SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I6WZS8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I6WZS8
Domain Number 1 Region: 1-160
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.000000000863
Family Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I6WZS8
Sequence length 358
Comment (tr|I6WZS8|I6WZS8_MYCTU) Uncharacterized protein {ECO:0000313|EMBL:CCP43674.1} KW=Complete proteome; Reference proteome OX=83332 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv). GN=Rv0926c OC=Mycobacterium; Mycobacterium tuberculosis complex.
Sequence
MAIPVVQLGTGNVGVHSLRALIADPEFELTGVWVSSDAKAGKDAAELAGLADSTGVRAST
DLNAVLATGPRCAVYNAMADNRLPEALEDYRRILAAGINIVGSGPVFLQYPWQVIPDEII
KPLQDAARAGNSSLYVNGIDPGFANDLLPMALAGTCESIEQIRCMEIVDYATYDSAVVMF
DVMGFGKPMDQIPMLLQPGVLSLAWGSVVRQLAAGLGISLDGVEEMYVREPAPEAFNIAS
GHIPKGSAAALRFEVLGLVDGVPAVVLEHVTRLRADLCPEWPQPAQPGGSYRIEISGEPC
YAMDICLSSRHGDHNHAGLVATAMRIVNAIPAVVAAEPGIRTTLDLPLITGEGRYAAA
Download sequence
Identical sequences A0A045H561 A0A083WF44 A0A089QMU9 A0A0H3L7S0 A0A0H3M944 A0A0K2HTH2 A0A109SLG4 A0A109SUY1 A0A197IZ86 A0A1R3XWU8 A0A1S1BAM0 A5U0W6 F8M4H2 G0TFS0 I6WZS8 M8CQF0 O05918 R4MG39
gi|433641050|ref|YP_007286809.1| gi|392385636|ref|YP_005307265.1| gi|385997707|ref|YP_005916005.1| gi|224989320|ref|YP_002644007.1| gi|471336797|ref|YP_007609510.1| gi|148822135|ref|YP_001286889.1| gi|15608066|ref|NP_215441.1| gi|121636849|ref|YP_977072.1| gi|385990380|ref|YP_005908678.1| gi|449062966|ref|YP_007430049.1| gi|15840349|ref|NP_335386.1| gi|31792113|ref|NP_854606.1| gi|479313811|ref|YP_007853863.1| gi|479054877|ref|YP_007350683.1| gi|253800047|ref|YP_003033048.1| gi|375297284|ref|YP_005101551.1| NP_215441.1.84033 WP_003404767.1.100000 WP_003404767.1.100021 WP_003404767.1.100069 WP_003404767.1.100087 WP_003404767.1.10015 WP_003404767.1.100208 WP_003404767.1.100216 WP_003404767.1.10022 WP_003404767.1.100255 WP_003404767.1.100260 WP_003404767.1.100270 WP_003404767.1.100279 WP_003404767.1.100286 WP_003404767.1.100308 WP_003404767.1.100309 WP_003404767.1.100318 WP_003404767.1.100337 WP_003404767.1.100338 WP_003404767.1.10037 WP_003404767.1.100383 WP_003404767.1.100395 WP_003404767.1.100396 WP_003404767.1.1004 WP_003404767.1.100401 WP_003404767.1.100459 WP_003404767.1.100460 WP_003404767.1.100552 WP_003404767.1.100581 WP_003404767.1.100600 WP_003404767.1.100625 WP_003404767.1.10064 WP_003404767.1.100666 WP_003404767.1.100671 WP_003404767.1.100677 WP_003404767.1.100682 WP_003404767.1.100697 WP_003404767.1.100703 WP_003404767.1.100716 WP_003404767.1.100722 WP_003404767.1.100754 WP_003404767.1.100757 WP_003404767.1.100772 WP_003404767.1.1008 WP_003404767.1.100812 WP_003404767.1.100866 WP_003404767.1.10088 WP_003404767.1.100889 WP_003404767.1.10090 WP_003404767.1.100910 WP_003404767.1.100915 WP_003404767.1.100918 WP_003404767.1.100935 WP_003404767.1.100984 WP_003404767.1.100992 WP_003404767.1.100998 WP_003404767.1.101 WP_003404767.1.101025 WP_003404767.1.101028 WP_003404767.1.10104 WP_003404767.1.101048 WP_003404767.1.101054 WP_003404767.1.101075 WP_003404767.1.101143 WP_003404767.1.101146 WP_003404767.1.10116 WP_003404767.1.10117 WP_003404767.1.101209 WP_003404767.1.10125 WP_003404767.1.101290 WP_003404767.1.101323 WP_003404767.1.101324 WP_003404767.1.101350 WP_003404767.1.101367 WP_003404767.1.101398 WP_003404767.1.101403 WP_003404767.1.101421 WP_003404767.1.10144 WP_003404767.1.101442 WP_003404767.1.10145 WP_003404767.1.101452 WP_003404767.1.101456 WP_003404767.1.101481 WP_003404767.1.101493 WP_003404767.1.101496 WP_003404767.1.101525 WP_003404767.1.101533 WP_003404767.1.101535 WP_003404767.1.101553 WP_003404767.1.101558 WP_003404767.1.10156 WP_003404767.1.101573 WP_003404767.1.101576 WP_003404767.1.10159 WP_003404767.1.101592 WP_003404767.1.101604 WP_003404767.1.101607 WP_003404767.1.101622 WP_003404767.1.101644 WP_003404767.1.101659 WP_003404767.1.101671 WP_003404767.1.101687 WP_003404767.1.101698 WP_003404767.1.10170 WP_003404767.1.101713 WP_003404767.1.101722 WP_003404767.1.101733 WP_003404767.1.101743 WP_003404767.1.101753 WP_003404767.1.101754 WP_003404767.1.101764 WP_003404767.1.101773 WP_003404767.1.101795 WP_003404767.1.101797 WP_003404767.1.101798 WP_003404767.1.101802 WP_003404767.1.101826 WP_003404767.1.101836 WP_003404767.1.101858 WP_003404767.1.101859 WP_003404767.1.101862 WP_003404767.1.101888 WP_003404767.1.101894 WP_003404767.1.101899 WP_003404767.1.1019 WP_003404767.1.101923 WP_003404767.1.101925 WP_003404767.1.10193 WP_003404767.1.101996 WP_003404767.1.102 WP_003404767.1.102008 WP_003404767.1.102017 WP_003404767.1.102053 WP_003404767.1.102055 WP_003404767.1.102063 WP_003404767.1.102099 WP_003404767.1.1021 WP_003404767.1.10211 WP_003404767.1.102119 WP_003404767.1.102121 WP_003404767.1.10216 WP_003404767.1.10224 WP_003404767.1.10253 WP_003404767.1.10262 WP_003404767.1.10272 WP_003404767.1.10277 WP_003404767.1.1033 WP_003404767.1.10350 WP_003404767.1.10362 WP_003404767.1.10366 WP_003404767.1.10376 WP_003404767.1.10396 WP_003404767.1.10410 WP_003404767.1.10414 WP_003404767.1.10430 WP_003404767.1.1044 WP_003404767.1.10440 WP_003404767.1.10445 WP_003404767.1.10471 WP_003404767.1.10472 WP_003404767.1.10489 WP_003404767.1.105 WP_003404767.1.10518 WP_003404767.1.10523 WP_003404767.1.10545 WP_003404767.1.1057 WP_003404767.1.10594 WP_003404767.1.10603 WP_003404767.1.10606 WP_003404767.1.10615 WP_003404767.1.10623 WP_003404767.1.10635 WP_003404767.1.10643 WP_003404767.1.10648 WP_003404767.1.10662 WP_003404767.1.10709 WP_003404767.1.10735 WP_003404767.1.10740 WP_003404767.1.10756 WP_003404767.1.10791 WP_003404767.1.10799 WP_003404767.1.10825 WP_003404767.1.10848 WP_003404767.1.10863 WP_003404767.1.10879 WP_003404767.1.10912 WP_003404767.1.10916 WP_003404767.1.10923 WP_003404767.1.10927 WP_003404767.1.1095 WP_003404767.1.10956 WP_003404767.1.10958 WP_003404767.1.10962 WP_003404767.1.10980 WP_003404767.1.10981 WP_003404767.1.10993 WP_003404767.1.1100 WP_003404767.1.11040 WP_003404767.1.11061 WP_003404767.1.11070 WP_003404767.1.11141 WP_003404767.1.11171 WP_003404767.1.11175 WP_003404767.1.11176 WP_003404767.1.11222 WP_003404767.1.11329 WP_003404767.1.1133 WP_003404767.1.11342 WP_003404767.1.11373 WP_003404767.1.11376 WP_003404767.1.11390 WP_003404767.1.11402 WP_003404767.1.11481 WP_003404767.1.11487 WP_003404767.1.11489 WP_003404767.1.11491 WP_003404767.1.11514 WP_003404767.1.11587 WP_003404767.1.11589 WP_003404767.1.11596 WP_003404767.1.11604 WP_003404767.1.11610 WP_003404767.1.11697 WP_003404767.1.11707 WP_003404767.1.11752 WP_003404767.1.11758 WP_003404767.1.11761 WP_003404767.1.11775 WP_003404767.1.11804 WP_003404767.1.11822 WP_003404767.1.11826 WP_003404767.1.11856 WP_003404767.1.11898 WP_003404767.1.11906 WP_003404767.1.11939 WP_003404767.1.11960 WP_003404767.1.11972 WP_003404767.1.11984 WP_003404767.1.120 WP_003404767.1.12001 WP_003404767.1.12049 WP_003404767.1.12052 WP_003404767.1.12100 WP_003404767.1.12116 WP_003404767.1.12130 WP_003404767.1.12133 WP_003404767.1.12161 WP_003404767.1.12165 WP_003404767.1.12184 WP_003404767.1.12187 WP_003404767.1.12190 WP_003404767.1.12216 WP_003404767.1.12265 WP_003404767.1.12275 WP_003404767.1.12293 WP_003404767.1.12294 WP_003404767.1.123 WP_003404767.1.1231 WP_003404767.1.12314 WP_003404767.1.12327 WP_003404767.1.12338 WP_003404767.1.1236 WP_003404767.1.12371 WP_003404767.1.12372 WP_003404767.1.12406 WP_003404767.1.1241 WP_003404767.1.12421 WP_003404767.1.12424 WP_003404767.1.12446 WP_003404767.1.12464 WP_003404767.1.12479 WP_003404767.1.12519 WP_003404767.1.12523 WP_003404767.1.12526 WP_003404767.1.1255 WP_003404767.1.12550 WP_003404767.1.12551 WP_003404767.1.12563 WP_003404767.1.12611 WP_003404767.1.12669 WP_003404767.1.1267 WP_003404767.1.12672 WP_003404767.1.12692 WP_003404767.1.1271 WP_003404767.1.12710 WP_003404767.1.12768 WP_003404767.1.1279 WP_003404767.1.12794 WP_003404767.1.12801 WP_003404767.1.12804 WP_003404767.1.12821 WP_003404767.1.12841 WP_003404767.1.12854 WP_003404767.1.12871 WP_003404767.1.12901 WP_003404767.1.12941 WP_003404767.1.12947 WP_003404767.1.12957 WP_003404767.1.12972 WP_003404767.1.13028 WP_003404767.1.13043 WP_003404767.1.13086 WP_003404767.1.13087 WP_003404767.1.13090 WP_003404767.1.13096 WP_003404767.1.13163 WP_003404767.1.13175 WP_003404767.1.13183 WP_003404767.1.132 WP_003404767.1.13249 WP_003404767.1.13282 WP_003404767.1.13284 WP_003404767.1.13296 WP_003404767.1.13298 WP_003404767.1.13302 WP_003404767.1.13306 WP_003404767.1.13312 WP_003404767.1.13313 WP_003404767.1.13321 WP_003404767.1.13345 WP_003404767.1.13358 WP_003404767.1.13370 WP_003404767.1.13420 WP_003404767.1.13433 WP_003404767.1.13435 WP_003404767.1.13438 WP_003404767.1.13461 WP_003404767.1.13466 WP_003404767.1.13489 WP_003404767.1.13526 WP_003404767.1.13551 WP_003404767.1.13561 WP_003404767.1.13564 WP_003404767.1.13579 WP_003404767.1.13647 WP_003404767.1.13687 WP_003404767.1.13697 WP_003404767.1.13719 WP_003404767.1.13763 WP_003404767.1.1377 WP_003404767.1.13774 WP_003404767.1.13786 WP_003404767.1.13793 WP_003404767.1.13794 WP_003404767.1.13817 WP_003404767.1.13834 WP_003404767.1.13866 WP_003404767.1.13880 WP_003404767.1.13899 WP_003404767.1.13909 WP_003404767.1.13910 WP_003404767.1.13919 WP_003404767.1.13920 WP_003404767.1.13952 WP_003404767.1.13953 WP_003404767.1.13962 WP_003404767.1.1398 WP_003404767.1.13988 WP_003404767.1.14027 WP_003404767.1.14046 WP_003404767.1.14115 WP_003404767.1.1415 WP_003404767.1.14152 WP_003404767.1.14158 WP_003404767.1.14162 WP_003404767.1.14175 WP_003404767.1.14178 WP_003404767.1.14194 WP_003404767.1.14195 WP_003404767.1.14208 WP_003404767.1.14238 WP_003404767.1.14266 WP_003404767.1.14273 WP_003404767.1.14303 WP_003404767.1.14306 WP_003404767.1.14307 WP_003404767.1.14310 WP_003404767.1.14341 WP_003404767.1.14382 WP_003404767.1.14416 WP_003404767.1.14428 WP_003404767.1.14441 WP_003404767.1.14469 WP_003404767.1.14477 WP_003404767.1.14504 WP_003404767.1.14514 WP_003404767.1.1452 WP_003404767.1.14527 WP_003404767.1.1454 WP_003404767.1.14548 WP_003404767.1.14551 WP_003404767.1.14561 WP_003404767.1.14573 WP_003404767.1.1462 WP_003404767.1.14658 WP_003404767.1.14667 WP_003404767.1.14668 WP_003404767.1.14675 WP_003404767.1.14694 WP_003404767.1.14695 WP_003404767.1.14709 WP_003404767.1.14766 WP_003404767.1.14783 WP_003404767.1.14865 WP_003404767.1.14872 WP_003404767.1.14905 WP_003404767.1.14926 WP_003404767.1.14951 WP_003404767.1.14955 WP_003404767.1.15003 WP_003404767.1.15009 WP_003404767.1.15028 WP_003404767.1.15040 WP_003404767.1.15052 WP_003404767.1.15065 WP_003404767.1.15072 WP_003404767.1.15089 WP_003404767.1.1509 WP_003404767.1.15126 WP_003404767.1.15131 WP_003404767.1.15168 WP_003404767.1.15172 WP_003404767.1.15174 WP_003404767.1.15187 WP_003404767.1.15196 WP_003404767.1.15210 WP_003404767.1.15216 WP_003404767.1.15217 WP_003404767.1.1523 WP_003404767.1.15232 WP_003404767.1.15238 WP_003404767.1.15240 