1.6159 WP_003403880.1.61592 WP_003403880.1.6160 WP_003403880.1.61614 WP_003403880.1.6163 WP_003403880.1.61655 WP_003403880.1.61665 WP_003403880.1.61669 WP_003403880.1.61682 WP_003403880.1.61692 WP_003403880.1.61719 WP_003403880.1.61728 WP_003403880.1.61750 WP_003403880.1.61754 WP_003403880.1.61755 WP_003403880.1.61757 WP_003403880.1.61778 WP_003403880.1.61793 WP_003403880.1.61816 WP_003403880.1.61842 WP_003403880.1.61850 WP_003403880.1.61862 WP_003403880.1.61865 WP_003403880.1.61868 WP_003403880.1.61911 WP_003403880.1.61925 WP_003403880.1.61941 WP_003403880.1.61953 WP_003403880.1.61979 WP_003403880.1.61986 WP_003403880.1.61987 WP_003403880.1.61998 WP_003403880.1.62021 WP_003403880.1.62087 WP_003403880.1.62089 WP_003403880.1.62104 WP_003403880.1.6211 WP_003403880.1.62132 WP_003403880.1.62162 WP_003403880.1.62225 WP_003403880.1.62230 WP_003403880.1.62238 WP_003403880.1.62249 WP_003403880.1.62270 WP_003403880.1.62281 WP_003403880.1.62307 WP_003403880.1.6231 WP_003403880.1.62359 WP_003403880.1.62360 WP_003403880.1.62371 WP_003403880.1.62379 WP_003403880.1.62395 WP_003403880.1.62408 WP_003403880.1.62449 WP_003403880.1.62468 WP_003403880.1.6248 WP_003403880.1.62508 WP_003403880.1.62565 WP_003403880.1.62594 WP_003403880.1.62606 WP_003403880.1.62616 WP_003403880.1.62666 WP_003403880.1.62687 WP_003403880.1.62715 WP_003403880.1.62730 WP_003403880.1.62738 WP_003403880.1.62761 WP_003403880.1.62766 WP_003403880.1.62786 WP_003403880.1.62813 WP_003403880.1.62839 WP_003403880.1.62841 WP_003403880.1.62909 WP_003403880.1.62936 WP_003403880.1.6294 WP_003403880.1.6295 WP_003403880.1.62962 WP_003403880.1.63007 WP_003403880.1.63019 WP_003403880.1.63064 WP_003403880.1.63066 WP_003403880.1.63072 WP_003403880.1.6308 WP_003403880.1.63081 WP_003403880.1.63096 WP_003403880.1.63106 WP_003403880.1.6314 WP_003403880.1.63144 WP_003403880.1.63154 WP_003403880.1.63160 WP_003403880.1.63161 WP_003403880.1.63166 WP_003403880.1.63175 WP_003403880.1.63194 WP_003403880.1.6322 WP_003403880.1.63222 WP_003403880.1.63247 WP_003403880.1.6328 WP_003403880.1.63291 WP_003403880.1.63312 WP_003403880.1.63317 WP_003403880.1.63331 WP_003403880.1.63373 WP_003403880.1.63384 WP_003403880.1.63403 WP_003403880.1.63424 WP_003403880.1.63428 WP_003403880.1.6345 WP_003403880.1.63464 WP_003403880.1.63483 WP_003403880.1.63502 WP_003403880.1.63504 WP_003403880.1.63530 WP_003403880.1.63538 WP_003403880.1.63564 WP_003403880.1.63567 WP_003403880.1.63596 WP_003403880.1.63623 WP_003403880.1.63624 WP_003403880.1.63625 WP_003403880.1.63627 WP_003403880.1.63654 WP_003403880.1.63662 WP_003403880.1.63711 WP_003403880.1.63734 WP_003403880.1.63819 WP_003403880.1.63844 WP_003403880.1.63913 WP_003403880.1.63915 WP_003403880.1.63918 WP_003403880.1.63961 WP_003403880.1.63970 WP_003403880.1.64000 WP_003403880.1.64027 WP_003403880.1.64058 WP_003403880.1.64065 WP_003403880.1.64082 WP_003403880.1.64091 WP_003403880.1.64102 WP_003403880.1.64104 WP_003403880.1.64119 WP_003403880.1.64169 WP_003403880.1.64219 WP_003403880.1.6422 WP_003403880.1.64222 WP_003403880.1.64223 WP_003403880.1.64228 WP_003403880.1.64235 WP_003403880.1.64249 WP_003403880.1.6427 WP_003403880.1.64278 WP_003403880.1.64287 WP_003403880.1.64414 WP_003403880.1.64419 WP_003403880.1.6443 WP_003403880.1.64463 WP_003403880.1.64480 WP_003403880.1.64506 WP_003403880.1.64511 WP_003403880.1.64513 WP_003403880.1.64514 WP_003403880.1.64515 WP_003403880.1.64522 WP_003403880.1.64526 WP_003403880.1.64543 WP_003403880.1.6456 WP_003403880.1.64567 WP_003403880.1.64588 WP_003403880.1.64589 WP_003403880.1.64594 WP_003403880.1.64595 WP_003403880.1.64608 WP_003403880.1.64619 WP_003403880.1.64629 WP_003403880.1.6464 WP_003403880.1.64664 WP_003403880.1.64669 WP_003403880.1.64672 WP_003403880.1.64680 WP_003403880.1.64682 WP_003403880.1.64727 WP_003403880.1.64729 WP_003403880.1.64774 WP_003403880.1.64776 WP_003403880.1.64802 WP_003403880.1.64832 WP_003403880.1.6486 WP_003403880.1.64870 WP_003403880.1.64898 WP_003403880.1.64922 WP_003403880.1.64924 WP_003403880.1.6493 WP_003403880.1.64937 WP_003403880.1.64941 WP_003403880.1.64966 WP_003403880.1.64973 WP_003403880.1.65001 WP_003403880.1.65026 WP_003403880.1.65053 WP_003403880.1.65102 WP_003403880.1.65157 WP_003403880.1.65181 WP_003403880.1.65212 WP_003403880.1.65229 WP_003403880.1.6523 WP_003403880.1.65253 WP_003403880.1.65289 WP_003403880.1.65291 WP_003403880.1.65315 WP_003403880.1.65329 WP_003403880.1.65359 WP_003403880.1.6536 WP_003403880.1.65374 WP_003403880.1.65386 WP_003403880.1.65414 WP_003403880.1.65416 WP_003403880.1.65433 WP_003403880.1.65455 WP_003403880.1.65467 WP_003403880.1.65488 WP_003403880.1.65529 WP_003403880.1.65539 WP_003403880.1.65583 WP_003403880.1.65612 WP_003403880.1.65623 WP_003403880.1.65635 WP_003403880.1.65648 WP_003403880.1.65683 WP_003403880.1.65686 WP_003403880.1.65688 WP_003403880.1.65707 WP_003403880.1.65733 WP_003403880.1.65746 WP_003403880.1.65747 WP_003403880.1.65759 WP_003403880.1.65816 WP_003403880.1.65830 WP_003403880.1.65858 WP_003403880.1.65862 WP_003403880.1.65869 WP_003403880.1.65893 WP_003403880.1.65929 WP_003403880.1.65932 WP_003403880.1.65958 WP_003403880.1.65974 WP_003403880.1.66004 WP_003403880.1.66013 WP_003403880.1.6606 WP_003403880.1.66089 WP_003403880.1.66149 WP_003403880.1.66151 WP_003403880.1.66229 WP_003403880.1.66276 WP_003403880.1.66293 WP_003403880.1.66297 WP_003403880.1.66323 WP_003403880.1.66325 WP_003403880.1.6633 WP_003403880.1.66334 WP_003403880.1.66355 WP_003403880.1.66367 WP_003403880.1.66394 WP_003403880.1.66396 WP_003403880.1.66451 WP_003403880.1.66455 WP_003403880.1.66457 WP_003403880.1.66460 WP_003403880.1.66464 WP_003403880.1.66466 WP_003403880.1.66487 WP_003403880.1.66504 WP_003403880.1.66544 WP_003403880.1.66558 WP_003403880.1.66580 WP_003403880.1.66582 WP_003403880.1.66612 