WP_003404767.1.15253 WP_003404767.1.15267 WP_003404767.1.1527 WP_003404767.1.15292 WP_003404767.1.15299 WP_003404767.1.15302 WP_003404767.1.15322 WP_003404767.1.1534 WP_003404767.1.15345 WP_003404767.1.15365 WP_003404767.1.15386 WP_003404767.1.15387 WP_003404767.1.15442 WP_003404767.1.15449 WP_003404767.1.15477 WP_003404767.1.15481 WP_003404767.1.15492 WP_003404767.1.15511 WP_003404767.1.15512 WP_003404767.1.15558 WP_003404767.1.15559 WP_003404767.1.15566 WP_003404767.1.15599 WP_003404767.1.1560 WP_003404767.1.15611 WP_003404767.1.1563 WP_003404767.1.15633 WP_003404767.1.15643 WP_003404767.1.15688 WP_003404767.1.15755 WP_003404767.1.15763 WP_003404767.1.15774 WP_003404767.1.1578 WP_003404767.1.15780 WP_003404767.1.15827 WP_003404767.1.15834 WP_003404767.1.15842 WP_003404767.1.15848 WP_003404767.1.15853 WP_003404767.1.15870 WP_003404767.1.15877 WP_003404767.1.15893 WP_003404767.1.15896 WP_003404767.1.15926 WP_003404767.1.15933 WP_003404767.1.15946 WP_003404767.1.15958 WP_003404767.1.15973 WP_003404767.1.15987 WP_003404767.1.15993 WP_003404767.1.16009 WP_003404767.1.16025 WP_003404767.1.16043 WP_003404767.1.16066 WP_003404767.1.16069 WP_003404767.1.16077 WP_003404767.1.16106 WP_003404767.1.16108 WP_003404767.1.16130 WP_003404767.1.16136 WP_003404767.1.16139 WP_003404767.1.16141 WP_003404767.1.16143 WP_003404767.1.1630 WP_003404767.1.16318 WP_003404767.1.1632 WP_003404767.1.16327 WP_003404767.1.16334 WP_003404767.1.16341 WP_003404767.1.16345 WP_003404767.1.16374 WP_003404767.1.16384 WP_003404767.1.16386 WP_003404767.1.164 WP_003404767.1.1642 WP_003404767.1.16421 WP_003404767.1.16424 WP_003404767.1.16426 WP_003404767.1.16431 WP_003404767.1.1644 WP_003404767.1.16442 WP_003404767.1.16448 WP_003404767.1.16451 WP_003404767.1.16476 WP_003404767.1.16480 WP_003404767.1.16494 WP_003404767.1.1652 WP_003404767.1.16549 WP_003404767.1.16560 WP_003404767.1.16598 WP_003404767.1.16609 WP_003404767.1.16619 WP_003404767.1.16620 WP_003404767.1.16622 WP_003404767.1.16637 WP_003404767.1.1669 WP_003404767.1.16707 WP_003404767.1.16724 WP_003404767.1.16731 WP_003404767.1.16743 WP_003404767.1.1683 WP_003404767.1.16837 WP_003404767.1.16852 WP_003404767.1.16937 WP_003404767.1.16940 WP_003404767.1.16950 WP_003404767.1.16959 WP_003404767.1.16968 WP_003404767.1.1697 WP_003404767.1.16973 WP_003404767.1.16977 WP_003404767.1.16987 WP_003404767.1.17005 WP_003404767.1.17006 WP_003404767.1.17010 WP_003404767.1.17015 WP_003404767.1.17019 WP_003404767.1.17039 WP_003404767.1.17041 WP_003404767.1.17052 WP_003404767.1.17057 WP_003404767.1.17062 WP_003404767.1.1707 WP_003404767.1.17094 WP_003404767.1.17130 WP_003404767.1.17138 WP_003404767.1.17147 WP_003404767.1.17167 WP_003404767.1.17224 WP_003404767.1.17251 WP_003404767.1.17288 WP_003404767.1.17304 WP_003404767.1.17314 WP_003404767.1.17345 WP_003404767.1.17381 WP_003404767.1.17391 WP_003404767.1.17412 WP_003404767.1.1743 WP_003404767.1.17440 WP_003404767.1.17466 WP_003404767.1.17477 WP_003404767.1.17483 WP_003404767.1.17505 WP_003404767.1.17527 WP_003404767.1.17535 WP_003404767.1.17540 WP_003404767.1.17553 WP_003404767.1.17558 WP_003404767.1.17599 WP_003404767.1.17635 WP_003404767.1.17655 WP_003404767.1.17679 WP_003404767.1.1768 WP_003404767.1.17687 WP_003404767.1.17700 WP_003404767.1.17710 WP_003404767.1.17713 WP_003404767.1.17722 WP_003404767.1.17746 WP_003404767.1.17788 WP_003404767.1.17798 WP_003404767.1.17803 WP_003404767.1.17816 WP_003404767.1.17821 WP_003404767.1.17830 WP_003404767.1.17868 WP_003404767.1.17878 WP_003404767.1.1792 WP_003404767.1.17923 WP_003404767.1.1795 WP_003404767.1.17955 WP_003404767.1.17973 WP_003404767.1.18009 WP_003404767.1.18013 WP_003404767.1.18033 WP_003404767.1.18057 WP_003404767.1.18065 WP_003404767.1.18070 WP_003404767.1.18116 WP_003404767.1.18120 WP_003404767.1.18126 WP_003404767.1.1817 WP_003404767.1.18170 WP_003404767.1.18206 WP_003404767.1.18216 WP_003404767.1.18240 WP_003404767.1.18257 WP_003404767.1.18297 WP_003404767.1.18306 WP_003404767.1.18364 WP_003404767.1.18399 WP_003404767.1.18411 WP_003404767.1.18444 WP_003404767.1.18448 WP_003404767.1.18467 WP_003404767.1.18476 WP_003404767.1.18522 WP_003404767.1.18580 WP_003404767.1.18582 WP_003404767.1.18587 WP_003404767.1.186 WP_003404767.1.18601 WP_003404767.1.18639 WP_003404767.1.18646 WP_003404767.1.18647 WP_003404767.1.1868 WP_003404767.1.18694 WP_003404767.1.18710 WP_003404767.1.18751 WP_003404767.1.18781 WP_003404767.1.18793 WP_003404767.1.18804 WP_003404767.1.18816 WP_003404767.1.18823 WP_003404767.1.18827 WP_003404767.1.18838 WP_003404767.1.18849 WP_003404767.1.18856 WP_003404767.1.18945 WP_003404767.1.1898 WP_003404767.1.19005 WP_003404767.1.19056 WP_003404767.1.19063 WP_003404767.1.19066 WP_003404767.1.19071 WP_003404767.1.19085 WP_003404767.1.19094 WP_003404767.1.19144 WP_003404767.1.19159 WP_003404767.1.19193 WP_003404767.1.19231 WP_003404767.1.19243 WP_003404767.1.19264 WP_003404767.1.19295 WP_003404767.1.19307 WP_003404767.1.19326 WP_003404767.1.19364 WP_003404767.1.19382 WP_003404767.1.19400 WP_003404767.1.19426 WP_003404767.1.19429 WP_003404767.1.19480 WP_003404767.1.19512 WP_003404767.1.19553 WP_003404767.1.19562 WP_003404767.1.19564 WP_003404767.1.19568 WP_003404767.1.19572 WP_003404767.1.19595 WP_003404767.1.19596 WP_003404767.1.19600 WP_003404767.1.19630 WP_003404767.1.1967 WP_003404767.1.19694 WP_003404767.1.1970 WP_003404767.1.19707 WP_003404767.1.19742 WP_003404767.1.19785 WP_003404767.1.19820 WP_003404767.1.19868 WP_003404767.1.19874 WP_003404767.1.19890 WP_003404767.1.19900 WP_003404767.1.19922 WP_003404767.1.19936 WP_003404767.1.19946 WP_003404767.1.19949 WP_003404767.1.19960 WP_003404767.1.19964 WP_003404767.1.20007 WP_003404767.1.20016 WP_003404767.1.20028 WP_003404767.1.2003 WP_003404767.1.20037 WP_003404767.1.20039 WP_003404767.1.20082 WP_003404767.1.20085 WP_003404767.1.20097 WP_003404767.1.20116 WP_003404767.1.20130 WP_003404767.1.20140 WP_003404767.1.20141 WP_003404767.1.20142 WP_003404767.1.20158 WP_003404767.1.20239 WP_003404767.1.20243 WP_003404767.1.20259 WP_003404767.1.20262 WP_003404767.1.20268 WP_003404767.1.20272 WP_003404767.1.20280 WP_003404767.1.20294 WP_003404767.1.20300 WP_003404767.1.20309 WP_003404767.1.20322 WP_003404767.1.2037 WP_003404767.1.20372 WP_003404767.1.20381 WP_003404767.1.204 WP_003404767.1.20427 WP_003404767.1.20457 WP_003404767.1.20459 WP_003404767.1.20460 WP_003404767.1.20542 WP_003404767.1.20578 WP_003404767.1.20608 WP_003404767.1.20624 WP_003404767.1.20628 WP_003404767.1.2066 WP_003404767.1.20707 WP_003404767.1.20722 WP_003404767.1.20729 WP_003404767.1.20742 WP_003404767.1.20751 WP_003404767.1.20776 WP_003404767.1.20843 WP_003404767.1.20850 WP_003404767.1.2086 WP_003404767.1.20868 WP_003404767.1.20876 WP_003404767.1.20897 WP_003404767.1.20898 WP_003404767.1.2090 WP_003404767.1.20911 WP_003404767.1.20916 WP_003404767.1.20921 WP_003404767.1.20926 WP_003404767.1.20927 WP_003404767.1.20951 WP_003404767.1.20970 WP_003404767.1.2104 WP_003404767.1.21070 WP_003404767.1.21127 WP_003404767.1.21135 WP_003404767.1.21173 WP_003404767.1.21187 WP_003404767.1.212 WP_003404767.1.2120 WP_003404767.1.21219 WP_003404767.1.2123 WP_003404767.1.21231 WP_003404767.1.21234 WP_003404767.1.2126 WP_003404767.1.21292 WP_003404767.1.21307 WP_003404767.1.2131 WP_003404767.1.21311 WP_003404767.1.21321 WP_003404767.1.21365 WP_003404767.1.21392 WP_003404767.1.21397 WP_003404767.1.21403 WP_003404767.1.21415 WP_003404767.1.21418 WP_003404767.1.21430 WP_003404767.1.21434 WP_003404767.1.21444 WP_003404767.1.21468 WP_003404767.1.21498 WP_003404767.1.21509 WP_003404767.1.21513 WP_003404767.1.21560 WP_003404767.1.21565 WP_003404767.1.21586 WP_003404767.1.21591 WP_003404767.1.21594 WP_003404767.1.21602 WP_003404767.1.21615 WP_003404767.1.21638 WP_003404767.1.21639 WP_003404767.1.21655 WP_003404767.1.2168 WP_003404767.1.2174 WP_003404767.1.21741 WP_003404767.1.21742 WP_003404767.1.21777 WP_003404767.1.21786 WP_003404767.1.21795 WP_003404767.1.218 WP_003404767.1.21826 WP_003404767.1.21829 WP_003404767.1.21840 WP_003404767.1.21843 WP_003404767.1.21872 WP_003404767.1.21873 WP_003404767.1.2188 WP_003404767.1.21882 WP_003404767.1.21906 WP_003404767.1.21912 WP_003404767.1.2194 WP_003404767.1.21941 WP_003404767.1.21956 WP_003404767.1.21958 WP_003404767.1.21960 WP_003404767.1.21971 WP_003404767.1.21973 WP_003404767.1.21983 WP_003404767.1.22003 WP_003404767.1.22013 WP_003404767.1.22025 WP_003404767.1.22036 WP_003404767.1.22075 WP_003404767.1.22092 WP_003404767.1.2212 WP_003404767.1.22127 WP_003404767.1.22140 WP_003404767.1.22233 WP_003404767.1.22255 WP_003404767.1.22277 WP_003404767.1.22305 WP_003404767.1.22348 WP_003404767.1.22366 WP_003404767.1.2238 WP_003404767.1.22380 WP_003404767.1.22437 WP_003404767.1.22438 WP_003404767.1.22445 WP_003404767.1.22490 WP_003404767.1.22511 WP_003404767.1.22524 WP_003404767.1.2253 WP_003404767.1.22585 WP_003404767.1.22589 WP_003404767.1.22606 WP_003404767.1.22608 WP_003404767.1.22609 WP_003404767.1.22618 WP_003404767.1.2262 WP_003404767.1.22624 WP_003404767.1.22629 WP_003404767.1.22647 WP_003404767.1.22664 WP_003404767.1.22665 WP_003404767.1.22670 WP_003404767.1.22674 WP_003404767.1.22680 WP_003404767.1.22725 WP_003404767.1.22728 WP_003404767.1.22733 WP_003404767.1.22737 WP_003404767.1.2275 WP_003404767.1.22754 WP_003404767.1.22797 WP_003404767.1.22800 WP_003404767.1.22804 WP_003404767.1.22829 WP_003404767.1.22840 WP_003404767.1.22844 WP_003404767.1.22963 WP_003404767.1.22970 WP_003404767.1.22996 WP_003404767.1.22997 WP_003404767.1.22999 WP_003404767.1.23015 WP_003404767.1.23032 WP_003404767.1.231 WP_003404767.1.23101 WP_003404767.1.2312 WP_003404767.1.23140 WP_003404767.1.23153 WP_003404767.1.23171 WP_003404767.1.23199 WP_003404767.1.2320 WP_003404767.1.23204 WP_003404767.1.23216 WP_003404767.1.23229 WP_003404767.1.23233 WP_003404767.1.2326 WP_003404767.1.23261 WP_003404767.1.23272 WP_003404767.1.23289 WP_003404767.1.2329 WP_003404767.1.23308 WP_003404767.1.23316 WP_003404767.1.23321 WP_003404767.1.23325 WP_003404767.1.2339 WP_003404767.1.23406 WP_003404767.1.23438 WP_003404767.1.23445 WP_003404767.1.23447 WP_003404767.1.23452 WP_003404767.1.23461 WP_003404767.1.2349 WP_003404767.1.23496 WP_003404767.1.23497 WP_003404767.1.23506 WP_003404767.1.23530 WP_003404767.1.23539 WP_003404767.1.23546 WP_003404767.1.23551 WP_003404767.1.23573 WP_003404767.1.23583 WP_003404767.1.23588 WP_003404767.1.23628 WP_003404767.1.23677 WP_003404767.1.23683 WP_003404767.1.23692 WP_003404767.1.23694 WP_003404767.1.23699 WP_003404767.1.2371 WP_003404767.1.23807 WP_003404767.1.23825 WP_003404767.1.23832 WP_003404767.1.2384 WP_003404767.1.23843 WP_003404767.1.23863 WP_003404767.1.2387 WP_003404767.1.23894 WP_003404767.1.23993 WP_003404767.1.2400 WP_003404767.1.24007 WP_003404767.1.24008 WP_003404767.1.24046 WP_003404767.1.24057 WP_003404767.1.24062 WP_003404767.1.24113 WP_003404767.1.24119 WP_003404767.1.24140 WP_003404767.1.24176 WP_003404767.1.24190 WP_003404767.1.24202 WP_003404767.1.24244 WP_003404767.1.24261 WP_003404767.1.24294 WP_003404767.1.24357 WP_003404767.1.24396 WP_003404767.1.24414 WP_003404767.1.24423 WP_003404767.1.2443 WP_003404767.1.24446 WP_003404767.1.24461 WP_003404767.1.24500 WP_003404767.1.24507 WP_003404767.1.24509 WP_003404767.1.24529 WP_003404767.1.24553 WP_003404767.1.24599 WP_003404767.1.24648 WP_003404767.1.2466 WP_003404767.1.24767 WP_003404767.1.24824 WP_003404767.1.24831 WP_003404767.1.24840 WP_003404767.1.24848 WP_003404767.1.24857 WP_003404767.1.2487 WP_003404767.1.24907 WP_003404767.1.24933 WP_003404767.1.24956 WP_003404767.1.24958 WP_003404767.1.24985 WP_003404767.1.2499 WP_003404767.1.25004 WP_003404767.1.2505 WP_003404767.1.25051 WP_003404767.1.2507 WP_003404767.1.25096 WP_003404767.1.25103 WP_003404767.1.25129 WP_003404767.1.25171 WP_003404767.1.25184 WP_003404767.1.25247 WP_003404767.1.25252 WP_003404767.1.25278 WP_003404767.1.25283 WP_003404767.1.25309 WP_003404767.1.25313 WP_003404767.1.25338 WP_003404767.1.25342 WP_003404767.1.25343 WP_003404767.1.25367 WP_003404767.1.25393 WP_003404767.1.25406 WP_003404767.1.25435 WP_003404767.1.25437 WP_003404767.1.25445 WP_003404767.1.25455 WP_003404767.1.25473 WP_003404767.1.25504 WP_003404767.1.25513 WP_003404767.1.25542 WP_003404767.1.25579 WP_003404767.1.25594 WP_003404767.1.25606 WP_003404767.1.25645 WP_003404767.1.2566 WP_003404767.1.25673 WP_003404767.1.25674 WP_003404767.1.25693 WP_003404767.1.25699 WP_003404767.1.25727 WP_003404767.1.25736 WP_003404767.1.25738 WP_003404767.1.25756 WP_003404767.1.25759 WP_003404767.1.2580 WP_003404767.1.25813 WP_003404767.1.25854 WP_003404767.1.25874 WP_003404767.1.25885 WP_003404767.1.25892 WP_003404767.1.25906 WP_003404767.1.25914 WP_003404767.1.25916 WP_003404767.1.2594 WP_003404767.1.25954 WP_003404767.1.25965 WP_003404767.1.25972 WP_003404767.1.26017 WP_003404767.1.26032 WP_003404767.1.26038 WP_003404767.1.26072 WP_003404767.1.26089 WP_003404767.1.26097 WP_003404767.1.26098 WP_003404767.1.26108 WP_003404767.1.26109 WP_003404767.1.26118 WP_003404767.1.26126 WP_003404767.1.2614 WP_003404767.1.26168 WP_003404767.1.26182 WP_003404767.1.26190 WP_003404767.1.2620 WP_003404767.1.26234 WP_003404767.1.26243 WP_003404767.1.26265 WP_003404767.1.26267 WP_003404767.1.26292 WP_003404767.1.26310 WP_003404767.1.26328 WP_003404767.1.26349 WP_003404767.1.26366 WP_003404767.1.26374 WP_003404767.1.26407 WP_003404767.1.26412 WP_003404767.1.26454 WP_003404767.1.26464 WP_003404767.1.2653 WP_003404767.1.26560 WP_003404767.1.26571 WP_003404767.1.2659 WP_003404767.1.26597 WP_003404767.1.26603 WP_003404767.1.26629 WP_003404767.1.26651 WP_003404767.1.26702 WP_003404767.1.26707 WP_003404767.1.26710 WP_003404767.1.26719 WP_003404767.1.26737 WP_003404767.1.26738 WP_003404767.1.26745 WP_003404767.1.26756 WP_003404767.1.2676 WP_003404767.1.2677 WP_003404767.1.26779 WP_003404767.1.26780 WP_003404767.1.26854 WP_003404767.1.26868 WP_003404767.1.26876 WP_003404767.1.26888 WP_003404767.1.26945 WP_003404767.1.26959 WP_003404767.1.26969 WP_003404767.1.26984 WP_003404767.1.26992 WP_003404767.1.27017 WP_003404767.1.27045 WP_003404767.1.27074 WP_003404767.1.27075 WP_003404767.1.27128 WP_003404767.1.27130 WP_003404767.1.27139 WP_003404767.1.27152 WP_003404767.1.27162 WP_003404767.1.27164 WP_003404767.1.27193 WP_003404767.1.27235 WP_003404767.1.27254 WP_003404767.1.27278 WP_003404767.1.27343 WP_003404767.1.27352 WP_003404767.1.27369 WP_003404767.1.27391 WP_003404767.1.27398 WP_003404767.1.27402 WP_003404767.1.27410 WP_003404767.1.27411 WP_003404767.1.27449 WP_003404767.1.27460 WP_003404767.1.27463 WP_003404767.1.2749 WP_003404767.1.27492 WP_003404767.1.27528 WP_003404767.1.27541 WP_003404767.1.27576 WP_003404767.1.27582 WP_003404767.1.27596 WP_003404767.1.27607 WP_003404767.1.2766 WP_003404767.1.277 WP_003404767.1.27724 WP_003404767.1.27730 WP_003404767.1.27736 WP_003404767.1.27743 WP_003404767.1.27750 WP_003404767.1.27771 WP_003404767.1.27779 WP_003404767.1.27795 WP_003404767.1.27803 WP_003404767.1.27819 WP_003404767.1.27835 WP_003404767.1.27915 WP_003404767.1.27935 WP_003404767.1.27962 WP_003404767.1.28053 WP_003404767.1.28092 WP_003404767.1.28106 WP_003404767.1.28131 WP_003404767.1.28142 WP_003404767.1.28159 WP_003404767.1.2816 WP_003404767.1.28161 WP_003404767.1.28192 WP_003404767.1.28202 WP_003404767.1.28241 WP_003404767.1.28242 WP_003404767.1.28251 WP_003404767.1.28255 WP_003404767.1.28269 WP_003404767.1.28276 WP_003404767.1.28293 WP_003404767.1.28331 WP_003404767.1.28367 WP_003404767.1.28378 WP_003404767.1.28391 WP_003404767.1.2842 WP_003404767.1.28448 WP_003404767.1.2847 WP_003404767.1.28471 WP_003404767.1.28473 WP_003404767.1.28493 WP_003404767.1.28497 WP_003404767.1.28530 WP_003404767.1.28545 WP_003404767.1.28561 WP_003404767.1.28567 WP_003404767.1.28585 WP_003404767.1.286 WP_003404767.1.28610 WP_003404767.1.28617 WP_003404767.1.28634 WP_003404767.1.28642 WP_003404767.1.28671 WP_003404767.1.28682 WP_003404767.1.28698 WP_003404767.1.28703 WP_003404767.1.28739 WP_003404767.1.28781 WP_003404767.1.28787 WP_003404767.1.28827 WP_003404767.1.28839 WP_003404767.1.28847 WP_003404767.1.28850 WP_003404767.1.28851 WP_003404767.1.28865 WP_003404767.1.28897 WP_003404767.1.28914 WP_003404767.1.28935 WP_003404767.1.28936 WP_003404767.1.28939 WP_003404767.1.28943 WP_003404767.1.28952 WP_003404767.1.28975 WP_003404767.1.2899 WP_003404767.1.28993 WP_003404767.1.29000 WP_003404767.1.2901 WP_003404767.1.29028 WP_003404767.1.29033 WP_003404767.1.29058 WP_003404767.1.29115 WP_003404767.1.2916 WP_003404767.1.29217 WP_003404767.1.29223 WP_003404767.1.29234 WP_003404767.1.29264 WP_003404767.1.29275 WP_003404767.1.29306 WP_003404767.1.29339 WP_003404767.1.29348 WP_003404767.1.29364 WP_003404767.1.29367 WP_003404767.1.2938 WP_003404767.1.29426 WP_003404767.1.2944 WP_003404767.1.29449 WP_003404767.1.29450 WP_003404767.1.29452 WP_003404767.1.2949 WP_003404767.1.29510 WP_003404767.1.29515 WP_003404767.1.29525 WP_003404767.1.2953 WP_003404767.1.29559 WP_003404767.1.29587 WP_003404767.1.2959 WP_003404767.1.29592 WP_003404767.1.29599 WP_003404767.1.29611 WP_003404767.1.29632 WP_003404767.1.29649 WP_003404767.1.2965 WP_003404767.1.29659 WP_003404767.1.2969 WP_003404767.1.29696 WP_003404767.1.29698 WP_003404767.1.29718 WP_003404767.1.29745 WP_003404767.1.29747 WP_003404767.1.29769 WP_003404767.1.29825 WP_003404767.1.29830 WP_003404767.1.29847 WP_003404767.1.29861 WP_003404767.1.29869 WP_003404767.1.29883 WP_003404767.1.29890 WP_003404767.1.299 WP_003404767.1.29931 WP_003404767.1.29960 WP_003404767.1.30014 WP_003404767.1.3004 WP_003404767.1.30040 WP_003404767.1.30043 WP_003404767.1.30074 WP_003404767.1.30097 WP_003404767.1.30106 WP_003404767.1.30114 WP_003404767.1.30126 WP_003404767.1.30131 WP_003404767.1.30138 WP_003404767.1.30139 WP_003404767.1.30145 WP_003404767.1.30211 WP_003404767.1.30224 WP_003404767.1.30235 WP_003404767.1.30237 WP_003404767.1.3027 WP_003404767.1.30279 WP_003404767.1.30282 WP_003404767.1.30283 WP_003404767.1.30288 WP_003404767.1.30291 WP_003404767.1.30363 WP_003404767.1.30374 WP_003404767.1.30404 WP_003404767.1.3043 WP_003404767.1.30433 WP_003404767.1.30438 WP_003404767.1.30462 WP_003404767.1.30464 WP_003404767.1.30468 WP_003404767.1.30500 WP_003404767.1.3057 WP_003404767.1.30574 WP_003404767.1.30628 WP_003404767.1.30641 WP_003404767.1.30642 WP_003404767.1.30661 WP_003404767.1.30669 WP_003404767.1.30683 WP_003404767.1.30699 WP_003404767.1.30709 WP_003404767.1.30713 WP_003404767.1.30716 WP_003404767.1.30719 WP_003404767.1.30730 WP_003404767.1.30732 WP_003404767.1.30736 WP_003404767.1.30760 WP_003404767.1.30791 WP_003404767.1.308 WP_003404767.1.30807 WP_003404767.1.30818 WP_003404767.1.30824 WP_003404767.1.30848 WP_003404767.1.30877 WP_003404767.1.30888 WP_003404767.1.30901 WP_003404767.1.30903 WP_003404767.1.30912 WP_003404767.1.30913 WP_003404767.1.30914 WP_003404767.1.30919 WP_003404767.1.30977 WP_003404767.1.3100 WP_003404767.1.31002 WP_003404767.1.3101 WP_003404767.1.31034 WP_003404767.1.31047 WP_003404767.1.31070 WP_003404767.1.31074 WP_003404767.1.31102 WP_003404767.1.31127 WP_003404767.1.31184 WP_003404767.1.31199 WP_003404767.1.31226 WP_003404767.1.31230 WP_003404767.1.31233 WP_003404767.1.31263 WP_003404767.1.31264 WP_003404767.1.31270 WP_003404767.1.31287 WP_003404767.1.31290 WP_003404767.1.31304 WP_003404767.1.31346 WP_003404767.1.31348 WP_003404767.1.31354 WP_003404767.1.31390 WP_003404767.1.31414 WP_003404767.1.31417 WP_003404767.1.31428 WP_003404767.1.3143 WP_003404767.1.31458 WP_003404767.1.31483 WP_003404767.1.3149 WP_003404767.1.31498 WP_003404767.1.31507 WP_003404767.1.31537 WP_003404767.1.31548 WP_003404767.1.31569 WP_003404767.1.31573 WP_003404767.1.316 WP_003404767.1.31629 WP_003404767.1.31666 WP_003404767.1.31693 WP_003404767.1.31703 WP_003404767.1.31744 WP_003404767.1.31745 WP_003404767.1.31770 WP_003404767.1.31776 WP_003404767.1.31783 WP_003404767.1.318 WP_003404767.1.3184 WP_003404767.1.31840 WP_003404767.1.31880 WP_003404767.1.31911 WP_003404767.1.31930 WP_003404767.1.31932 WP_003404767.1.31955 WP_003404767.1.31985 WP_003404767.1.31991 WP_003404767.1.31995 WP_003404767.1.32004 WP_003404767.1.32039 WP_003404767.1.3204 WP_003404767.1.32045 WP_003404767.1.32071 WP_003404767.1.32098 WP_003404767.1.32132 WP_003404767.1.32157 WP_003404767.1.32164 WP_003404767.1.32179 WP_003404767.1.32198 WP_003404767.1.32297 WP_003404767.1.32317 WP_003404767.1.32383 WP_003404767.1.32400 WP_003404767.1.32403 WP_003404767.1.32416 WP_003404767.1.32461 WP_003404767.1.32482 WP_003404767.1.32503 WP_003404767.1.32556 WP_003404767.1.32562 WP_003404767.1.32569 WP_003404767.1.32592 WP_003404767.1.32620 WP_003404767.1.32647 WP_003404767.1.32653 WP_003404767.1.32654 WP_003404767.1.3268 WP_003404767.1.32695 WP_003404767.1.32706 WP_003404767.1.32716 WP_003404767.1.32738 WP_003404767.1.32752 WP_003404767.1.32780 WP_003404767.1.32781 WP_003404767.1.32793 WP_003404767.1.32799 WP_003404767.1.32822 WP_003404767.1.32833 WP_003404767.1.32862 WP_003404767.1.32880 WP_003404767.1.32897 WP_003404767.1.32909 WP_003404767.1.32935 WP_003404767.1.32974 WP_003404767.1.33007 WP_003404767.1.3302 WP_003404767.1.33028 WP_003404767.1.33035 WP_003404767.1.33044 WP_003404767.1.33054 WP_003404767.1.33082 WP_003404767.1.33141 WP_003404767.1.33148 WP_003404767.1.33155 WP_003404767.1.33168 WP_003404767.1.3321 WP_003404767.1.33215 WP_003404767.1.3325 WP_003404767.1.3327 WP_003404767.1.33278 WP_003404767.1.33288 WP_003404767.1.33305 WP_003404767.1.3331 WP_003404767.1.33319 WP_003404767.1.3333 WP_003404767.1.33393 WP_003404767.1.33403 WP_003404767.1.33452 WP_003404767.1.33467 WP_003404767.1.33477 WP_003404767.1.3349 WP_003404767.1.33519 WP_003404767.1.33542 WP_003404767.1.33601 WP_003404767.1.33602 WP_003404767.1.33633 WP_003404767.1.33673 