WP_003403880.1.66615 WP_003403880.1.66617 WP_003403880.1.66656 WP_003403880.1.66663 WP_003403880.1.66675 WP_003403880.1.66715 WP_003403880.1.66718 WP_003403880.1.66762 WP_003403880.1.66776 WP_003403880.1.66817 WP_003403880.1.66826 WP_003403880.1.66830 WP_003403880.1.66842 WP_003403880.1.66868 WP_003403880.1.66878 WP_003403880.1.66880 WP_003403880.1.66893 WP_003403880.1.66961 WP_003403880.1.67005 WP_003403880.1.6704 WP_003403880.1.67044 WP_003403880.1.67061 WP_003403880.1.67089 WP_003403880.1.67098 WP_003403880.1.67146 WP_003403880.1.67170 WP_003403880.1.67197 WP_003403880.1.67198 WP_003403880.1.6720 WP_003403880.1.67207 WP_003403880.1.67220 WP_003403880.1.67225 WP_003403880.1.67231 WP_003403880.1.6724 WP_003403880.1.67257 WP_003403880.1.67298 WP_003403880.1.67307 WP_003403880.1.67324 WP_003403880.1.67332 WP_003403880.1.67346 WP_003403880.1.67354 WP_003403880.1.67360 WP_003403880.1.67381 WP_003403880.1.67396 WP_003403880.1.67417 WP_003403880.1.67422 WP_003403880.1.67453 WP_003403880.1.6746 WP_003403880.1.67473 WP_003403880.1.67481 WP_003403880.1.67482 WP_003403880.1.67496 WP_003403880.1.67499 WP_003403880.1.67516 WP_003403880.1.67523 WP_003403880.1.67536 WP_003403880.1.67575 WP_003403880.1.67587 WP_003403880.1.67598 WP_003403880.1.67600 WP_003403880.1.67602 WP_003403880.1.67630 WP_003403880.1.67692 WP_003403880.1.67744 WP_003403880.1.6775 WP_003403880.1.67750 WP_003403880.1.6777 WP_003403880.1.67809 WP_003403880.1.67816 WP_003403880.1.67844 WP_003403880.1.67848 WP_003403880.1.67870 WP_003403880.1.67888 WP_003403880.1.67915 WP_003403880.1.67945 WP_003403880.1.67949 WP_003403880.1.67980 WP_003403880.1.67982 WP_003403880.1.68022 WP_003403880.1.68029 WP_003403880.1.68037 WP_003403880.1.68045 WP_003403880.1.68057 WP_003403880.1.68083 WP_003403880.1.68088 WP_003403880.1.68106 WP_003403880.1.68110 WP_003403880.1.68153 WP_003403880.1.68164 WP_003403880.1.68169 WP_003403880.1.68212 WP_003403880.1.68227 WP_003403880.1.6825 WP_003403880.1.68297 WP_003403880.1.68325 WP_003403880.1.68329 WP_003403880.1.68340 WP_003403880.1.68384 WP_003403880.1.68388 WP_003403880.1.68429 WP_003403880.1.6843 WP_003403880.1.68433 WP_003403880.1.68444 WP_003403880.1.68465 WP_003403880.1.68484 WP_003403880.1.68518 WP_003403880.1.68569 WP_003403880.1.68576 WP_003403880.1.68580 WP_003403880.1.68623 WP_003403880.1.68624 WP_003403880.1.68637 WP_003403880.1.68646 WP_003403880.1.68667 WP_003403880.1.68669 WP_003403880.1.68672 WP_003403880.1.68684 WP_003403880.1.68704 WP_003403880.1.68708 WP_003403880.1.6872 WP_003403880.1.68730 WP_003403880.1.68734 WP_003403880.1.68748 WP_003403880.1.68754 WP_003403880.1.6876 WP_003403880.1.68761 WP_003403880.1.68763 WP_003403880.1.68766 WP_003403880.1.68774 WP_003403880.1.68796 WP_003403880.1.68824 WP_003403880.1.68832 WP_003403880.1.68833 WP_003403880.1.68841 WP_003403880.1.68859 WP_003403880.1.68876 WP_003403880.1.68906 WP_003403880.1.68916 WP_003403880.1.68923 WP_003403880.1.68945 WP_003403880.1.6896 WP_003403880.1.68981 WP_003403880.1.68984 WP_003403880.1.68997 WP_003403880.1.69008 WP_003403880.1.69076 WP_003403880.1.69079 WP_003403880.1.69178 WP_003403880.1.69181 WP_003403880.1.69231 WP_003403880.1.69256 WP_003403880.1.69311 WP_003403880.1.69315 WP_003403880.1.69322 WP_003403880.1.69342 WP_003403880.1.6935 WP_003403880.1.6936 WP_003403880.1.69369 WP_003403880.1.69374 WP_003403880.1.69398 WP_003403880.1.69401 WP_003403880.1.69426 WP_003403880.1.69427 WP_003403880.1.69429 WP_003403880.1.6951 WP_003403880.1.69511 WP_003403880.1.69526 WP_003403880.1.69528 WP_003403880.1.69547 WP_003403880.1.69573 WP_003403880.1.69581 WP_003403880.1.6960 WP_003403880.1.69617 WP_003403880.1.69634 WP_003403880.1.69659 WP_003403880.1.69673 WP_003403880.1.69686 WP_003403880.1.69707 WP_003403880.1.69709 WP_003403880.1.69723 WP_003403880.1.69736 WP_003403880.1.69778 WP_003403880.1.69800 WP_003403880.1.69802 WP_003403880.1.69845 WP_003403880.1.69870 WP_003403880.1.69873 WP_003403880.1.69898 WP_003403880.1.69913 WP_003403880.1.69925 WP_003403880.1.69931 WP_003403880.1.69938 WP_003403880.1.69955 WP_003403880.1.69957 WP_003403880.1.69981 WP_003403880.1.69990 WP_003403880.1.70 WP_003403880.1.70017 WP_003403880.1.70032 WP_003403880.1.70055 WP_003403880.1.70062 WP_003403880.1.70072 WP_003403880.1.70131 WP_003403880.1.70132 WP_003403880.1.7022 WP_003403880.1.70227 WP_003403880.1.70255 WP_003403880.1.70271 WP_003403880.1.70274 WP_003403880.1.7029 WP_003403880.1.70325 WP_003403880.1.70328 WP_003403880.1.70356 WP_003403880.1.70364 WP_003403880.1.70369 WP_003403880.1.70418 WP_003403880.1.70422 WP_003403880.1.70435 WP_003403880.1.70444 WP_003403880.1.70463 WP_003403880.1.70471 WP_003403880.1.70480 WP_003403880.1.70494 WP_003403880.1.70498 WP_003403880.1.70505 WP_003403880.1.70525 WP_003403880.1.70573 WP_003403880.1.70577 WP_003403880.1.70610 WP_003403880.1.70615 WP_003403880.1.70618 WP_003403880.1.70622 WP_003403880.1.70626 WP_003403880.1.70699 WP_003403880.1.70704 WP_003403880.1.70729 WP_003403880.1.70757 WP_003403880.1.70782 WP_003403880.1.70796 WP_003403880.1.70830 WP_003403880.1.70834 WP_003403880.1.7084 WP_003403880.1.70840 WP_003403880.1.70871 WP_003403880.1.70915 WP_003403880.1.70955 WP_003403880.1.70958 WP_003403880.1.70964 WP_003403880.1.70976 WP_003403880.1.71015 WP_003403880.1.71026 WP_003403880.1.71063 WP_003403880.1.71076 WP_003403880.1.71083 WP_003403880.1.7111 WP_003403880.1.71118 WP_003403880.1.71128 WP_003403880.1.7113 WP_003403880.1.71187 WP_003403880.1.71191 WP_003403880.1.71255 WP_003403880.1.71258 WP_003403880.1.71259 WP_003403880.1.71326 WP_003403880.1.71329 WP_003403880.1.71331 WP_003403880.1.71344 WP_003403880.1.71390 WP_003403880.1.71399 WP_003403880.1.71414 WP_003403880.1.71440 WP_003403880.1.71457 WP_003403880.1.7146 WP_003403880.1.71464 WP_003403880.1.71490 