WP_003404767.1.3369 WP_003404767.1.33705 WP_003404767.1.33762 WP_003404767.1.33783 WP_003404767.1.33789 WP_003404767.1.3383 WP_003404767.1.33832 WP_003404767.1.33839 WP_003404767.1.33848 WP_003404767.1.3387 WP_003404767.1.33886 WP_003404767.1.33895 WP_003404767.1.33906 WP_003404767.1.33912 WP_003404767.1.33954 WP_003404767.1.3399 WP_003404767.1.34042 WP_003404767.1.3405 WP_003404767.1.34055 WP_003404767.1.34056 WP_003404767.1.34065 WP_003404767.1.3408 WP_003404767.1.34090 WP_003404767.1.34109 WP_003404767.1.34111 WP_003404767.1.34131 WP_003404767.1.34152 WP_003404767.1.34153 WP_003404767.1.34163 WP_003404767.1.34181 WP_003404767.1.34197 WP_003404767.1.34198 WP_003404767.1.34215 WP_003404767.1.34219 WP_003404767.1.34255 WP_003404767.1.34260 WP_003404767.1.34275 WP_003404767.1.343 WP_003404767.1.34347 WP_003404767.1.34358 WP_003404767.1.34392 WP_003404767.1.344 WP_003404767.1.34428 WP_003404767.1.3443 WP_003404767.1.34435 WP_003404767.1.34446 WP_003404767.1.34499 WP_003404767.1.34505 WP_003404767.1.34516 WP_003404767.1.34529 WP_003404767.1.34551 WP_003404767.1.34563 WP_003404767.1.34576 WP_003404767.1.34581 WP_003404767.1.34588 WP_003404767.1.34596 WP_003404767.1.34599 WP_003404767.1.34639 WP_003404767.1.34673 WP_003404767.1.34724 WP_003404767.1.34740 WP_003404767.1.34755 WP_003404767.1.34777 WP_003404767.1.34783 WP_003404767.1.34841 WP_003404767.1.34908 WP_003404767.1.34919 WP_003404767.1.3492 WP_003404767.1.34933 WP_003404767.1.34945 WP_003404767.1.34946 WP_003404767.1.34954 WP_003404767.1.34960 WP_003404767.1.34961 WP_003404767.1.34963 WP_003404767.1.34965 WP_003404767.1.34968 WP_003404767.1.35023 WP_003404767.1.35069 WP_003404767.1.35072 WP_003404767.1.35078 WP_003404767.1.35100 WP_003404767.1.35146 WP_003404767.1.35156 WP_003404767.1.35160 WP_003404767.1.35173 WP_003404767.1.35176 WP_003404767.1.3520 WP_003404767.1.35213 WP_003404767.1.35221 WP_003404767.1.35246 WP_003404767.1.35278 WP_003404767.1.35301 WP_003404767.1.35311 WP_003404767.1.35312 WP_003404767.1.35317 WP_003404767.1.35319 WP_003404767.1.35347 WP_003404767.1.35363 WP_003404767.1.35382 WP_003404767.1.35385 WP_003404767.1.35396 WP_003404767.1.35397 WP_003404767.1.35426 WP_003404767.1.35439 WP_003404767.1.35455 WP_003404767.1.3548 WP_003404767.1.35484 WP_003404767.1.35492 WP_003404767.1.3553 WP_003404767.1.35553 WP_003404767.1.35555 WP_003404767.1.35561 WP_003404767.1.35602 WP_003404767.1.35610 WP_003404767.1.35635 WP_003404767.1.35657 WP_003404767.1.35680 WP_003404767.1.35687 WP_003404767.1.35689 WP_003404767.1.35707 WP_003404767.1.35732 WP_003404767.1.35754 WP_003404767.1.35767 WP_003404767.1.35770 WP_003404767.1.35771 WP_003404767.1.35780 WP_003404767.1.35805 WP_003404767.1.35811 WP_003404767.1.35821 WP_003404767.1.3584 WP_003404767.1.35848 WP_003404767.1.35864 WP_003404767.1.35874 WP_003404767.1.35876 WP_003404767.1.35897 WP_003404767.1.35899 WP_003404767.1.3593 WP_003404767.1.35954 WP_003404767.1.36005 WP_003404767.1.36014 WP_003404767.1.36023 WP_003404767.1.36051 WP_003404767.1.36053 WP_003404767.1.36075 WP_003404767.1.36089 WP_003404767.1.36097 WP_003404767.1.36098 WP_003404767.1.36116 WP_003404767.1.36145 WP_003404767.1.36156 WP_003404767.1.36205 WP_003404767.1.36228 WP_003404767.1.36246 WP_003404767.1.36252 WP_003404767.1.36260 WP_003404767.1.36270 WP_003404767.1.36271 WP_003404767.1.36303 WP_003404767.1.36309 WP_003404767.1.36315 WP_003404767.1.36319 WP_003404767.1.36321 WP_003404767.1.36326 WP_003404767.1.3634 WP_003404767.1.36356 WP_003404767.1.36357 WP_003404767.1.3636 WP_003404767.1.36385 WP_003404767.1.36399 WP_003404767.1.36436 WP_003404767.1.36465 WP_003404767.1.36469 WP_003404767.1.36473 WP_003404767.1.36508 WP_003404767.1.36540 WP_003404767.1.36561 WP_003404767.1.36571 WP_003404767.1.36573 WP_003404767.1.36578 WP_003404767.1.36585 WP_003404767.1.36597 WP_003404767.1.36614 WP_003404767.1.36657 WP_003404767.1.36674 WP_003404767.1.36720 WP_003404767.1.36727 WP_003404767.1.36733 WP_003404767.1.36785 WP_003404767.1.36810 WP_003404767.1.36844 WP_003404767.1.36862 WP_003404767.1.36893 WP_003404767.1.36901 WP_003404767.1.36921 WP_003404767.1.36935 WP_003404767.1.36941 WP_003404767.1.3695 WP_003404767.1.36951 WP_003404767.1.36968 WP_003404767.1.3700 WP_003404767.1.37004 WP_003404767.1.37012 WP_003404767.1.37071 WP_003404767.1.37088 WP_003404767.1.37131 WP_003404767.1.37157 WP_003404767.1.37175 WP_003404767.1.37188 WP_003404767.1.37213 WP_003404767.1.37229 WP_003404767.1.3724 WP_003404767.1.37277 WP_003404767.1.37305 WP_003404767.1.37330 WP_003404767.1.37389 WP_003404767.1.37400 WP_003404767.1.37440 WP_003404767.1.37459 WP_003404767.1.37468 WP_003404767.1.37475 WP_003404767.1.37484 WP_003404767.1.37601 WP_003404767.1.37612 WP_003404767.1.37632 WP_003404767.1.37643 WP_003404767.1.37655 WP_003404767.1.37660 WP_003404767.1.37674 WP_003404767.1.37700 WP_003404767.1.37701 WP_003404767.1.37709 WP_003404767.1.37711 WP_003404767.1.37721 WP_003404767.1.37722 WP_003404767.1.37747 WP_003404767.1.37765 WP_003404767.1.37772 WP_003404767.1.37804 WP_003404767.1.37809 WP_003404767.1.37859 WP_003404767.1.37877 WP_003404767.1.37912 WP_003404767.1.37913 WP_003404767.1.37943 WP_003404767.1.37950 WP_003404767.1.37973 WP_003404767.1.37975 WP_003404767.1.37983 WP_003404767.1.38 WP_003404767.1.38002 WP_003404767.1.3802 WP_003404767.1.38039 WP_003404767.1.38040 WP_003404767.1.38067 WP_003404767.1.38068 WP_003404767.1.38135 WP_003404767.1.38138 WP_003404767.1.38144 WP_003404767.1.38158 WP_003404767.1.38159 WP_003404767.1.38210 WP_003404767.1.38233 WP_003404767.1.38240 WP_003404767.1.38299 WP_003404767.1.38332 WP_003404767.1.38347 WP_003404767.1.38354 WP_003404767.1.38380 WP_003404767.1.38384 WP_003404767.1.38389 WP_003404767.1.38398 WP_003404767.1.38402 WP_003404767.1.38418 WP_003404767.1.38421 WP_003404767.1.38466 WP_003404767.1.38477 WP_003404767.1.38483 WP_003404767.1.385 WP_003404767.1.38530 WP_003404767.1.38535 WP_003404767.1.38594 WP_003404767.1.38601 WP_003404767.1.38611 WP_003404767.1.38638 WP_003404767.1.38639 WP_003404767.1.38646 WP_003404767.1.38648 WP_003404767.1.38654 WP_003404767.1.38659 WP_003404767.1.38660 WP_003404767.1.38666 WP_003404767.1.38671 WP_003404767.1.38672 WP_003404767.1.38677 WP_003404767.1.38750 WP_003404767.1.38772 WP_003404767.1.38812 WP_003404767.1.38821 WP_003404767.1.38844 WP_003404767.1.38863 WP_003404767.1.38873 WP_003404767.1.3889 WP_003404767.1.38894 WP_003404767.1.38909 WP_003404767.1.38939 WP_003404767.1.38974 WP_003404767.1.38975 WP_003404767.1.38991 WP_003404767.1.39025 WP_003404767.1.39070 WP_003404767.1.39072 WP_003404767.1.39095 WP_003404767.1.39106 WP_003404767.1.39165 WP_003404767.1.39174 WP_003404767.1.39176 WP_003404767.1.39178 WP_003404767.1.39190 WP_003404767.1.39201 WP_003404767.1.39207 WP_003404767.1.39211 WP_003404767.1.39236 WP_003404767.1.39239 WP_003404767.1.39252 WP_003404767.1.39288 WP_003404767.1.39295 WP_003404767.1.39306 WP_003404767.1.39359 WP_003404767.1.39364 WP_003404767.1.39400 WP_003404767.1.39447 WP_003404767.1.3945 WP_003404767.1.39450 WP_003404767.1.39455 WP_003404767.1.3949 WP_003404767.1.39521 WP_003404767.1.39560 WP_003404767.1.39592 WP_003404767.1.39593 WP_003404767.1.396 WP_003404767.1.3960 WP_003404767.1.39616 WP_003404767.1.39654 WP_003404767.1.39657 WP_003404767.1.39661 WP_003404767.1.39674 WP_003404767.1.39678 WP_003404767.1.3968 WP_003404767.1.39694 WP_003404767.1.3971 WP_003404767.1.39718 WP_003404767.1.39728 WP_003404767.1.39739 WP_003404767.1.39748 WP_003404767.1.39751 WP_003404767.1.39759 WP_003404767.1.39801 WP_003404767.1.39804 WP_003404767.1.39848 WP_003404767.1.39877 WP_003404767.1.39925 WP_003404767.1.3994 WP_003404767.1.39959 WP_003404767.1.3996 WP_003404767.1.3997 WP_003404767.1.39980 WP_003404767.1.40000 WP_003404767.1.40028 WP_003404767.1.40029 WP_003404767.1.4003 WP_003404767.1.40094 WP_003404767.1.40096 WP_003404767.1.40150 WP_003404767.1.40156 WP_003404767.1.40174 WP_003404767.1.40186 WP_003404767.1.40276 WP_003404767.1.40277 WP_003404767.1.40323 WP_003404767.1.40336 WP_003404767.1.40353 WP_003404767.1.4036 WP_003404767.1.40372 WP_003404767.1.40402 WP_003404767.1.40413 WP_003404767.1.40440 WP_003404767.1.40446 WP_003404767.1.40451 WP_003404767.1.40455 WP_003404767.1.40523 WP_003404767.1.40543 WP_003404767.1.40641 WP_003404767.1.40646 WP_003404767.1.40651 WP_003404767.1.40653 WP_003404767.1.4067 WP_003404767.1.40705 WP_003404767.1.40723 WP_003404767.1.40731 WP_003404767.1.40735 WP_003404767.1.40795 WP_003404767.1.40799 WP_003404767.1.40876 WP_003404767.1.40881 WP_003404767.1.40922 WP_003404767.1.4095 WP_003404767.1.40956 WP_003404767.1.40957 WP_003404767.1.40964 WP_003404767.1.4097 WP_003404767.1.410 WP_003404767.1.41000 WP_003404767.1.41055 WP_003404767.1.41108 WP_003404767.1.41123 WP_003404767.1.41177 WP_003404767.1.41202 WP_003404767.1.41219 WP_003404767.1.41231 WP_003404767.1.41249 WP_003404767.1.4127 WP_003404767.1.41296 WP_003404767.1.41355 WP_003404767.1.41376 WP_003404767.1.41430 WP_003404767.1.41447 WP_003404767.1.41469 WP_003404767.1.41504 WP_003404767.1.41553 WP_003404767.1.41564 WP_003404767.1.41583 WP_003404767.1.41616 WP_003404767.1.41632 WP_003404767.1.41635 WP_003404767.1.41636 WP_003404767.1.41648 WP_003404767.1.41660 WP_003404767.1.41685 WP_003404767.1.41695 WP_003404767.1.41704 WP_003404767.1.4171 WP_003404767.1.41719 WP_003404767.1.41733 WP_003404767.1.41744 WP_003404767.1.41774 WP_003404767.1.41791 WP_003404767.1.41803 WP_003404767.1.41820 WP_003404767.1.41828 WP_003404767.1.41829 WP_003404767.1.41860 WP_003404767.1.41912 WP_003404767.1.41921 WP_003404767.1.41933 WP_003404767.1.41944 WP_003404767.1.42043 WP_003404767.1.42075 WP_003404767.1.42078 WP_003404767.1.42094 WP_003404767.1.42112 WP_003404767.1.4212 WP_003404767.1.42122 WP_003404767.1.42134 WP_003404767.1.42183 WP_003404767.1.42188 WP_003404767.1.42201 WP_003404767.1.42202 WP_003404767.1.42208 WP_003404767.1.42247 WP_003404767.1.42255 WP_003404767.1.42273 WP_003404767.1.42278 WP_003404767.1.42304 WP_003404767.1.42309 WP_003404767.1.42370 WP_003404767.1.42385 WP_003404767.1.42400 WP_003404767.1.42409 WP_003404767.1.42414 WP_003404767.1.42417 WP_003404767.1.42430 WP_003404767.1.42461 WP_003404767.1.42465 WP_003404767.1.42467 WP_003404767.1.42473 WP_003404767.1.42474 WP_003404767.1.4248 WP_003404767.1.42494 WP_003404767.1.42519 WP_003404767.1.42524 WP_003404767.1.42534 WP_003404767.1.4255 WP_003404767.1.42562 WP_003404767.1.42568 WP_003404767.1.42570 WP_003404767.1.42618 WP_003404767.1.42660 WP_003404767.1.42695 WP_003404767.1.42704 WP_003404767.1.42705 WP_003404767.1.42722 WP_003404767.1.42782 WP_003404767.1.42835 WP_003404767.1.42839 WP_003404767.1.42842 WP_003404767.1.42905 WP_003404767.1.42916 WP_003404767.1.42930 WP_003404767.1.42971 WP_003404767.1.43005 WP_003404767.1.43009 WP_003404767.1.43053 WP_003404767.1.43082 WP_003404767.1.43087 WP_003404767.1.43098 WP_003404767.1.43208 WP_003404767.1.43236 WP_003404767.1.43246 WP_003404767.1.43255 WP_003404767.1.43266 WP_003404767.1.43269 WP_003404767.1.43273 WP_003404767.1.43296 WP_003404767.1.43306 WP_003404767.1.4335 WP_003404767.1.43368 WP_003404767.1.43395 WP_003404767.1.43462 WP_003404767.1.43475 WP_003404767.1.43478 WP_003404767.1.43484 WP_003404767.1.43557 WP_003404767.1.43578 WP_003404767.1.43588 WP_003404767.1.43643 WP_003404767.1.43664 WP_003404767.1.43684 WP_003404767.1.43686 WP_003404767.1.43706 WP_003404767.1.43716 WP_003404767.1.4377 WP_003404767.1.43781 WP_003404767.1.43794 WP_003404767.1.43815 WP_003404767.1.43846 WP_003404767.1.43861 WP_003404767.1.43863 WP_003404767.1.43866 WP_003404767.1.43872 WP_003404767.1.43885 WP_003404767.1.4390 WP_003404767.1.43902 WP_003404767.1.43921 WP_003404767.1.43936 WP_003404767.1.43937 WP_003404767.1.43960 WP_003404767.1.43965 WP_003404767.1.4399 WP_003404767.1.43993 WP_003404767.1.43996 WP_003404767.1.44 WP_003404767.1.44001 WP_003404767.1.44008 WP_003404767.1.44016 WP_003404767.1.44033 WP_003404767.1.44037 WP_003404767.1.44041 WP_003404767.1.44070 WP_003404767.1.44071 WP_003404767.1.44076 WP_003404767.1.44104 WP_003404767.1.44111 WP_003404767.1.44124 WP_003404767.1.44169 WP_003404767.1.44219 WP_003404767.1.44237 WP_003404767.1.44277 WP_003404767.1.44279 WP_003404767.1.44336 WP_003404767.1.44355 WP_003404767.1.44358 WP_003404767.1.4438 WP_003404767.1.44390 WP_003404767.1.44392 WP_003404767.1.4441 WP_003404767.1.44415 WP_003404767.1.44464 WP_003404767.1.44466 WP_003404767.1.44492 WP_003404767.1.44494 WP_003404767.1.44500 WP_003404767.1.44519 WP_003404767.1.44526 WP_003404767.1.44532 WP_003404767.1.44534 WP_003404767.1.44562 WP_003404767.1.44589 WP_003404767.1.44600 WP_003404767.1.44602 WP_003404767.1.44615 WP_003404767.1.4464 WP_003404767.1.44651 WP_003404767.1.44659 WP_003404767.1.44665 WP_003404767.1.44694 WP_003404767.1.44700 WP_003404767.1.44735 WP_003404767.1.44740 WP_003404767.1.44757 WP_003404767.1.4476 WP_003404767.1.44761 WP_003404767.1.44767 WP_003404767.1.44776 WP_003404767.1.44779 WP_003404767.1.44786 WP_003404767.1.44808 WP_003404767.1.44864 WP_003404767.1.44901 WP_003404767.1.44908 WP_003404767.1.44913 WP_003404767.1.4492 WP_003404767.1.44939 WP_003404767.1.44979 WP_003404767.1.44981 WP_003404767.1.45002 WP_003404767.1.45011 WP_003404767.1.4504 WP_003404767.1.45062 WP_003404767.1.45066 WP_003404767.1.45081 WP_003404767.1.45113 WP_003404767.1.45129 WP_003404767.1.45135 WP_003404767.1.45147 WP_003404767.1.45168 WP_003404767.1.4517 WP_003404767.1.45181 WP_003404767.1.45185 WP_003404767.1.45192 WP_003404767.1.45200 WP_003404767.1.45205 WP_003404767.1.45211 WP_003404767.1.45249 WP_003404767.1.4526 WP_003404767.1.45286 WP_003404767.1.45326 WP_003404767.1.45347 WP_003404767.1.45374 WP_003404767.1.45390 WP_003404767.1.454 WP_003404767.1.45407 WP_003404767.1.45451 WP_003404767.1.45453 WP_003404767.1.45460 WP_003404767.1.45463 WP_003404767.1.45470 WP_003404767.1.45474 WP_003404767.1.45491 WP_003404767.1.45510 WP_003404767.1.45563 WP_003404767.1.45584 WP_003404767.1.45590 WP_003404767.1.45619 WP_003404767.1.45626 WP_003404767.1.45631 WP_003404767.1.45697 WP_003404767.1.4571 WP_003404767.1.45731 WP_003404767.1.45743 WP_003404767.1.45765 WP_003404767.1.45776 WP_003404767.1.45783 WP_003404767.1.45805 WP_003404767.1.45815 WP_003404767.1.45849 WP_003404767.1.45867 WP_003404767.1.45884 WP_003404767.1.45923 WP_003404767.1.45926 WP_003404767.1.45963 WP_003404767.1.45992 WP_003404767.1.46025 WP_003404767.1.46083 WP_003404767.1.46090 WP_003404767.1.46092 WP_003404767.1.46100 WP_003404767.1.46101 WP_003404767.1.46103 WP_003404767.1.46107 WP_003404767.1.46127 WP_003404767.1.46128 WP_003404767.1.46129 WP_003404767.1.46141 WP_003404767.1.46150 WP_003404767.1.46201 WP_003404767.1.46226 WP_003404767.1.4624 WP_003404767.1.46253 WP_003404767.1.46268 WP_003404767.1.46285 WP_003404767.1.46300 WP_003404767.1.46313 WP_003404767.1.46336 WP_003404767.1.46365 WP_003404767.1.46370 WP_003404767.1.46381 WP_003404767.1.46402 WP_003404767.1.46411 WP_003404767.1.4644 WP_003404767.1.46442 WP_003404767.1.46453 WP_003404767.1.46478 WP_003404767.1.46492 WP_003404767.1.46521 WP_003404767.1.4653 WP_003404767.1.46532 WP_003404767.1.46539 WP_003404767.1.46568 WP_003404767.1.46585 WP_003404767.1.46609 WP_003404767.1.46613 WP_003404767.1.46625 WP_003404767.1.46642 WP_003404767.1.46647 WP_003404767.1.46724 WP_003404767.1.46758 WP_003404767.1.46773 WP_003404767.1.46777 WP_003404767.1.46786 WP_003404767.1.46792 WP_003404767.1.46847 WP_003404767.1.4687 WP_003404767.1.46897 WP_003404767.1.46936 WP_003404767.1.46980 WP_003404767.1.47011 WP_003404767.1.47012 WP_003404767.1.47066 WP_003404767.1.47077 WP_003404767.1.47083 WP_003404767.1.47106 WP_003404767.1.47142 WP_003404767.1.47147 WP_003404767.1.47166 WP_003404767.1.47178 WP_003404767.1.47179 WP_003404767.1.47194 WP_003404767.1.47207 WP_003404767.1.47210 WP_003404767.1.47261 WP_003404767.1.47262 WP_003404767.1.47402 WP_003404767.1.47423 WP_003404767.1.47467 WP_003404767.1.47502 WP_003404767.1.4751 WP_003404767.1.47511 WP_003404767.1.47537 WP_003404767.1.47540 WP_003404767.1.47568 WP_003404767.1.47572 WP_003404767.1.47588 WP_003404767.1.47636 WP_003404767.1.4764 WP_003404767.1.47653 WP_003404767.1.47679 WP_003404767.1.47681 WP_003404767.1.47690 WP_003404767.1.4771 WP_003404767.1.47717 WP_003404767.1.47743 WP_003404767.1.47754 WP_003404767.1.47773 WP_003404767.1.47776 WP_003404767.1.47780 WP_003404767.1.47805 WP_003404767.1.47832 WP_003404767.1.47847 WP_003404767.1.47858 WP_003404767.1.47861 WP_003404767.1.47868 WP_003404767.1.47893 WP_003404767.1.47899 WP_003404767.1.479 WP_003404767.1.47912 WP_003404767.1.47913 WP_003404767.1.47926 WP_003404767.1.4794 WP_003404767.1.47943 WP_003404767.1.47944 WP_003404767.1.47959 WP_003404767.1.47974 WP_003404767.1.47993 WP_003404767.1.48004 WP_003404767.1.48039 WP_003404767.1.48050 WP_003404767.1.48084 WP_003404767.1.48097 WP_003404767.1.48101 WP_003404767.1.48109 WP_003404767.1.4813 WP_003404767.1.48130 WP_003404767.1.48135 WP_003404767.1.48143 WP_003404767.1.48155 WP_003404767.1.48170 WP_003404767.1.48173 WP_003404767.1.48177 WP_003404767.1.48185 WP_003404767.1.48204 WP_003404767.1.48219 WP_003404767.1.4823 WP_003404767.1.48240 WP_003404767.1.48256 WP_003404767.1.48264 WP_003404767.1.48287 WP_003404767.1.48330 WP_003404767.1.48333 WP_003404767.1.48348 WP_003404767.1.48354 WP_003404767.1.48372 WP_003404767.1.48383 WP_003404767.1.48388 WP_003404767.1.48419 WP_003404767.1.48423 WP_003404767.1.48443 WP_003404767.1.48450 WP_003404767.1.48462 WP_003404767.1.48543 WP_003404767.1.48605 WP_003404767.1.48618 WP_003404767.1.4863 WP_003404767.1.48648 WP_003404767.1.48658 WP_003404767.1.48666 WP_003404767.1.48687 WP_003404767.1.48779 WP_003404767.1.4878 WP_003404767.1.48798 WP_003404767.1.48802 WP_003404767.1.48826 WP_003404767.1.48831 WP_003404767.1.48843 WP_003404767.1.48857 WP_003404767.1.4890 WP_003404767.1.48946 WP_003404767.1.48979 WP_003404767.1.49017 WP_003404767.1.49048 WP_003404767.1.49059 WP_003404767.1.4907 WP_003404767.1.49103 WP_003404767.1.49110 WP_003404767.1.49111 WP_003404767.1.49112 WP_003404767.1.4919 WP_003404767.1.49251 WP_003404767.1.49254 WP_003404767.1.49263 WP_003404767.1.49291 WP_003404767.1.49296 WP_003404767.1.49335 WP_003404767.1.49337 WP_003404767.1.49419 WP_003404767.1.49426 WP_003404767.1.49437 WP_003404767.1.49439 WP_003404767.1.49474 WP_003404767.1.49506 WP_003404767.1.49523 WP_003404767.1.49526 WP_003404767.1.49532 WP_003404767.1.49588 WP_003404767.1.4959 WP_003404767.1.49678 WP_003404767.1.49687 WP_003404767.1.49699 WP_003404767.1.49709 WP_003404767.1.4971 WP_003404767.1.4972 WP_003404767.1.49736 WP_003404767.1.49746 WP_003404767.1.49764 WP_003404767.1.49773 WP_003404767.1.49796 WP_003404767.1.49814 WP_003404767.1.49815 WP_003404767.1.49816 WP_003404767.1.49839 WP_003404767.1.49857 WP_003404767.1.49878 WP_003404767.1.49880 WP_003404767.1.49944 WP_003404767.1.4999 WP_003404767.1.49990 WP_003404767.1.50068 WP_003404767.1.50077 WP_003404767.1.5008 WP_003404767.1.50081 WP_003404767.1.50122 WP_003404767.1.50126 WP_003404767.1.50149 WP_003404767.1.50162 WP_003404767.1.5018 WP_003404767.1.50194 WP_003404767.1.50218 WP_003404767.1.50235 WP_003404767.1.50249 WP_003404767.1.50265 WP_003404767.1.50271 WP_003404767.1.50324 WP_003404767.1.50347 WP_003404767.1.50372 WP_003404767.1.50398 WP_003404767.1.50407 WP_003404767.1.50444 WP_003404767.1.50466 WP_003404767.1.50472 WP_003404767.1.5048 WP_003404767.1.50498 WP_003404767.1.5050 WP_003404767.1.50540 WP_003404767.1.50554 WP_003404767.1.50557 WP_003404767.1.50601 WP_003404767.1.50610 WP_003404767.1.50632 WP_003404767.1.50633 WP_003404767.1.50655 WP_003404767.1.50659 WP_003404767.1.50683 WP_003404767.1.50689 WP_003404767.1.50692 WP_003404767.1.50714 WP_003404767.1.50729 WP_003404767.1.50756 WP_003404767.1.50784 WP_003404767.1.50794 WP_003404767.1.50841 WP_003404767.1.50860 WP_003404767.1.50868 WP_003404767.1.50877 WP_003404767.1.5096 WP_003404767.1.50981 WP_003404767.1.50987 WP_003404767.1.51003 WP_003404767.1.51009 WP_003404767.1.51037 WP_003404767.1.51074 WP_003404767.1.51082 WP_003404767.1.51101 WP_003404767.1.51116 WP_003404767.1.51149 WP_003404767.1.51157 WP_003404767.1.51213 WP_003404767.1.51232 WP_003404767.1.51239 WP_003404767.1.51247 WP_003404767.1.51266 WP_003404767.1.51279 WP_003404767.1.51291 WP_003404767.1.51294 WP_003404767.1.51301 WP_003404767.1.51329 WP_003404767.1.51391 WP_003404767.1.51422 WP_003404767.1.51445 WP_003404767.1.51466 WP_003404767.1.51468 WP_003404767.1.51478 WP_003404767.1.51497 WP_003404767.1.51520 WP_003404767.1.51593 WP_003404767.1.51628 WP_003404767.1.5164 WP_003404767.1.51647 WP_003404767.1.51660 WP_003404767.1.51696 WP_003404767.1.51721 WP_003404767.1.51788 WP_003404767.1.51795 WP_003404767.1.51801 WP_003404767.1.51817 WP_003404767.1.51819 WP_003404767.1.51854 WP_003404767.1.51923 WP_003404767.1.51942 WP_003404767.1.51963 WP_003404767.1.51969 WP_003404767.1.52000 WP_003404767.1.52001 WP_003404767.1.52003 WP_003404767.1.52006 WP_003404767.1.52036 WP_003404767.1.52038 WP_003404767.1.52046 WP_003404767.1.52059 WP_003404767.1.52069 WP_003404767.1.52082 WP_003404767.1.52102 WP_003404767.1.52106 WP_003404767.1.52166 WP_003404767.1.52168 WP_003404767.1.52173 WP_003404767.1.52178 WP_003404767.1.52206 WP_003404767.1.52216 WP_003404767.1.52238 WP_003404767.1.52241 WP_003404767.1.52280 WP_003404767.1.52314 WP_003404767.1.52385 WP_003404767.1.52390 WP_003404767.1.524 WP_003404767.1.52460 WP_003404767.1.52485 WP_003404767.1.52486 WP_003404767.1.52495 WP_003404767.1.52504 WP_003404767.1.52522 WP_003404767.1.52531 WP_003404767.1.52533 WP_003404767.1.52545 WP_003404767.1.52553 WP_003404767.1.52563 WP_003404767.1.52564 WP_003404767.1.52574 WP_003404767.1.52641 WP_003404767.1.52673 WP_003404767.1.52674 WP_003404767.1.52708 WP_003404767.1.52713 