WP_003403880.1.71492 WP_003403880.1.71509 WP_003403880.1.71516 WP_003403880.1.71517 WP_003403880.1.71527 WP_003403880.1.71532 WP_003403880.1.71545 WP_003403880.1.71546 WP_003403880.1.71569 WP_003403880.1.71604 WP_003403880.1.71621 WP_003403880.1.71630 WP_003403880.1.71638 WP_003403880.1.71654 WP_003403880.1.71664 WP_003403880.1.71665 WP_003403880.1.71683 WP_003403880.1.71701 WP_003403880.1.71718 WP_003403880.1.71731 WP_003403880.1.71778 WP_003403880.1.71781 WP_003403880.1.71803 WP_003403880.1.71820 WP_003403880.1.71847 WP_003403880.1.7185 WP_003403880.1.71851 WP_003403880.1.71871 WP_003403880.1.71909 WP_003403880.1.71957 WP_003403880.1.71970 WP_003403880.1.72047 WP_003403880.1.72061 WP_003403880.1.72062 WP_003403880.1.72111 WP_003403880.1.72122 WP_003403880.1.72128 WP_003403880.1.72143 WP_003403880.1.7216 WP_003403880.1.72168 WP_003403880.1.72179 WP_003403880.1.72209 WP_003403880.1.72218 WP_003403880.1.72219 WP_003403880.1.72227 WP_003403880.1.7224 WP_003403880.1.72268 WP_003403880.1.72332 WP_003403880.1.72380 WP_003403880.1.72401 WP_003403880.1.72405 WP_003403880.1.72420 WP_003403880.1.72441 WP_003403880.1.72451 WP_003403880.1.72452 WP_003403880.1.72457 WP_003403880.1.72459 WP_003403880.1.72460 WP_003403880.1.72466 WP_003403880.1.72487 WP_003403880.1.72488 WP_003403880.1.72492 WP_003403880.1.72506 WP_003403880.1.72543 WP_003403880.1.7256 WP_003403880.1.72576 WP_003403880.1.72585 WP_003403880.1.72591 WP_003403880.1.72592 WP_003403880.1.72640 WP_003403880.1.7266 WP_003403880.1.72661 WP_003403880.1.72684 WP_003403880.1.72739 WP_003403880.1.72744 WP_003403880.1.72755 WP_003403880.1.72759 WP_003403880.1.72784 WP_003403880.1.72792 WP_003403880.1.72826 WP_003403880.1.72831 WP_003403880.1.72852 WP_003403880.1.72853 WP_003403880.1.72879 WP_003403880.1.72880 WP_003403880.1.72954 WP_003403880.1.72957 WP_003403880.1.72959 WP_003403880.1.72973 WP_003403880.1.7298 WP_003403880.1.72982 WP_003403880.1.72988 WP_003403880.1.72993 WP_003403880.1.73006 WP_003403880.1.73013 WP_003403880.1.73025 WP_003403880.1.73028 WP_003403880.1.73042 WP_003403880.1.73045 WP_003403880.1.73092 WP_003403880.1.73118 WP_003403880.1.7312 WP_003403880.1.73127 WP_003403880.1.73134 WP_003403880.1.73150 WP_003403880.1.73154 WP_003403880.1.73163 WP_003403880.1.73205 WP_003403880.1.7321 WP_003403880.1.73310 WP_003403880.1.73315 WP_003403880.1.73365 WP_003403880.1.73391 WP_003403880.1.73404 WP_003403880.1.73424 WP_003403880.1.73436 WP_003403880.1.73445 WP_003403880.1.73453 WP_003403880.1.73465 WP_003403880.1.73466 WP_003403880.1.73470 WP_003403880.1.73471 WP_003403880.1.73478 WP_003403880.1.73482 WP_003403880.1.73507 WP_003403880.1.73532 WP_003403880.1.73550 WP_003403880.1.73564 WP_003403880.1.73623 WP_003403880.1.73629 WP_003403880.1.73644 WP_003403880.1.7366 WP_003403880.1.73661 WP_003403880.1.7368 WP_003403880.1.73688 WP_003403880.1.73744 WP_003403880.1.73750 WP_003403880.1.73760 WP_003403880.1.73774 WP_003403880.1.7379 WP_003403880.1.73813 WP_003403880.1.73840 WP_003403880.1.73876 WP_003403880.1.7389 WP_003403880.1.73986 WP_003403880.1.74016 WP_003403880.1.74039 WP_003403880.1.74083 WP_003403880.1.74101 WP_003403880.1.74107 WP_003403880.1.74120 WP_003403880.1.74129 WP_003403880.1.74144 WP_003403880.1.7417 WP_003403880.1.74190 WP_003403880.1.74210 WP_003403880.1.7423 WP_003403880.1.74259 WP_003403880.1.74262 WP_003403880.1.74269 WP_003403880.1.74291 WP_003403880.1.74296 WP_003403880.1.74304 WP_003403880.1.7432 WP_003403880.1.74347 WP_003403880.1.7436 WP_003403880.1.74378 WP_003403880.1.74395 WP_003403880.1.74400 WP_003403880.1.74401 WP_003403880.1.74432 WP_003403880.1.74442 WP_003403880.1.74477 WP_003403880.1.74487 WP_003403880.1.74499 WP_003403880.1.74504 WP_003403880.1.74511 WP_003403880.1.74523 WP_003403880.1.74525 WP_003403880.1.74551 WP_003403880.1.74555 WP_003403880.1.74628 WP_003403880.1.74641 WP_003403880.1.74653 WP_003403880.1.74660 WP_003403880.1.74683 WP_003403880.1.7469 WP_003403880.1.74725 WP_003403880.1.74760 WP_003403880.1.74786 WP_003403880.1.74809 WP_003403880.1.74820 WP_003403880.1.74870 WP_003403880.1.74881 WP_003403880.1.74888 WP_003403880.1.74952 WP_003403880.1.7496 WP_003403880.1.75043 WP_003403880.1.75045 WP_003403880.1.75055 WP_003403880.1.75078 WP_003403880.1.75081 WP_003403880.1.75120 WP_003403880.1.75163 WP_003403880.1.75188 WP_003403880.1.75200 WP_003403880.1.75202 WP_003403880.1.75239 WP_003403880.1.75250 WP_003403880.1.75263 WP_003403880.1.75281 WP_003403880.1.75342 WP_003403880.1.7535 WP_003403880.1.75376 WP_003403880.1.75391 WP_003403880.1.75441 WP_003403880.1.75510 WP_003403880.1.75581 WP_003403880.1.75598 WP_003403880.1.75635 WP_003403880.1.75645 WP_003403880.1.75665 WP_003403880.1.75671 WP_003403880.1.75741 WP_003403880.1.75749 WP_003403880.1.75772 WP_003403880.1.75774 WP_003403880.1.75811 WP_003403880.1.75833 WP_003403880.1.7585 WP_003403880.1.75864 WP_003403880.1.75868 WP_003403880.1.75878 WP_003403880.1.75927 WP_003403880.1.75946 WP_003403880.1.75968 WP_003403880.1.75974 WP_003403880.1.76007 WP_003403880.1.76016 WP_003403880.1.76032 WP_003403880.1.76037 WP_003403880.1.7604 WP_003403880.1.76052 WP_003403880.1.76058 WP_003403880.1.76064 WP_003403880.1.76110 WP_003403880.1.76133 WP_003403880.1.76138 WP_003403880.1.76172 WP_003403880.1.76177 WP_003403880.1.76183 WP_003403880.1.76209 WP_003403880.1.76239 WP_003403880.1.76272 WP_003403880.1.76277 WP_003403880.1.76280 WP_003403880.1.76281 WP_003403880.1.76291 WP_003403880.1.76297 WP_003403880.1.76360 WP_003403880.1.76379 WP_003403880.1.76403 WP_003403880.1.76413 WP_003403880.1.76414 WP_003403880.1.76427 WP_003403880.1.76436 WP_003403880.1.76442 WP_003403880.1.76443 WP_003403880.1.76456 WP_003403880.1.76521 WP_003403880.1.76533 WP_003403880.1.76616 WP_003403880.1.76625 WP_003403880.1.76629 WP_003403880.1.76635 