WP_003404767.1.52761 WP_003404767.1.52778 WP_003404767.1.52791 WP_003404767.1.52797 WP_003404767.1.52818 WP_003404767.1.52872 WP_003404767.1.52873 WP_003404767.1.52891 WP_003404767.1.52892 WP_003404767.1.52909 WP_003404767.1.52970 WP_003404767.1.52998 WP_003404767.1.53053 WP_003404767.1.53056 WP_003404767.1.5306 WP_003404767.1.53088 WP_003404767.1.5309 WP_003404767.1.531 WP_003404767.1.53117 WP_003404767.1.53118 WP_003404767.1.53142 WP_003404767.1.53143 WP_003404767.1.53157 WP_003404767.1.53167 WP_003404767.1.53200 WP_003404767.1.53204 WP_003404767.1.53213 WP_003404767.1.53217 WP_003404767.1.53226 WP_003404767.1.53229 WP_003404767.1.53230 WP_003404767.1.53237 WP_003404767.1.53254 WP_003404767.1.53257 WP_003404767.1.5327 WP_003404767.1.53276 WP_003404767.1.53278 WP_003404767.1.533 WP_003404767.1.53302 WP_003404767.1.53306 WP_003404767.1.5334 WP_003404767.1.5335 WP_003404767.1.53353 WP_003404767.1.53381 WP_003404767.1.53413 WP_003404767.1.53458 WP_003404767.1.53460 WP_003404767.1.53480 WP_003404767.1.53517 WP_003404767.1.53522 WP_003404767.1.53525 WP_003404767.1.53526 WP_003404767.1.53553 WP_003404767.1.53606 WP_003404767.1.53609 WP_003404767.1.53643 WP_003404767.1.53667 WP_003404767.1.53679 WP_003404767.1.53730 WP_003404767.1.53742 WP_003404767.1.53743 WP_003404767.1.53754 WP_003404767.1.53775 WP_003404767.1.53787 WP_003404767.1.53803 WP_003404767.1.53818 WP_003404767.1.53853 WP_003404767.1.53865 WP_003404767.1.53888 WP_003404767.1.53900 WP_003404767.1.53912 WP_003404767.1.53914 WP_003404767.1.53952 WP_003404767.1.5398 WP_003404767.1.5408 WP_003404767.1.54089 WP_003404767.1.54093 WP_003404767.1.54099 WP_003404767.1.54112 WP_003404767.1.54125 WP_003404767.1.54141 WP_003404767.1.54162 WP_003404767.1.54179 WP_003404767.1.54206 WP_003404767.1.54218 WP_003404767.1.54225 WP_003404767.1.54227 WP_003404767.1.54232 WP_003404767.1.54241 WP_003404767.1.54245 WP_003404767.1.54247 WP_003404767.1.54260 WP_003404767.1.54275 WP_003404767.1.54280 WP_003404767.1.5429 WP_003404767.1.54294 WP_003404767.1.54314 WP_003404767.1.54347 WP_003404767.1.54351 WP_003404767.1.54370 WP_003404767.1.54428 WP_003404767.1.54449 WP_003404767.1.54494 WP_003404767.1.54502 WP_003404767.1.54514 WP_003404767.1.54519 WP_003404767.1.5452 WP_003404767.1.54531 WP_003404767.1.54537 WP_003404767.1.54553 WP_003404767.1.54555 WP_003404767.1.54575 WP_003404767.1.54633 WP_003404767.1.54686 WP_003404767.1.54687 WP_003404767.1.54705 WP_003404767.1.54730 WP_003404767.1.54732 WP_003404767.1.5475 WP_003404767.1.54797 WP_003404767.1.54807 WP_003404767.1.54836 WP_003404767.1.54838 WP_003404767.1.54860 WP_003404767.1.54888 WP_003404767.1.54897 WP_003404767.1.54905 WP_003404767.1.54909 WP_003404767.1.54937 WP_003404767.1.54939 WP_003404767.1.54944 WP_003404767.1.54945 WP_003404767.1.54953 WP_003404767.1.54964 WP_003404767.1.55015 WP_003404767.1.55022 WP_003404767.1.55023 WP_003404767.1.55051 WP_003404767.1.55072 WP_003404767.1.55088 WP_003404767.1.55106 WP_003404767.1.55126 WP_003404767.1.55128 WP_003404767.1.55140 WP_003404767.1.55150 WP_003404767.1.55210 WP_003404767.1.55227 WP_003404767.1.55248 WP_003404767.1.55257 WP_003404767.1.55258 WP_003404767.1.55267 WP_003404767.1.55307 WP_003404767.1.55326 WP_003404767.1.55328 WP_003404767.1.5533 WP_003404767.1.55345 WP_003404767.1.55396 WP_003404767.1.55398 WP_003404767.1.55441 WP_003404767.1.55459 WP_003404767.1.55501 WP_003404767.1.55504 WP_003404767.1.55578 WP_003404767.1.55626 WP_003404767.1.55641 WP_003404767.1.5569 WP_003404767.1.55723 WP_003404767.1.55735 WP_003404767.1.5574 WP_003404767.1.55772 WP_003404767.1.55802 WP_003404767.1.55819 WP_003404767.1.55821 WP_003404767.1.5583 WP_003404767.1.55849 WP_003404767.1.55856 WP_003404767.1.55860 WP_003404767.1.55882 WP_003404767.1.55883 WP_003404767.1.55894 WP_003404767.1.55902 WP_003404767.1.55908 WP_003404767.1.55909 WP_003404767.1.5591 WP_003404767.1.55961 WP_003404767.1.55977 WP_003404767.1.55983 WP_003404767.1.56028 WP_003404767.1.56057 WP_003404767.1.56060 WP_003404767.1.56107 WP_003404767.1.56132 WP_003404767.1.56163 WP_003404767.1.56167 WP_003404767.1.56178 WP_003404767.1.56287 WP_003404767.1.56292 WP_003404767.1.56327 WP_003404767.1.56341 WP_003404767.1.56359 WP_003404767.1.56365 WP_003404767.1.56394 WP_003404767.1.56443 WP_003404767.1.56473 WP_003404767.1.56478 WP_003404767.1.56500 WP_003404767.1.56517 WP_003404767.1.56534 WP_003404767.1.5656 WP_003404767.1.56577 WP_003404767.1.56593 WP_003404767.1.56625 WP_003404767.1.56637 WP_003404767.1.56670 WP_003404767.1.56697 WP_003404767.1.567 WP_003404767.1.56701 WP_003404767.1.56709 WP_003404767.1.56729 WP_003404767.1.56743 WP_003404767.1.56755 WP_003404767.1.56764 WP_003404767.1.56769 WP_003404767.1.56770 WP_003404767.1.56795 WP_003404767.1.5681 WP_003404767.1.56827 WP_003404767.1.56839 WP_003404767.1.56863 WP_003404767.1.56868 WP_003404767.1.56869 WP_003404767.1.56915 WP_003404767.1.56926 WP_003404767.1.56961 WP_003404767.1.56971 WP_003404767.1.56972 WP_003404767.1.57023 WP_003404767.1.57035 WP_003404767.1.57077 WP_003404767.1.57087 WP_003404767.1.57094 WP_003404767.1.57134 WP_003404767.1.57151 WP_003404767.1.57169 WP_003404767.1.57208 WP_003404767.1.57212 WP_003404767.1.57230 WP_003404767.1.5724 WP_003404767.1.5725 WP_003404767.1.5727 WP_003404767.1.57273 WP_003404767.1.573 WP_003404767.1.57314 WP_003404767.1.57326 WP_003404767.1.57328 WP_003404767.1.57331 WP_003404767.1.57340 WP_003404767.1.57351 WP_003404767.1.57352 WP_003404767.1.57380 WP_003404767.1.57430 WP_003404767.1.5744 WP_003404767.1.57440 WP_003404767.1.5745 WP_003404767.1.57461 WP_003404767.1.57469 WP_003404767.1.57489 WP_003404767.1.575 WP_003404767.1.57509 WP_003404767.1.57519 WP_003404767.1.57525 WP_003404767.1.57551 WP_003404767.1.57596 WP_003404767.1.57604 WP_003404767.1.57616 WP_003404767.1.57617 WP_003404767.1.57619 WP_003404767.1.57627 WP_003404767.1.57642 WP_003404767.1.57658 WP_003404767.1.57667 WP_003404767.1.57675 WP_003404767.1.57689 WP_003404767.1.57708 WP_003404767.1.57794 WP_003404767.1.57821 WP_003404767.1.57825 WP_003404767.1.57843 WP_003404767.1.57906 WP_003404767.1.57924 WP_003404767.1.57926 WP_003404767.1.57930 WP_003404767.1.57957 WP_003404767.1.57960 WP_003404767.1.57964 WP_003404767.1.57991 WP_003404767.1.58000 WP_003404767.1.58086 WP_003404767.1.58101 WP_003404767.1.58103 WP_003404767.1.58108 WP_003404767.1.5811 WP_003404767.1.58121 WP_003404767.1.58145 WP_003404767.1.58164 WP_003404767.1.58174 WP_003404767.1.582 WP_003404767.1.58202 WP_003404767.1.58209 WP_003404767.1.58215 WP_003404767.1.5824 WP_003404767.1.58250 WP_003404767.1.58259 WP_003404767.1.58288 WP_003404767.1.5830 WP_003404767.1.58303 WP_003404767.1.58311 WP_003404767.1.58330 WP_003404767.1.58359 WP_003404767.1.58386 WP_003404767.1.58393 WP_003404767.1.58431 WP_003404767.1.5844 WP_003404767.1.58457 WP_003404767.1.58488 WP_003404767.1.58518 WP_003404767.1.58534 WP_003404767.1.58559 WP_003404767.1.58567 WP_003404767.1.58573 WP_003404767.1.58602 WP_003404767.1.58612 WP_003404767.1.58619 WP_003404767.1.58630 WP_003404767.1.5865 WP_003404767.1.58671 WP_003404767.1.58690 WP_003404767.1.58702 WP_003404767.1.58743 WP_003404767.1.58754 WP_003404767.1.5879 WP_003404767.1.5881 WP_003404767.1.58824 WP_003404767.1.58848 WP_003404767.1.58857 WP_003404767.1.58891 WP_003404767.1.58892 WP_003404767.1.5890 WP_003404767.1.58904 WP_003404767.1.58921 WP_003404767.1.58930 WP_003404767.1.58939 WP_003404767.1.58941 WP_003404767.1.58953 WP_003404767.1.58961 WP_003404767.1.5898 WP_003404767.1.59025 WP_003404767.1.59029 WP_003404767.1.59037 WP_003404767.1.59044 WP_003404767.1.59085 WP_003404767.1.59088 WP_003404767.1.59130 WP_003404767.1.5914 WP_003404767.1.59147 WP_003404767.1.59166 WP_003404767.1.59205 WP_003404767.1.59209 WP_003404767.1.59237 WP_003404767.1.59240 WP_003404767.1.59253 WP_003404767.1.59254 WP_003404767.1.59262 WP_003404767.1.59270 WP_003404767.1.5928 WP_003404767.1.59304 WP_003404767.1.59305 WP_003404767.1.59309 WP_003404767.1.59316 WP_003404767.1.59326 WP_003404767.1.59328 WP_003404767.1.59333 WP_003404767.1.59388 WP_003404767.1.59428 WP_003404767.1.59487 WP_003404767.1.59537 WP_003404767.1.59561 WP_003404767.1.59677 WP_003404767.1.59722 WP_003404767.1.59727 WP_003404767.1.59732 WP_003404767.1.59738 WP_003404767.1.59750 WP_003404767.1.59757 WP_003404767.1.59761 WP_003404767.1.59808 WP_003404767.1.59850 WP_003404767.1.59856 WP_003404767.1.59860 WP_003404767.1.59861 WP_003404767.1.5987 WP_003404767.1.59878 WP_003404767.1.59888 WP_003404767.1.59952 WP_003404767.1.5996 WP_003404767.1.59961 WP_003404767.1.59974 WP_003404767.1.6000 WP_003404767.1.60007 WP_003404767.1.60016 WP_003404767.1.6003 WP_003404767.1.60047 WP_003404767.1.6007 WP_003404767.1.60091 WP_003404767.1.60121 WP_003404767.1.60125 WP_003404767.1.60135 WP_003404767.1.60139 WP_003404767.1.60152 WP_003404767.1.60171 WP_003404767.1.60197 WP_003404767.1.6020 WP_003404767.1.60205 WP_003404767.1.60207 WP_003404767.1.60215 WP_003404767.1.60217 WP_003404767.1.60267 WP_003404767.1.60288 WP_003404767.1.60291 WP_003404767.1.60301 WP_003404767.1.60305 WP_003404767.1.60312 WP_003404767.1.60313 WP_003404767.1.60314 WP_003404767.1.60367 WP_003404767.1.60376 WP_003404767.1.60403 WP_003404767.1.60413 WP_003404767.1.60421 WP_003404767.1.60451 WP_003404767.1.60460 WP_003404767.1.60479 WP_003404767.1.60487 WP_003404767.1.60512 WP_003404767.1.60573 WP_003404767.1.60583 WP_003404767.1.60632 WP_003404767.1.60657 WP_003404767.1.60687 WP_003404767.1.60689 WP_003404767.1.60727 WP_003404767.1.60738 WP_003404767.1.60763 WP_003404767.1.6077 WP_003404767.1.60791 WP_003404767.1.60834 WP_003404767.1.60870 WP_003404767.1.60878 WP_003404767.1.60879 WP_003404767.1.60913 WP_003404767.1.60978 WP_003404767.1.61000 WP_003404767.1.61001 WP_003404767.1.61014 WP_003404767.1.61015 WP_003404767.1.61037 WP_003404767.1.61052 WP_003404767.1.61065 WP_003404767.1.61100 WP_003404767.1.61101 WP_003404767.1.61138 WP_003404767.1.61142 WP_003404767.1.61198 WP_003404767.1.61234 WP_003404767.1.61256 WP_003404767.1.61281 WP_003404767.1.61314 WP_003404767.1.61321 WP_003404767.1.61326 WP_003404767.1.61328 WP_003404767.1.61368 WP_003404767.1.61391 WP_003404767.1.61406 WP_003404767.1.61420 WP_003404767.1.61422 WP_003404767.1.61425 WP_003404767.1.61428 WP_003404767.1.61469 WP_003404767.1.61494 WP_003404767.1.61522 WP_003404767.1.61552 WP_003404767.1.61557 WP_003404767.1.61567 WP_003404767.1.61571 WP_003404767.1.61573 WP_003404767.1.61584 WP_003404767.1.61586 WP_003404767.1.6159 WP_003404767.1.61592 WP_003404767.1.6160 WP_003404767.1.61614 WP_003404767.1.6163 WP_003404767.1.61655 WP_003404767.1.61665 WP_003404767.1.61669 WP_003404767.1.61682 WP_003404767.1.61692 WP_003404767.1.61719 WP_003404767.1.61728 WP_003404767.1.61750 WP_003404767.1.61754 WP_003404767.1.61755 WP_003404767.1.61757 WP_003404767.1.61778 WP_003404767.1.6179 WP_003404767.1.61793 WP_003404767.1.61816 WP_003404767.1.61842 WP_003404767.1.61850 WP_003404767.1.61862 WP_003404767.1.61865 WP_003404767.1.61868 WP_003404767.1.61911 WP_003404767.1.61925 WP_003404767.1.61941 WP_003404767.1.61953 WP_003404767.1.61986 WP_003404767.1.61987 WP_003404767.1.61998 WP_003404767.1.62021 WP_003404767.1.62087 WP_003404767.1.62089 WP_003404767.1.62101 WP_003404767.1.62104 WP_003404767.1.6211 WP_003404767.1.62132 WP_003404767.1.62162 WP_003404767.1.62225 WP_003404767.1.62230 WP_003404767.1.62238 WP_003404767.1.62249 WP_003404767.1.62270 WP_003404767.1.62281 WP_003404767.1.62307 WP_003404767.1.6231 WP_003404767.1.62359 WP_003404767.1.62360 WP_003404767.1.62371 WP_003404767.1.62379 WP_003404767.1.62395 WP_003404767.1.62408 WP_003404767.1.62449 WP_003404767.1.62468 WP_003404767.1.6248 WP_003404767.1.62508 WP_003404767.1.62565 WP_003404767.1.62594 WP_003404767.1.62606 WP_003404767.1.62616 WP_003404767.1.62666 WP_003404767.1.62687 WP_003404767.1.62715 WP_003404767.1.62730 WP_003404767.1.62738 WP_003404767.1.62761 WP_003404767.1.62766 WP_003404767.1.62786 WP_003404767.1.62813 WP_003404767.1.62839 WP_003404767.1.62841 WP_003404767.1.62909 WP_003404767.1.62936 WP_003404767.1.6294 WP_003404767.1.6295 WP_003404767.1.62962 WP_003404767.1.63007 WP_003404767.1.63019 WP_003404767.1.63032 WP_003404767.1.63037 WP_003404767.1.63064 WP_003404767.1.63066 WP_003404767.1.63072 WP_003404767.1.6308 WP_003404767.1.63081 WP_003404767.1.63096 WP_003404767.1.63106 WP_003404767.1.6314 WP_003404767.1.63144 WP_003404767.1.63154 WP_003404767.1.63160 WP_003404767.1.63161 WP_003404767.1.63175 WP_003404767.1.63194 WP_003404767.1.6322 WP_003404767.1.63222 WP_003404767.1.6328 WP_003404767.1.63291 WP_003404767.1.63312 WP_003404767.1.63317 WP_003404767.1.63331 WP_003404767.1.63373 WP_003404767.1.63384 WP_003404767.1.63403 WP_003404767.1.63424 WP_003404767.1.63428 WP_003404767.1.6345 WP_003404767.1.63464 WP_003404767.1.63483 WP_003404767.1.63502 WP_003404767.1.63504 WP_003404767.1.63522 WP_003404767.1.63530 WP_003404767.1.63538 WP_003404767.1.63564 WP_003404767.1.63567 WP_003404767.1.63596 WP_003404767.1.63600 WP_003404767.1.63623 WP_003404767.1.63624 WP_003404767.1.63625 WP_003404767.1.63627 WP_003404767.1.63654 WP_003404767.1.63662 WP_003404767.1.63711 WP_003404767.1.63734 WP_003404767.1.63807 WP_003404767.1.63819 WP_003404767.1.63844 WP_003404767.1.63888 WP_003404767.1.63913 WP_003404767.1.63915 WP_003404767.1.63918 WP_003404767.1.63961 WP_003404767.1.63970 WP_003404767.1.64000 WP_003404767.1.64027 WP_003404767.1.64058 WP_003404767.1.64065 WP_003404767.1.6407 WP_003404767.1.64082 WP_003404767.1.64091 WP_003404767.1.64102 WP_003404767.1.64104 WP_003404767.1.64119 WP_003404767.1.64169 WP_003404767.1.64219 WP_003404767.1.6422 WP_003404767.1.64222 WP_003404767.1.64228 WP_003404767.1.64235 WP_003404767.1.64249 WP_003404767.1.6427 WP_003404767.1.64278 WP_003404767.1.64287 WP_003404767.1.64414 WP_003404767.1.64419 WP_003404767.1.6443 WP_003404767.1.64463 WP_003404767.1.64480 WP_003404767.1.64497 WP_003404767.1.64506 WP_003404767.1.64511 WP_003404767.1.64513 WP_003404767.1.64514 WP_003404767.1.64515 WP_003404767.1.64522 WP_003404767.1.64526 WP_003404767.1.64543 WP_003404767.1.6456 WP_003404767.1.64567 WP_003404767.1.64588 WP_003404767.1.64589 WP_003404767.1.64594 WP_003404767.1.64595 WP_003404767.1.64608 WP_003404767.1.64619 WP_003404767.1.64629 WP_003404767.1.6464 WP_003404767.1.64664 WP_003404767.1.64669 WP_003404767.1.64672 WP_003404767.1.64680 WP_003404767.1.64682 WP_003404767.1.64727 WP_003404767.1.64729 WP_003404767.1.64774 WP_003404767.1.64776 WP_003404767.1.64802 WP_003404767.1.64832 WP_003404767.1.6486 WP_003404767.1.64870 WP_003404767.1.64898 WP_003404767.1.64922 WP_003404767.1.64924 WP_003404767.1.6493 WP_003404767.1.64937 WP_003404767.1.64941 WP_003404767.1.64966 WP_003404767.1.64973 WP_003404767.1.65001 WP_003404767.1.65026 WP_003404767.1.65053 WP_003404767.1.65070 WP_003404767.1.65079 WP_003404767.1.65102 WP_003404767.1.65157 WP_003404767.1.65181 WP_003404767.1.65212 WP_003404767.1.65229 WP_003404767.1.6523 WP_003404767.1.65253 WP_003404767.1.65289 WP_003404767.1.65291 WP_003404767.1.65315 WP_003404767.1.65329 WP_003404767.1.65359 WP_003404767.1.6536 WP_003404767.1.65374 WP_003404767.1.65386 WP_003404767.1.65414 WP_003404767.1.65416 WP_003404767.1.65433 WP_003404767.1.65455 WP_003404767.1.65467 WP_003404767.1.65488 WP_003404767.1.65529 WP_003404767.1.65539 WP_003404767.1.65583 WP_003404767.1.65612 WP_003404767.1.65623 WP_003404767.1.65635 WP_003404767.1.65637 WP_003404767.1.65648 WP_003404767.1.65683 WP_003404767.1.65686 WP_003404767.1.65688 WP_003404767.1.65707 WP_003404767.1.65733 WP_003404767.1.65746 WP_003404767.1.65747 WP_003404767.1.65759 WP_003404767.1.65816 WP_003404767.1.65830 WP_003404767.1.65858 WP_003404767.1.65862 WP_003404767.1.65869 WP_003404767.1.65893 WP_003404767.1.65929 WP_003404767.1.65932 WP_003404767.1.65958 WP_003404767.1.65974 WP_003404767.1.66004 WP_003404767.1.66013 WP_003404767.1.6606 WP_003404767.1.66089 WP_003404767.1.66149 WP_003404767.1.66151 WP_003404767.1.66229 WP_003404767.1.66276 WP_003404767.1.66293 WP_003404767.1.66297 WP_003404767.1.66323 WP_003404767.1.66325 WP_003404767.1.6633 WP_003404767.1.66334 WP_003404767.1.66355 WP_003404767.1.66367 WP_003404767.1.66394 WP_003404767.1.66396 WP_003404767.1.66451 WP_003404767.1.66455 WP_003404767.1.66457 WP_003404767.1.66460 WP_003404767.1.66464 WP_003404767.1.66466 WP_003404767.1.66487 WP_003404767.1.66504 WP_003404767.1.66544 WP_003404767.1.66558 WP_003404767.1.66580 WP_003404767.1.66582 WP_003404767.1.66612 WP_003404767.1.66615 WP_003404767.1.66617 WP_003404767.1.66635 WP_003404767.1.66656 WP_003404767.1.66663 WP_003404767.1.66675 WP_003404767.1.66715 WP_003404767.1.66718 WP_003404767.1.66762 WP_003404767.1.66776 WP_003404767.1.66808 WP_003404767.1.66817 WP_003404767.1.66819 WP_003404767.1.66826 WP_003404767.1.66830 WP_003404767.1.66842 WP_003404767.1.66868 WP_003404767.1.66878 WP_003404767.1.66880 WP_003404767.1.66893 WP_003404767.1.66961 WP_003404767.1.67005 WP_003404767.1.6704 WP_003404767.1.67044 WP_003404767.1.67061 WP_003404767.1.67098 WP_003404767.1.67146 WP_003404767.1.67170 WP_003404767.1.67197 WP_003404767.1.67198 WP_003404767.1.6720 WP_003404767.1.67207 WP_003404767.1.67218 WP_003404767.1.67220 WP_003404767.1.67225 WP_003404767.1.67231 WP_003404767.1.6724 WP_003404767.1.67257 WP_003404767.1.67298 WP_003404767.1.67307 WP_003404767.1.67324 WP_003404767.1.67332 WP_003404767.1.67346 WP_003404767.1.67354 WP_003404767.1.67360 WP_003404767.1.67381 WP_003404767.1.67396 WP_003404767.1.67417 WP_003404767.1.67422 WP_003404767.1.67453 WP_003404767.1.67459 WP_003404767.1.6746 WP_003404767.1.67473 WP_003404767.1.67481 WP_003404767.1.67482 WP_003404767.1.67496 WP_003404767.1.67499 WP_003404767.1.67516 WP_003404767.1.67523 WP_003404767.1.67536 WP_003404767.1.67575 WP_003404767.1.67587 WP_003404767.1.67598 WP_003404767.1.67600 WP_003404767.1.67602 WP_003404767.1.67630 WP_003404767.1.67679 WP_003404767.1.67692 WP_003404767.1.67744 WP_003404767.1.6775 WP_003404767.1.67750 WP_003404767.1.6777 WP_003404767.1.67809 WP_003404767.1.67816 WP_003404767.1.67844 WP_003404767.1.67848 WP_003404767.1.67870 WP_003404767.1.67888 WP_003404767.1.67915 WP_003404767.1.67945 WP_003404767.1.67949 WP_003404767.1.67980 WP_003404767.1.67982 WP_003404767.1.68022 WP_003404767.1.68029 WP_003404767.1.68037 WP_003404767.1.68038 WP_003404767.1.68045 WP_003404767.1.68057 WP_003404767.1.68083 WP_003404767.1.68088 WP_003404767.1.68106 WP_003404767.1.68110 WP_003404767.1.68153 WP_003404767.1.68169 WP_003404767.1.68193 WP_003404767.1.68212 WP_003404767.1.68227 WP_003404767.1.68243 WP_003404767.1.6825 WP_003404767.1.68297 WP_003404767.1.68309 WP_003404767.1.68325 WP_003404767.1.68329 WP_003404767.1.68340 WP_003404767.1.68384 WP_003404767.1.68388 WP_003404767.1.68429 WP_003404767.1.6843 WP_003404767.1.68433 WP_003404767.1.68444 WP_003404767.1.68465 WP_003404767.1.68484 WP_003404767.1.68518 WP_003404767.1.68569 WP_003404767.1.68576 WP_003404767.1.68580 WP_003404767.1.68586 WP_003404767.1.68623 WP_003404767.1.68637 WP_003404767.1.68646 WP_003404767.1.68667 WP_003404767.1.68669 WP_003404767.1.68672 WP_003404767.1.68684 WP_003404767.1.68704 WP_003404767.1.68708 WP_003404767.1.6872 WP_003404767.1.68730 WP_003404767.1.68734 WP_003404767.1.68748 WP_003404767.1.68754 WP_003404767.1.6876 WP_003404767.1.68761 WP_003404767.1.68763 WP_003404767.1.68766 WP_003404767.1.68774 WP_003404767.1.68796 WP_003404767.1.68824 WP_003404767.1.68832 WP_003404767.1.68833 WP_003404767.1.68841 WP_003404767.1.68859 WP_003404767.1.68876 WP_003404767.1.68906 WP_003404767.1.68916 WP_003404767.1.68923 WP_003404767.1.68945 WP_003404767.1.6896 WP_003404767.1.68981 WP_003404767.1.68984 WP_003404767.1.68997 WP_003404767.1.69008 WP_003404767.1.69076 WP_003404767.1.69079 WP_003404767.1.6908 WP_003404767.1.69082 WP_003404767.1.69178 WP_003404767.1.69181 WP_003404767.1.69208 WP_003404767.1.69231 WP_003404767.1.69256 WP_003404767.1.69311 WP_003404767.1.69315 WP_003404767.1.69322 WP_003404767.1.69342 WP_003404767.1.6935 WP_003404767.1.6936 WP_003404767.1.69369 WP_003404767.1.69374 WP_003404767.1.69398 WP_003404767.1.69401 WP_003404767.1.69426 WP_003404767.1.69427 WP_003404767.1.69429 WP_003404767.1.6949 WP_003404767.1.6951 WP_003404767.1.69511 WP_003404767.1.69526 WP_003404767.1.69528 WP_003404767.1.69547 WP_003404767.1.69573 WP_003404767.1.69581 WP_003404767.1.6960 WP_003404767.1.69617 WP_003404767.1.69634 WP_003404767.1.69647 WP_003404767.1.69659 WP_003404767.1.69673 WP_003404767.1.69682 WP_003404767.1.69684 WP_003404767.1.69686 WP_003404767.1.69707 WP_003404767.1.69709 WP_003404767.1.69736 WP_003404767.1.69778 WP_003404767.1.69800 WP_003404767.1.69802 WP_003404767.1.69845 WP_003404767.1.69870 WP_003404767.1.69873 WP_003404767.1.69898 WP_003404767.1.69913 WP_003404767.1.69931 WP_003404767.1.69938 WP_003404767.1.69955 WP_003404767.1.69957 WP_003404767.1.69981 WP_003404767.1.69990 WP_003404767.1.70 WP_003404767.1.70000 WP_003404767.1.70017 WP_003404767.1.70032 WP_003404767.1.70055 WP_003404767.1.70062 WP_003404767.1.70072 WP_003404767.1.70131 WP_003404767.1.70132 WP_003404767.1.7022 WP_003404767.1.70227 WP_003404767.1.70255 WP_003404767.1.70271 WP_003404767.1.70274 WP_003404767.1.7029 WP_003404767.1.70325 WP_003404767.1.70328 WP_003404767.1.70356 WP_003404767.1.70364 WP_003404767.1.70368 WP_003404767.1.70369 WP_003404767.1.70418 WP_003404767.1.70422 WP_003404767.1.70435 WP_003404767.1.70444 WP_003404767.1.70463 WP_003404767.1.70471 WP_003404767.1.70480 WP_003404767.1.70494 WP_003404767.1.70498 WP_003404767.1.70505 WP_003404767.1.70525 WP_003404767.1.70573 WP_003404767.1.70577 WP_003404767.1.70610 WP_003404767.1.70615 WP_003404767.1.70618 WP_003404767.1.70622 WP_003404767.1.70626 WP_003404767.1.70668 WP_003404767.1.70699 WP_003404767.1.70704 WP_003404767.1.70729 