WP_003403880.1.76638 WP_003403880.1.76639 WP_003403880.1.76640 WP_003403880.1.76644 WP_003403880.1.76677 WP_003403880.1.76678 WP_003403880.1.76679 WP_003403880.1.76734 WP_003403880.1.76744 WP_003403880.1.76750 WP_003403880.1.76754 WP_003403880.1.76757 WP_003403880.1.76781 WP_003403880.1.76818 WP_003403880.1.76824 WP_003403880.1.76835 WP_003403880.1.76873 WP_003403880.1.76881 WP_003403880.1.76900 WP_003403880.1.7691 WP_003403880.1.76947 WP_003403880.1.76954 WP_003403880.1.76955 WP_003403880.1.76963 WP_003403880.1.76976 WP_003403880.1.77000 WP_003403880.1.77008 WP_003403880.1.77021 WP_003403880.1.77056 WP_003403880.1.77065 WP_003403880.1.77075 WP_003403880.1.77093 WP_003403880.1.77107 WP_003403880.1.77115 WP_003403880.1.77118 WP_003403880.1.77125 WP_003403880.1.77141 WP_003403880.1.77142 WP_003403880.1.77166 WP_003403880.1.77250 WP_003403880.1.77252 WP_003403880.1.77260 WP_003403880.1.77266 WP_003403880.1.77280 WP_003403880.1.77285 WP_003403880.1.77312 WP_003403880.1.77348 WP_003403880.1.77351 WP_003403880.1.77352 WP_003403880.1.77361 WP_003403880.1.774 WP_003403880.1.7740 WP_003403880.1.77404 WP_003403880.1.77425 WP_003403880.1.77463 WP_003403880.1.77474 WP_003403880.1.7748 WP_003403880.1.77484 WP_003403880.1.77491 WP_003403880.1.77510 WP_003403880.1.77530 WP_003403880.1.77559 WP_003403880.1.77599 WP_003403880.1.77605 WP_003403880.1.7762 WP_003403880.1.77627 WP_003403880.1.77649 WP_003403880.1.77654 WP_003403880.1.7766 WP_003403880.1.77667 WP_003403880.1.77704 WP_003403880.1.77706 WP_003403880.1.77726 WP_003403880.1.77774 WP_003403880.1.7778 WP_003403880.1.77790 WP_003403880.1.77809 WP_003403880.1.77820 WP_003403880.1.77843 WP_003403880.1.77865 WP_003403880.1.77868 WP_003403880.1.77879 WP_003403880.1.77890 WP_003403880.1.77909 WP_003403880.1.77911 WP_003403880.1.77931 WP_003403880.1.77984 WP_003403880.1.78020 WP_003403880.1.78024 WP_003403880.1.78075 WP_003403880.1.78084 WP_003403880.1.78086 WP_003403880.1.7809 WP_003403880.1.78098 WP_003403880.1.78105 WP_003403880.1.78113 WP_003403880.1.78136 WP_003403880.1.78162 WP_003403880.1.7817 WP_003403880.1.78200 WP_003403880.1.78216 WP_003403880.1.78236 WP_003403880.1.78238 WP_003403880.1.78322 WP_003403880.1.78338 WP_003403880.1.7836 WP_003403880.1.78360 WP_003403880.1.78429 WP_003403880.1.78435 WP_003403880.1.78459 WP_003403880.1.78488 WP_003403880.1.7849 WP_003403880.1.78499 WP_003403880.1.785 WP_003403880.1.78516 WP_003403880.1.78524 WP_003403880.1.78526 WP_003403880.1.78538 WP_003403880.1.78544 WP_003403880.1.78545 WP_003403880.1.78547 WP_003403880.1.78574 WP_003403880.1.78580 WP_003403880.1.7860 WP_003403880.1.78620 WP_003403880.1.78646 WP_003403880.1.78648 WP_003403880.1.78649 WP_003403880.1.78655 WP_003403880.1.78657 WP_003403880.1.78659 WP_003403880.1.7869 WP_003403880.1.78692 WP_003403880.1.78760 WP_003403880.1.78766 WP_003403880.1.78776 WP_003403880.1.78778 WP_003403880.1.78784 WP_003403880.1.78788 WP_003403880.1.78790 WP_003403880.1.78793 WP_003403880.1.78848 WP_003403880.1.78860 WP_003403880.1.7887 WP_003403880.1.78884 WP_003403880.1.78932 WP_003403880.1.78969 WP_003403880.1.78977 WP_003403880.1.78980 WP_003403880.1.79005 WP_003403880.1.79016 WP_003403880.1.79033 WP_003403880.1.79064 WP_003403880.1.79066 WP_003403880.1.79068 WP_003403880.1.79077 WP_003403880.1.79095 WP_003403880.1.79112 WP_003403880.1.79122 WP_003403880.1.79145 WP_003403880.1.79152 WP_003403880.1.79163 WP_003403880.1.79182 WP_003403880.1.79198 WP_003403880.1.79213 WP_003403880.1.79218 WP_003403880.1.79268 WP_003403880.1.79273 WP_003403880.1.79290 WP_003403880.1.79319 WP_003403880.1.79325 WP_003403880.1.79326 WP_003403880.1.7933 WP_003403880.1.79330 WP_003403880.1.79339 WP_003403880.1.79394 WP_003403880.1.79399 WP_003403880.1.79413 WP_003403880.1.79422 WP_003403880.1.79445 WP_003403880.1.79447 WP_003403880.1.79455 WP_003403880.1.79471 WP_003403880.1.79480 WP_003403880.1.79482 WP_003403880.1.79488 WP_003403880.1.79500 WP_003403880.1.79502 WP_003403880.1.79508 WP_003403880.1.79514 WP_003403880.1.79561 WP_003403880.1.79565 WP_003403880.1.79578 WP_003403880.1.79588 WP_003403880.1.79598 WP_003403880.1.79615 WP_003403880.1.79684 WP_003403880.1.79698 WP_003403880.1.797 WP_003403880.1.79744 WP_003403880.1.79784 WP_003403880.1.79802 WP_003403880.1.79806 WP_003403880.1.79819 WP_003403880.1.79828 WP_003403880.1.79851 WP_003403880.1.79853 WP_003403880.1.79863 WP_003403880.1.79881 WP_003403880.1.79885 WP_003403880.1.7990 WP_003403880.1.79900 WP_003403880.1.79913 WP_003403880.1.79918 WP_003403880.1.79947 WP_003403880.1.79948 WP_003403880.1.7995 WP_003403880.1.7997 WP_003403880.1.80004 WP_003403880.1.80015 WP_003403880.1.80022 WP_003403880.1.80030 WP_003403880.1.80054 WP_003403880.1.80084 WP_003403880.1.80129 WP_003403880.1.80177 WP_003403880.1.80234 WP_003403880.1.8026 WP_003403880.1.80275 WP_003403880.1.8029 WP_003403880.1.80300 WP_003403880.1.80304 WP_003403880.1.80326 WP_003403880.1.80351 WP_003403880.1.8037 WP_003403880.1.80370 WP_003403880.1.80387 WP_003403880.1.80399 WP_003403880.1.80451 WP_003403880.1.80458 WP_003403880.1.80461 WP_003403880.1.80490 WP_003403880.1.80503 WP_003403880.1.80507 WP_003403880.1.80552 WP_003403880.1.80576 WP_003403880.1.80588 WP_003403880.1.80599 WP_003403880.1.8060 WP_003403880.1.80624 WP_003403880.1.80636 WP_003403880.1.80669 WP_003403880.1.80673 WP_003403880.1.80711 WP_003403880.1.80743 WP_003403880.1.80815 WP_003403880.1.80853 WP_003403880.1.80918 WP_003403880.1.8093 WP_003403880.1.80967 WP_003403880.1.8097 WP_003403880.1.80988 WP_003403880.1.81013 WP_003403880.1.8105 WP_003403880.1.81059 WP_003403880.1.81063 WP_003403880.1.81066 WP_003403880.1.81075 WP_003403880.1.81091 WP_003403880.1.81119 WP_003403880.1.81125 WP_003403880.1.81136 WP_003403880.1.8114 WP_003403880.1.81189 WP_003403880.1.81192 WP_003403880.1.812 WP_003403880.1.81230 WP_003403880.1.81249 WP_003403880.1.81250 WP_003403880.1.81264 WP_003403880.1.8128 WP_003403880.1.81287 WP_003403880.1.81297 WP_003403880.1.8138 WP_003403880.1.81407 WP_003403880.1.8143 WP_003403880.1.81439 WP_003403880.1.81465 WP_003403880.1.81505 WP_003403880.1.81529 WP_003403880.1.81538 WP_003403880.1.81541 WP_003403880.1.81560 WP_003403880.1.81561 WP_003403880.1.81567 WP_003403880.1.81583 WP_003403880.1.81686 WP_003403880.1.81712 WP_003403880.1.81720 WP_003403880.1.81731 WP_003403880.1.81774 WP_003403880.1.81788 WP_003403880.1.81809 WP_003403880.1.81820 WP_003403880.1.81850 WP_003403880.1.81883 WP_003403880.1.81891 WP_003403880.1.81911 WP_003403880.1.81918 WP_003403880.1.82011 WP_003403880.1.82048 WP_003403880.1.82069 WP_003403880.1.82071 WP_003403880.1.82108 WP_003403880.1.82136 WP_003403880.1.82142 WP_003403880.1.8215 WP_003403880.1.82158 WP_003403880.1.8217 WP_003403880.1.82209 WP_003403880.1.82210 WP_003403880.1.82228 WP_003403880.1.82236 WP_003403880.1.82251 WP_003403880.1.82271 WP_003403880.1.82307 WP_003403880.1.82309 WP_003403880.1.82317 WP_003403880.1.82346 WP_003403880.1.82374 WP_003403880.1.82385 WP_003403880.1.82429 WP_003403880.1.82460 WP_003403880.1.82462 WP_003403880.1.82483 WP_003403880.1.82494 WP_003403880.1.82531 WP_003403880.1.82546 WP_003403880.1.82547 WP_003403880.1.82549 WP_003403880.1.82592 WP_003403880.1.82598 WP_003403880.1.82642 WP_003403880.1.82651 WP_003403880.1.82681 WP_003403880.1.82685 WP_003403880.1.8271 WP_003403880.1.82712 WP_003403880.1.8273 WP_003403880.1.82743 WP_003403880.1.82757 WP_003403880.1.82774 WP_003403880.1.82803 WP_003403880.1.82836 WP_003403880.1.82860 WP_003403880.1.82871 WP_003403880.1.82892 WP_003403880.1.82935 WP_003403880.1.82957 WP_003403880.1.82973 WP_003403880.1.82981 WP_003403880.1.82983 WP_003403880.1.83004 WP_003403880.1.83009 WP_003403880.1.83065 WP_003403880.1.83074 WP_003403880.1.83110 WP_003403880.1.83146 WP_003403880.1.83149 WP_003403880.1.83159 WP_003403880.1.8317 WP_003403880.1.83173 WP_003403880.1.83181 WP_003403880.1.83191 WP_003403880.1.83197 WP_003403880.1.83212 WP_003403880.1.83262 WP_003403880.1.83268 WP_003403880.1.83273 WP_003403880.1.83309 WP_003403880.1.83332 WP_003403880.1.83334 WP_003403880.1.83341 WP_003403880.1.83349 WP_003403880.1.8335 WP_003403880.1.83367 WP_003403880.1.83380 WP_003403880.1.83389 WP_003403880.1.83408 WP_003403880.1.83409 WP_003403880.1.83435 WP_003403880.1.83470 WP_003403880.1.83524 WP_003403880.1.83526 WP_003403880.1.8358 WP_003403880.1.83589 WP_003403880.1.83601 WP_003403880.1.83611 WP_003403880.1.83638 WP_003403880.1.83648 WP_003403880.1.83656 WP_003403880.1.83667 WP_003403880.1.83689 WP_003403880.1.83692 WP_003403880.1.83704 WP_003403880.1.83705 WP_003403880.1.83766 WP_003403880.1.83793 WP_003403880.1.83794 WP_003403880.1.83802 WP_003403880.1.83805 WP_003403880.1.83839 WP_003403880.1.83842 WP_003403880.1.83850 WP_003403880.1.83861 WP_003403880.1.83884 WP_003403880.1.83920 WP_003403880.1.83929 WP_003403880.1.83930 WP_003403880.1.83975 WP_003403880.1.83991 WP_003403880.1.8400 WP_003403880.1.84027 WP_003403880.1.8404 WP_003403880.1.84057 WP_003403880.1.84070 WP_003403880.1.8409 WP_003403880.1.84112 WP_003403880.1.84146 WP_003403880.1.8415 WP_003403880.1.84176 WP_003403880.1.84186 WP_003403880.1.84192 WP_003403880.1.84228 WP_003403880.1.8424 WP_003403880.1.84244 WP_003403880.1.84259 WP_003403880.1.8426 WP_003403880.1.84277 WP_003403880.1.84287 WP_003403880.1.8434 WP_003403880.1.84388 WP_003403880.1.84408 WP_003403880.1.84409 WP_003403880.1.84438 WP_003403880.1.84460 WP_003403880.1.84488 WP_003403880.1.84525 WP_003403880.1.84620 WP_003403880.1.84623 WP_003403880.1.84641 WP_003403880.1.84655 WP_003403880.1.84666 WP_003403880.1.84670 WP_003403880.1.84739 WP_003403880.1.84748 WP_003403880.1.84766 WP_003403880.1.84772 WP_003403880.1.84774 WP_003403880.1.848 WP_003403880.1.84812 WP_003403880.1.84839 WP_003403880.1.84846 WP_003403880.1.84873 WP_003403880.1.84911 WP_003403880.1.84938 WP_003403880.1.84968 WP_003403880.1.84973 WP_003403880.1.84985 WP_003403880.1.85038 WP_003403880.1.85041 WP_003403880.1.85043 WP_003403880.1.8505 WP_003403880.1.85074 WP_003403880.1.8509 WP_003403880.1.8512 WP_003403880.1.85148 WP_003403880.1.8518 WP_003403880.1.8522 WP_003403880.1.85242 WP_003403880.1.85276 WP_003403880.1.85281 WP_003403880.1.85284 WP_003403880.1.85314 WP_003403880.1.85330 WP_003403880.1.85341 WP_003403880.1.85346 WP_003403880.1.8535 WP_003403880.1.85363 WP_003403880.1.85371 WP_003403880.1.85377 WP_003403880.1.85387 WP_003403880.1.85399 WP_003403880.1.85458 WP_003403880.1.8546 WP_003403880.1.85464 WP_003403880.1.85478 WP_003403880.1.85480 WP_003403880.1.85488 WP_003403880.1.85495 WP_003403880.1.85551 WP_003403880.1.85557 WP_003403880.1.85577 WP_003403880.1.85597 WP_003403880.1.85599 WP_003403880.1.85610 WP_003403880.1.8563 WP_003403880.1.85648 WP_003403880.1.85679 WP_003403880.1.85717 WP_003403880.1.85727 WP_003403880.1.85737 WP_003403880.1.85763 WP_003403880.1.85808 WP_003403880.1.85819 WP_003403880.1.85820 WP_003403880.1.85823 WP_003403880.1.85832 WP_003403880.1.8586 WP_003403880.1.85872 WP_003403880.1.85894 WP_003403880.1.85909 WP_003403880.1.85913 WP_003403880.1.85953 WP_003403880.1.85986 WP_003403880.1.86000 WP_003403880.1.86024 WP_003403880.1.86025 WP_003403880.1.86032 WP_003403880.1.86048 WP_003403880.1.86052 WP_003403880.1.86067 WP_003403880.1.86103 WP_003403880.1.86122 WP_003403880.1.86124 WP_003403880.1.86160 WP_003403880.1.86164 WP_003403880.1.86168 WP_003403880.1.86190 WP_003403880.1.86204 WP_003403880.1.86208 WP_003403880.1.86235 WP_003403880.1.86249 WP_003403880.1.86260 WP_003403880.1.86290 WP_003403880.1.863 WP_003403880.1.86327 WP_003403880.1.86334 WP_003403880.1.86337 WP_003403880.1.86368 WP_003403880.1.86377 WP_003403880.1.86425 WP_003403880.1.86459 WP_003403880.1.8649 WP_003403880.1.86499 WP_003403880.1.86520 WP_003403880.1.86561 WP_003403880.1.86568 WP_003403880.1.86575 WP_003403880.1.86584 WP_003403880.1.86605 WP_003403880.1.86626 WP_003403880.1.86648 WP_003403880.1.8666 WP_003403880.1.86684 WP_003403880.1.86696 WP_003403880.1.86705 WP_003403880.1.86725 WP_003403880.1.86757 WP_003403880.1.86766 WP_003403880.1.86801 WP_003403880.1.86814 WP_003403880.1.86820 WP_003403880.1.86825 WP_003403880.1.86834 WP_003403880.1.8685 WP_003403880.1.86851 WP_003403880.1.86855 WP_003403880.1.86867 WP_003403880.1.86877 WP_003403880.1.86883 WP_003403880.1.8689 WP_003403880.1.86892 WP_003403880.1.86933 WP_003403880.1.86941 WP_003403880.1.86950 WP_003403880.1.86962 WP_003403880.1.86963 WP_003403880.1.86979 WP_003403880.1.8700 WP_003403880.1.87001 WP_003403880.1.87031 WP_003403880.1.87116 WP_003403880.1.87117 WP_003403880.1.8714 WP_003403880.1.87162 WP_003403880.1.87178 WP_003403880.1.87191 WP_003403880.1.87201 WP_003403880.1.87209 WP_003403880.1.87240 WP_003403880.1.87266 WP_003403880.1.87273 WP_003403880.1.87275 WP_003403880.1.8733 WP_003403880.1.87345 WP_003403880.1.87369 WP_003403880.1.8737 WP_003403880.1.87401 WP_003403880.1.87404 WP_003403880.1.87406 WP_003403880.1.87409 WP_003403880.1.87444 WP_003403880.1.87446 WP_003403880.1.87472 WP_003403880.1.87489 WP_003403880.1.87494 WP_003403880.1.87496 WP_003403880.1.87582 WP_003403880.1.87588 WP_003403880.1.87617 WP_003403880.1.87619 WP_003403880.1.87620 WP_003403880.1.87634 WP_003403880.1.87643 WP_003403880.1.8765 WP_003403880.1.87650 WP_003403880.1.87654 WP_003403880.1.87658 WP_003403880.1.87665 WP_003403880.1.87676 WP_003403880.1.87677 WP_003403880.1.87684 WP_003403880.1.87692 WP_003403880.1.87707 WP_003403880.1.87732 WP_003403880.1.87784 WP_003403880.1.87796 WP_003403880.1.87809 WP_003403880.1.87817 WP_003403880.1.87827 WP_003403880.1.87831 WP_003403880.1.87835 WP_003403880.1.87837 WP_003403880.1.8789 WP_003403880.1.87911 WP_003403880.1.87924 WP_003403880.1.87951 WP_003403880.1.87955 WP_003403880.1.87956 WP_003403880.1.87991 WP_003403880.1.88 WP_003403880.1.88002 WP_003403880.1.88037 WP_003403880.1.88039 WP_003403880.1.88072 WP_003403880.1.88077 WP_003403880.1.88121 WP_003403880.1.88180 WP_003403880.1.88191 WP_003403880.1.88205 WP_003403880.1.88217 WP_003403880.1.88219 WP_003403880.1.88245 WP_003403880.1.88253 WP_003403880.1.88294 WP_003403880.1.88315 WP_003403880.1.88316 WP_003403880.1.88320 WP_003403880.1.88338 WP_003403880.1.8840 WP_003403880.1.88437 WP_003403880.1.88453 WP_003403880.1.88469 WP_003403880.1.88507 WP_003403880.1.88521 WP_003403880.1.88530 WP_003403880.1.88537 WP_003403880.1.88541 WP_003403880.1.88616 WP_003403880.1.88618 WP_003403880.1.8862 WP_003403880.1.88625 WP_003403880.1.88632 WP_003403880.1.88634 WP_003403880.1.88649 WP_003403880.1.8870 WP_003403880.1.88756 WP_003403880.1.888 WP_003403880.1.88824 WP_003403880.1.88886 WP_003403880.1.88965 WP_003403880.1.88985 WP_003403880.1.8902 WP_003403880.1.89025 WP_003403880.1.89041 WP_003403880.1.89046 WP_003403880.1.89082 WP_003403880.1.89162 WP_003403880.1.89168 WP_003403880.1.8917 WP_003403880.1.89193 WP_003403880.1.89205 WP_003403880.1.89207 WP_003403880.1.89225 WP_003403880.1.8925 WP_003403880.1.89277 WP_003403880.1.89286 WP_003403880.1.89293 WP_003403880.1.89320 WP_003403880.1.8935 WP_003403880.1.89371 WP_003403880.1.89378 WP_003403880.1.89392 WP_003403880.1.89406 WP_003403880.1.8943 WP_003403880.1.89451 WP_003403880.1.89453 WP_003403880.1.89473 WP_003403880.1.89475 WP_003403880.1.89483 WP_003403880.1.895 WP_003403880.1.89513 WP_003403880.1.89517 WP_003403880.1.89522 WP_003403880.1.8954 WP_003403880.1.89543 WP_003403880.1.89567 WP_003403880.1.8957 WP_003403880.1.89572 WP_003403880.1.89589 WP_003403880.1.89607 WP_003403880.1.89613 WP_003403880.1.89625 WP_003403880.1.89648 WP_003403880.1.8967 WP_003403880.1.89670 WP_003403880.1.89676 WP_003403880.1.89729 WP_003403880.1.89739 WP_003403880.1.89762 WP_003403880.1.8977 WP_003403880.1.89802 WP_003403880.1.89808 WP_003403880.1.8982 WP_003403880.1.89831 WP_003403880.1.89849 WP_003403880.1.8989 WP_003403880.1.89901 WP_003403880.1.89903 WP_003403880.1.89909 WP_003403880.1.8992 WP_003403880.1.89922 WP_003403880.1.89926 WP_003403880.1.89963 WP_003403880.1.89971 WP_003403880.1.8998 WP_003403880.1.89987 WP_003403880.1.900 WP_003403880.1.90048 WP_003403880.1.9007 WP_003403880.1.90080 WP_003403880.1.90134 WP_003403880.1.90137 WP_003403880.1.90157 WP_003403880.1.90184 WP_003403880.1.90199 WP_003403880.1.90231 WP_003403880.1.90245 WP_003403880.1.90308 WP_003403880.1.90322 WP_003403880.1.90328 WP_003403880.1.90372 WP_003403880.1.90439 WP_003403880.1.90481 WP_003403880.1.90499 WP_003403880.1.9050 WP_003403880.1.90527 WP_003403880.1.90550 WP_003403880.1.90560 WP_003403880.1.90612 WP_003403880.1.90640 WP_003403880.1.90672 WP_003403880.1.90687 WP_003403880.1.90691 WP_003403880.1.90711 WP_003403880.1.90722 WP_003403880.1.90744 WP_003403880.1.9075 WP_003403880.1.90756 WP_003403880.1.90767 WP_003403880.1.90771 WP_003403880.1.90785 WP_003403880.1.90788 WP_003403880.1.90800 WP_003403880.1.90810 WP_003403880.1.90816 WP_003403880.1.90819 WP_003403880.1.9082 WP_003403880.1.90831 WP_003403880.1.90884 WP_003403880.1.90906 WP_003403880.1.90958 WP_003403880.1.90976 WP_003403880.1.90977 WP_003403880.1.90987 WP_003403880.1.9102 WP_003403880.1.91026 WP_003403880.1.91032 WP_003403880.1.91043 WP_003403880.1.91053 WP_003403880.1.91082 WP_003403880.1.91106 WP_003403880.1.91112 WP_003403880.1.91144 WP_003403880.1.91151 WP_003403880.1.91157 WP_003403880.1.91167 WP_003403880.1.91169 WP_003403880.1.91192 WP_003403880.1.91201 WP_003403880.1.91207 WP_003403880.1.91208 WP_003403880.1.91211 WP_003403880.1.91214 WP_003403880.1.91230 WP_003403880.1.91244 WP_003403880.1.91251 WP_003403880.1.91260 WP_003403880.1.91265 WP_003403880.1.9128 WP_003403880.1.91284 WP_003403880.1.91294 WP_003403880.1.91303 WP_003403880.1.91352 WP_003403880.1.91386 WP_003403880.1.9139 WP_003403880.1.91398 WP_003403880.1.91411 WP_003403880.1.91430 WP_003403880.1.91436 WP_003403880.1.91483 WP_003403880.1.91496 WP_003403880.1.91507 WP_003403880.1.91508 WP_003403880.1.91576 WP_003403880.1.91589 WP_003403880.1.91695 WP_003403880.1.91713 WP_003403880.1.91717 WP_003403880.1.91728 WP_003403880.1.91743 WP_003403880.1.91759 WP_003403880.1.91785 WP_003403880.1.91786 WP_003403880.1.91802 WP_003403880.1.91822 WP_003403880.1.91828 WP_003403880.1.9189 WP_003403880.1.91896 WP_003403880.1.9190 WP_003403880.1.91915 WP_003403880.1.91931 WP_003403880.1.91937 WP_003403880.1.91944 WP_003403880.1.91953 WP_003403880.1.91957 WP_003403880.1.91976 WP_003403880.1.91978 WP_003403880.1.92021 WP_003403880.1.92127 WP_003403880.1.92144 WP_003403880.1.92150 WP_003403880.1.92153 WP_003403880.1.92190 WP_003403880.1.92192 WP_003403880.1.92200 WP_003403880.1.92220 WP_003403880.1.92273 WP_003403880.1.92289 WP_003403880.1.9229 WP_003403880.1.92294 WP_003403880.1.92300 WP_003403880.1.92317 WP_003403880.1.92334 WP_003403880.1.92338 WP_003403880.1.92345 WP_003403880.1.92356 WP_003403880.1.92364 WP_003403880.1.92380 WP_003403880.1.92416 WP_003403880.1.92428 WP_003403880.1.92456 WP_003403880.1.92471 WP_003403880.1.92490 WP_003403880.1.92508 WP_003403880.1.9251 WP_003403880.1.92511 WP_003403880.1.92523 WP_003403880.1.92527 WP_003403880.1.92536 WP_003403880.1.92592 WP_003403880.1.92597 WP_003403880.1.92603 WP_003403880.1.92606 WP_003403880.1.92613 WP_003403880.1.9263 WP_003403880.1.9265 WP_003403880.1.92650 WP_003403880.1.92660 WP_003403880.1.92677 WP_003403880.1.92685 WP_003403880.1.92690 WP_003403880.1.92706 WP_003403880.1.92714 WP_003403880.1.92736 WP_003403880.1.9274 WP_003403880.1.92752 WP_003403880.1.92760 WP_003403880.1.92777 WP_003403880.1.92803 WP_003403880.1.92833 WP_003403880.1.92881 WP_003403880.1.92892 WP_003403880.1.92907 WP_003403880.1.92908 WP_003403880.1.9291 WP_003403880.1.92917 WP_003403880.1.92996 WP_003403880.1.93006 WP_003403880.1.93008 WP_003403880.1.93009 WP_003403880.1.93015 WP_003403880.1.93043 WP_003403880.1.9307 WP_003403880.1.93083 WP_003403880.1.93097 WP_003403880.1.93137 WP_003403880.1.93199 WP_003403880.1.93203 WP_003403880.1.93212 WP_003403880.1.93234 WP_003403880.1.93245 WP_003403880.1.93257 WP_003403880.1.93265 WP_003403880.1.93297 WP_003403880.1.93320 WP_003403880.1.93328 WP_003403880.1.93337 WP_003403880.1.93349 WP_003403880.1.93363 WP_003403880.1.93377 WP_003403880.1.9338 WP_003403880.1.93407 WP_003403880.1.93417 WP_003403880.1.93419 WP_003403880.1.93426 WP_003403880.1.9344 WP_003403880.1.93443 WP_003403880.1.93447 WP_003403880.1.93470 WP_003403880.1.93483 WP_003403880.1.93487 WP_003403880.1.93495 WP_003403880.1.93499 WP_003403880.1.93516 WP_003403880.1.93536 WP_003403880.1.93555 WP_003403880.1.93560 WP_003403880.1.93564 WP_003403880.1.9357 WP_003403880.1.93573 WP_003403880.1.93576 WP_003403880.1.93588 WP_003403880.1.9363 WP_003403880.1.93645 WP_003403880.1.93649 WP_003403880.1.93659 WP_003403880.1.93677 WP_003403880.1.9368 WP_003403880.1.93693 WP_003403880.1.93698 WP_003403880.1.93706 WP_003403880.1.9371 WP_003403880.1.93792 WP_003403880.1.93823 WP_003403880.1.93871 WP_003403880.1.9388 WP_003403880.1.93913 WP_003403880.1.93946 WP_003403880.1.93950 WP_003403880.1.93953 WP_003403880.1.93954 WP_003403880.1.93988 WP_003403880.1.9407 WP_003403880.1.94143 WP_003403880.1.94154 WP_003403880.1.94184 WP_003403880.1.94204 WP_003403880.1.94205 WP_003403880.1.94226 WP_003403880.1.94256 WP_003403880.1.94261 WP_003403880.1.94281 WP_003403880.1.94292 WP_003403880.1.94297 WP_003403880.1.9431 WP_003403880.1.94326 WP_003403880.1.94339 WP_003403880.1.94392 WP_003403880.1.94416 WP_003403880.1.94456 WP_003403880.1.94470 WP_003403880.1.94480 WP_003403880.1.94495 WP_003403880.1.94511 WP_003403880.1.94512 WP_003403880.1.94525 WP_003403880.1.94528 WP_003403880.1.94564 WP_003403880.1.946 WP_003403880.1.94602 WP_003403880.1.94623 WP_003403880.1.94629 WP_003403880.1.94673 WP_003403880.1.94714 WP_003403880.1.94730 WP_003403880.1.94736 WP_003403880.1.94776 WP_003403880.1.9478 WP_003403880.1.94834 WP_003403880.1.94852 WP_003403880.1.94872 WP_003403880.1.9488 WP_003403880.1.94902 WP_003403880.1.94916 WP_003403880.1.94979 WP_003403880.1.94994 WP_003403880.1.94996 WP_003403880.1.94998 WP_003403880.1.95007 WP_003403880.1.95010 WP_003403880.1.95015 WP_003403880.1.95034 WP_003403880.1.95068 WP_003403880.1.95081 WP_003403880.1.95082 WP_003403880.1.9509 WP_003403880.1.95096 WP_003403880.1.95112 WP_003403880.1.95138 WP_003403880.1.9514 WP_003403880.1.95179 WP_003403880.1.95188 WP_003403880.1.95234 WP_003403880.1.95241 WP_003403880.1.95245 WP_003403880.1.95257 WP_003403880.1.95279 WP_003403880.1.9531 WP_003403880.1.95335 WP_003403880.1.95344 WP_003403880.1.9535 WP_003403880.1.95370 WP_003403880.1.95392 WP_003403880.1.95416 WP_003403880.1.95417 WP_003403880.1.95454 WP_003403880.1.95455 WP_003403880.1.95491 WP_003403880.1.95497 WP_003403880.1.95508 WP_003403880.1.95509 WP_003403880.1.95529 WP_003403880.1.95556 WP_003403880.1.95557 WP_003403880.1.95565 WP_003403880.1.95578 WP_003403880.1.95580 WP_003403880.1.95585 WP_003403880.1.95643 WP_003403880.1.95679 WP_003403880.1.95685 WP_003403880.1.957 WP_003403880.1.95724 WP_003403880.1.95727 WP_003403880.1.95730 WP_003403880.1.95735 WP_003403880.1.95758 WP_003403880.1.95772 WP_003403880.1.95797 WP_003403880.1.95839 WP_003403880.1.9585 WP_003403880.1.9590 WP_003403880.1.95902 WP_003403880.1.95908 WP_003403880.1.95924 WP_003403880.1.95926 WP_003403880.1.95953 WP_003403880.1.95958 WP_003403880.1.95964 WP_003403880.1.95973 WP_003403880.1.96006 WP_003403880.1.9602 WP_003403880.1.96036 WP_003403880.1.96062 WP_003403880.1.96065 WP_003403880.1.96098 WP_003403880.1.96146 WP_003403880.1.96166 WP_003403880.1.96171 WP_003403880.1.96182 WP_003403880.1.96204 WP_003403880.1.96230 WP_003403880.1.96235 WP_003403880.1.96242 WP_003403880.1.96245 WP_003403880.1.96254 WP_003403880.1.96259 WP_003403880.1.96286 WP_003403880.1.96313 WP_003403880.1.96318 WP_003403880.1.96345 WP_003403880.1.96360 WP_003403880.1.96373 WP_003403880.1.96456 WP_003403880.1.96573 WP_003403880.1.96575 WP_003403880.1.96576 WP_003403880.1.96621 WP_003403880.1.9667 WP_003403880.1.96681 WP_003403880.1.96726 WP_003403880.1.96733 WP_003403880.1.96742 WP_003403880.1.96754 WP_003403880.1.9678 WP_003403880.1.96832 WP_003403880.1.9685 WP_003403880.1.97008 WP_003403880.1.97009 WP_003403880.1.97056 WP_003403880.1.97084 WP_003403880.1.97087 WP_003403880.1.97094 WP_003403880.1.97099 WP_003403880.1.97108 WP_003403880.1.97113 WP_003403880.1.97122 WP_003403880.1.97127 WP_003403880.1.97129 WP_003403880.1.97136 WP_003403880.1.9716 WP_003403880.1.97176 WP_003403880.1.97222 WP_003403880.1.97223 WP_003403880.1.97237 WP_003403880.1.97242 WP_003403880.1.97270 WP_003403880.1.97283 WP_003403880.1.97296 WP_003403880.1.97321 WP_003403880.1.97325 WP_003403880.1.97330 WP_003403880.1.97366 WP_003403880.1.97376 WP_003403880.1.97380 WP_003403880.1.9739 WP_003403880.1.97462 WP_003403880.1.97517 WP_003403880.1.97519 WP_003403880.1.97535 WP_003403880.1.97540 WP_003403880.1.97545 WP_003403880.1.97546 WP_003403880.1.97550 WP_003403880.1.97568 WP_003403880.1.97577 WP_003403880.1.97584 WP_003403880.1.9759 WP_003403880.1.97591 WP_003403880.1.97596 WP_003403880.1.97609 WP_003403880.1.97618 WP_003403880.1.9763 WP_003403880.1.97669 WP_003403880.1.97673 WP_003403880.1.97700 WP_003403880.1.97701 WP_003403880.1.97730 WP_003403880.1.97740 WP_003403880.1.97751 WP_003403880.1.97754 WP_003403880.1.97797 WP_003403880.1.9782 WP_003403880.1.9784 WP_003403880.1.97888 WP_003403880.1.9790 WP_003403880.1.9795 WP_003403880.1.97951 WP_003403880.1.97958 WP_003403880.1.97966 WP_003403880.1.97977 WP_003403880.1.97979 WP_003403880.1.98018 WP_003403880.1.98034 WP_003403880.1.98052 WP_003403880.1.98071 WP_003403880.1.98072 WP_003403880.1.98113 WP_003403880.1.98114 WP_003403880.1.98128 WP_003403880.1.98181 WP_003403880.1.98188 WP_003403880.1.98189 WP_003403880.1.98213 WP_003403880.1.98225 WP_003403880.1.98291 WP_003403880.1.98335 WP_003403880.1.98350 WP_003403880.1.98412 WP_003403880.1.98441 WP_003403880.1.98443 WP_003403880.1.98462 WP_003403880.1.9848 WP_003403880.1.98482 WP_003403880.1.98486 WP_003403880.1.98488 WP_003403880.1.98503 WP_003403880.1.98516 WP_003403880.1.98524 WP_003403880.1.98536 WP_003403880.1.98541 WP_003403880.1.98566 WP_003403880.1.98590 WP_003403880.1.98594 WP_003403880.1.98599 WP_003403880.1.98629 WP_003403880.1.98645 WP_003403880.1.98646 WP_003403880.1.98649 WP_003403880.1.98656 WP_003403880.1.98674 WP_003403880.1.98697 WP_003403880.1.98701 WP_003403880.1.98749 WP_003403880.1.98765 WP_003403880.1.98770 WP_003403880.1.98777 WP_003403880.1.98778 WP_003403880.1.98802 WP_003403880.1.98838 WP_003403880.1.98850 WP_003403880.1.98906 WP_003403880.1.98935 WP_003403880.1.98948 WP_003403880.1.98953 WP_003403880.1.98984 WP_003403880.1.99000 WP_003403880.1.99023 WP_003403880.1.99030 WP_003403880.1.99037 WP_003403880.1.99055 WP_003403880.1.99062 WP_003403880.1.99086 WP_003403880.1.99115 WP_003403880.1.99117 WP_003403880.1.99161 WP_003403880.1.99176 WP_003403880.1.99205 WP_003403880.1.99211 WP_003403880.1.99216 WP_003403880.1.99222 WP_003403880.1.99251 WP_003403880.1.99269 WP_003403880.1.99294 WP_003403880.1.99312 WP_003403880.1.99315 WP_003403880.1.99316 WP_003403880.1.99322 WP_003403880.1.99328 WP_003403880.1.99365 WP_003403880.1.99368 WP_003403880.1.99379 WP_003403880.1.99396 WP_003403880.1.99402 WP_003403880.1.99404 WP_003403880.1.99419 WP_003403880.1.99438 WP_003403880.1.99460 WP_003403880.1.99468 WP_003403880.1.99473 WP_003403880.1.99513 WP_003403880.1.99529 WP_003403880.1.99548 WP_003403880.1.99572 WP_003403880.1.99575 WP_003403880.1.99578 WP_003403880.1.99605 WP_003403880.1.99609 WP_003403880.1.99617 WP_003403880.1.99635 WP_003403880.1.99650 WP_003403880.1.99672 WP_003403880.1.99701 WP_003403880.1.99711 WP_003403880.1.99716 WP_003403880.1.99740 WP_003403880.1.99745 WP_003403880.1.99749 WP_003403880.1.9976 WP_003403880.1.99798 WP_003403880.1.99832 WP_003403880.1.99847 WP_003403880.1.99852 WP_003403880.1.99886 WP_003403880.1.99897 WP_003403880.1.99915 WP_003403880.1.9993 WP_003403880.1.99982 WP_003403880.1.99991 gi|375294980|ref|YP_005099247.1| gi|378770518|ref|YP_005170251.1| gi|121636684|ref|YP_976907.1| gi|224989156|ref|YP_002643843.1| gi|197739519|ref|YP_002160833.1| gi|392431189|ref|YP_006472233.1| gi|383306663|ref|YP_005359474.1| gi|494699149|ref|YP_007964631.1| Rv0760c gi|494695164|ref|YP_007960667.1| 2a15A gi|433625845|ref|YP_007259474.1| gi|479313641|ref|YP_007853693.1| gi|471336617|ref|YP_007609330.1| gi|148821966|ref|YP_001286720.1| gi|433640874|ref|YP_007286633.1| gi|506925185|ref|YP_008005635.1| gi|525673563|ref|YP_008224860.1| cath|current|2a15A00/5-137 cath|current|2z76A00/6-136 cath|current|2z76B00/6-136 cath|current|2z77A00/6-138 cath|current|2z77B00/5-135 cath|current|2z77C00/5-137 cath|current|2z77D00/6-135 cath|current|2z7aA00/4-136 cath|current|2z7aB00/6-136 cath|current|2z7aC00/3-136 cath|current|2z7aD00/7-135 gi|15607900|ref|NP_215274.1| 233413.Mb0783c 336982.TBFG_10775 410289.BCG_0812c 419947.MRA_0770 478434.TBMG_00775 561275.JTY_0782 83331.MT0785 83332.Rv0760c gi|494691389|ref|YP_007956932.1| gi|385997541|ref|YP_005915839.1| gi|15840175|ref|NP_335212.1| gi|148660537|ref|YP_001282060.1| gi|385990229|ref|YP_005908527.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]