WP_003404767.1.70757 WP_003404767.1.70782 WP_003404767.1.70796 WP_003404767.1.70830 WP_003404767.1.70834 WP_003404767.1.7084 WP_003404767.1.70840 WP_003404767.1.70864 WP_003404767.1.70871 WP_003404767.1.70915 WP_003404767.1.70958 WP_003404767.1.70964 WP_003404767.1.70976 WP_003404767.1.71015 WP_003404767.1.71026 WP_003404767.1.71063 WP_003404767.1.71076 WP_003404767.1.71083 WP_003404767.1.7111 WP_003404767.1.71118 WP_003404767.1.71128 WP_003404767.1.7113 WP_003404767.1.71187 WP_003404767.1.71191 WP_003404767.1.71255 WP_003404767.1.71258 WP_003404767.1.71259 WP_003404767.1.71289 WP_003404767.1.71326 WP_003404767.1.71329 WP_003404767.1.71331 WP_003404767.1.71344 WP_003404767.1.71390 WP_003404767.1.71399 WP_003404767.1.71414 WP_003404767.1.71440 WP_003404767.1.71457 WP_003404767.1.7146 WP_003404767.1.71464 WP_003404767.1.71490 WP_003404767.1.71492 WP_003404767.1.71509 WP_003404767.1.71516 WP_003404767.1.71517 WP_003404767.1.71527 WP_003404767.1.71532 WP_003404767.1.71545 WP_003404767.1.71546 WP_003404767.1.71569 WP_003404767.1.71604 WP_003404767.1.71621 WP_003404767.1.71630 WP_003404767.1.71638 WP_003404767.1.71654 WP_003404767.1.71664 WP_003404767.1.71665 WP_003404767.1.71683 WP_003404767.1.71701 WP_003404767.1.71718 WP_003404767.1.71731 WP_003404767.1.71778 WP_003404767.1.71803 WP_003404767.1.71820 WP_003404767.1.71847 WP_003404767.1.7185 WP_003404767.1.71851 WP_003404767.1.71871 WP_003404767.1.71909 WP_003404767.1.71957 WP_003404767.1.71970 WP_003404767.1.72047 WP_003404767.1.72061 WP_003404767.1.72062 WP_003404767.1.72072 WP_003404767.1.72111 WP_003404767.1.72122 WP_003404767.1.72128 WP_003404767.1.72143 WP_003404767.1.7216 WP_003404767.1.72168 WP_003404767.1.72179 WP_003404767.1.72218 WP_003404767.1.72219 WP_003404767.1.72227 WP_003404767.1.7224 WP_003404767.1.72268 WP_003404767.1.72332 WP_003404767.1.72380 WP_003404767.1.72401 WP_003404767.1.72405 WP_003404767.1.72420 WP_003404767.1.72441 WP_003404767.1.72451 WP_003404767.1.72452 WP_003404767.1.72457 WP_003404767.1.72459 WP_003404767.1.72460 WP_003404767.1.72466 WP_003404767.1.72487 WP_003404767.1.72488 WP_003404767.1.72492 WP_003404767.1.72543 WP_003404767.1.7256 WP_003404767.1.72576 WP_003404767.1.72578 WP_003404767.1.72585 WP_003404767.1.72591 WP_003404767.1.72592 WP_003404767.1.72640 WP_003404767.1.7266 WP_003404767.1.72661 WP_003404767.1.72684 WP_003404767.1.72739 WP_003404767.1.72744 WP_003404767.1.72755 WP_003404767.1.72759 WP_003404767.1.72784 WP_003404767.1.72792 WP_003404767.1.72826 WP_003404767.1.72831 WP_003404767.1.72852 WP_003404767.1.72853 WP_003404767.1.72879 WP_003404767.1.72880 WP_003404767.1.72938 WP_003404767.1.72954 WP_003404767.1.72957 WP_003404767.1.72959 WP_003404767.1.7298 WP_003404767.1.72982 WP_003404767.1.72988 WP_003404767.1.72993 WP_003404767.1.73006 WP_003404767.1.73013 WP_003404767.1.73025 WP_003404767.1.73028 WP_003404767.1.73042 WP_003404767.1.73045 WP_003404767.1.73092 WP_003404767.1.73118 WP_003404767.1.7312 WP_003404767.1.73127 WP_003404767.1.73134 WP_003404767.1.73150 WP_003404767.1.73154 WP_003404767.1.73163 WP_003404767.1.73182 WP_003404767.1.73205 WP_003404767.1.7321 WP_003404767.1.73310 WP_003404767.1.73315 WP_003404767.1.73365 WP_003404767.1.73391 WP_003404767.1.73404 WP_003404767.1.73424 WP_003404767.1.73436 WP_003404767.1.73445 WP_003404767.1.73453 WP_003404767.1.73465 WP_003404767.1.73466 WP_003404767.1.73470 WP_003404767.1.73471 WP_003404767.1.73478 WP_003404767.1.73482 WP_003404767.1.73507 WP_003404767.1.73532 WP_003404767.1.73550 WP_003404767.1.73564 WP_003404767.1.73623 WP_003404767.1.73629 WP_003404767.1.73644 WP_003404767.1.7366 WP_003404767.1.73661 WP_003404767.1.7368 WP_003404767.1.73688 WP_003404767.1.73723 WP_003404767.1.73744 WP_003404767.1.73750 WP_003404767.1.73760 WP_003404767.1.73774 WP_003404767.1.7379 WP_003404767.1.73813 WP_003404767.1.73840 WP_003404767.1.73876 WP_003404767.1.7389 WP_003404767.1.74016 WP_003404767.1.74039 WP_003404767.1.74083 WP_003404767.1.74101 WP_003404767.1.74107 WP_003404767.1.74120 WP_003404767.1.74129 WP_003404767.1.74144 WP_003404767.1.7417 WP_003404767.1.74190 WP_003404767.1.74210 WP_003404767.1.7423 WP_003404767.1.74259 WP_003404767.1.74262 WP_003404767.1.74269 WP_003404767.1.74282 WP_003404767.1.74291 WP_003404767.1.74296 WP_003404767.1.74304 WP_003404767.1.7432 WP_003404767.1.74347 WP_003404767.1.7436 WP_003404767.1.74378 WP_003404767.1.74382 WP_003404767.1.74395 WP_003404767.1.74400 WP_003404767.1.74401 WP_003404767.1.74432 WP_003404767.1.74442 WP_003404767.1.74477 WP_003404767.1.74487 WP_003404767.1.74499 WP_003404767.1.74504 WP_003404767.1.74511 WP_003404767.1.74523 WP_003404767.1.74525 WP_003404767.1.74551 WP_003404767.1.74555 WP_003404767.1.74628 WP_003404767.1.74641 WP_003404767.1.74653 WP_003404767.1.74660 WP_003404767.1.74683 WP_003404767.1.7469 WP_003404767.1.74725 WP_003404767.1.74760 WP_003404767.1.74786 WP_003404767.1.74809 WP_003404767.1.74820 WP_003404767.1.74870 WP_003404767.1.74881 WP_003404767.1.74888 WP_003404767.1.74952 WP_003404767.1.7496 WP_003404767.1.74988 WP_003404767.1.75043 WP_003404767.1.75045 WP_003404767.1.75055 WP_003404767.1.75078 WP_003404767.1.75081 WP_003404767.1.75120 WP_003404767.1.75163 WP_003404767.1.75200 WP_003404767.1.75202 WP_003404767.1.75234 WP_003404767.1.75239 WP_003404767.1.75250 WP_003404767.1.75263 WP_003404767.1.75281 WP_003404767.1.75342 WP_003404767.1.7535 WP_003404767.1.75376 WP_003404767.1.75391 WP_003404767.1.75395 WP_003404767.1.75441 WP_003404767.1.75510 WP_003404767.1.75581 WP_003404767.1.75598 WP_003404767.1.75635 WP_003404767.1.75665 WP_003404767.1.75671 WP_003404767.1.75741 WP_003404767.1.75749 WP_003404767.1.75772 WP_003404767.1.75774 WP_003404767.1.75811 WP_003404767.1.75833 WP_003404767.1.7585 WP_003404767.1.75864 WP_003404767.1.75868 WP_003404767.1.75878 WP_003404767.1.75927 WP_003404767.1.75946 WP_003404767.1.75968 WP_003404767.1.75974 WP_003404767.1.76016 WP_003404767.1.76032 WP_003404767.1.76037 WP_003404767.1.7604 WP_003404767.1.76045 WP_003404767.1.76052 WP_003404767.1.76058 WP_003404767.1.76064 WP_003404767.1.76110 WP_003404767.1.76126 WP_003404767.1.76133 WP_003404767.1.76138 WP_003404767.1.76157 WP_003404767.1.76172 WP_003404767.1.76177 WP_003404767.1.76183 WP_003404767.1.76209 WP_003404767.1.76239 WP_003404767.1.76272 WP_003404767.1.76277 WP_003404767.1.76281 WP_003404767.1.76291 WP_003404767.1.76297 WP_003404767.1.76379 WP_003404767.1.76403 WP_003404767.1.76413 WP_003404767.1.76414 WP_003404767.1.76427 WP_003404767.1.76436 WP_003404767.1.76442 WP_003404767.1.76443 WP_003404767.1.76456 WP_003404767.1.76533 WP_003404767.1.76616 WP_003404767.1.76625 WP_003404767.1.76629 WP_003404767.1.76635 WP_003404767.1.76638 WP_003404767.1.76640 WP_003404767.1.76644 WP_003404767.1.76677 WP_003404767.1.76678 WP_003404767.1.76679 WP_003404767.1.76734 WP_003404767.1.76744 WP_003404767.1.76750 WP_003404767.1.76754 WP_003404767.1.76757 WP_003404767.1.76781 WP_003404767.1.76818 WP_003404767.1.76824 WP_003404767.1.76835 WP_003404767.1.76873 WP_003404767.1.76888 WP_003404767.1.76900 WP_003404767.1.7691 WP_003404767.1.76947 WP_003404767.1.76954 WP_003404767.1.76955 WP_003404767.1.76963 WP_003404767.1.76976 WP_003404767.1.770 WP_003404767.1.77000 WP_003404767.1.77008 WP_003404767.1.77021 WP_003404767.1.77056 WP_003404767.1.77065 WP_003404767.1.77075 WP_003404767.1.77093 WP_003404767.1.77107 WP_003404767.1.77115 WP_003404767.1.77118 WP_003404767.1.77125 WP_003404767.1.77141 WP_003404767.1.77142 WP_003404767.1.77166 WP_003404767.1.77250 WP_003404767.1.77252 WP_003404767.1.77260 WP_003404767.1.77266 WP_003404767.1.77280 WP_003404767.1.77285 WP_003404767.1.77312 WP_003404767.1.77348 WP_003404767.1.77351 WP_003404767.1.77352 WP_003404767.1.77361 WP_003404767.1.774 WP_003404767.1.7740 WP_003404767.1.77404 WP_003404767.1.77425 WP_003404767.1.77463 WP_003404767.1.77474 WP_003404767.1.7748 WP_003404767.1.77484 WP_003404767.1.77491 WP_003404767.1.77499 WP_003404767.1.77510 WP_003404767.1.77530 WP_003404767.1.77554 WP_003404767.1.77559 WP_003404767.1.77599 WP_003404767.1.77605 WP_003404767.1.7762 WP_003404767.1.77627 WP_003404767.1.77649 WP_003404767.1.77654 WP_003404767.1.7766 WP_003404767.1.77667 WP_003404767.1.77704 WP_003404767.1.77706 WP_003404767.1.77774 WP_003404767.1.7778 WP_003404767.1.77790 WP_003404767.1.77809 WP_003404767.1.77820 WP_003404767.1.77843 WP_003404767.1.77855 WP_003404767.1.77865 WP_003404767.1.77868 WP_003404767.1.77879 WP_003404767.1.77890 WP_003404767.1.77909 WP_003404767.1.77911 WP_003404767.1.77931 WP_003404767.1.77984 WP_003404767.1.78020 WP_003404767.1.78024 WP_003404767.1.78075 WP_003404767.1.78086 WP_003404767.1.7809 WP_003404767.1.78098 WP_003404767.1.78105 WP_003404767.1.78113 WP_003404767.1.78136 WP_003404767.1.78162 WP_003404767.1.7817 WP_003404767.1.78200 WP_003404767.1.78216 WP_003404767.1.78236 WP_003404767.1.78238 WP_003404767.1.78322 WP_003404767.1.78338 WP_003404767.1.7836 WP_003404767.1.78360 WP_003404767.1.78386 WP_003404767.1.78429 WP_003404767.1.78435 WP_003404767.1.7844 WP_003404767.1.78459 WP_003404767.1.78488 WP_003404767.1.7849 WP_003404767.1.78499 WP_003404767.1.785 WP_003404767.1.78516 WP_003404767.1.78524 WP_003404767.1.78526 WP_003404767.1.78538 WP_003404767.1.78544 WP_003404767.1.78545 WP_003404767.1.78547 WP_003404767.1.78574 WP_003404767.1.78580 WP_003404767.1.7860 WP_003404767.1.78620 WP_003404767.1.78646 WP_003404767.1.78648 WP_003404767.1.78649 WP_003404767.1.78655 WP_003404767.1.78657 WP_003404767.1.78659 WP_003404767.1.7869 WP_003404767.1.78692 WP_003404767.1.78760 WP_003404767.1.78766 WP_003404767.1.78776 WP_003404767.1.78778 WP_003404767.1.78784 WP_003404767.1.78788 WP_003404767.1.78790 WP_003404767.1.78793 WP_003404767.1.78848 WP_003404767.1.78860 WP_003404767.1.7887 WP_003404767.1.78884 WP_003404767.1.78932 WP_003404767.1.78969 WP_003404767.1.78977 WP_003404767.1.78980 WP_003404767.1.79005 WP_003404767.1.79016 WP_003404767.1.79033 WP_003404767.1.79064 WP_003404767.1.79066 WP_003404767.1.79068 WP_003404767.1.79077 WP_003404767.1.79095 WP_003404767.1.79112 WP_003404767.1.79122 WP_003404767.1.79145 WP_003404767.1.79152 WP_003404767.1.79163 WP_003404767.1.79182 WP_003404767.1.79198 WP_003404767.1.79213 WP_003404767.1.79218 WP_003404767.1.79268 WP_003404767.1.79273 WP_003404767.1.79278 WP_003404767.1.79290 WP_003404767.1.79319 WP_003404767.1.79325 WP_003404767.1.79326 WP_003404767.1.7933 WP_003404767.1.79330 WP_003404767.1.79339 WP_003404767.1.79394 WP_003404767.1.79399 WP_003404767.1.79413 WP_003404767.1.79422 WP_003404767.1.79445 WP_003404767.1.79447 WP_003404767.1.79455 WP_003404767.1.79471 WP_003404767.1.79480 WP_003404767.1.79482 WP_003404767.1.79488 WP_003404767.1.79500 WP_003404767.1.79502 WP_003404767.1.79508 WP_003404767.1.79514 WP_003404767.1.79561 WP_003404767.1.79565 WP_003404767.1.79578 WP_003404767.1.79588 WP_003404767.1.79598 WP_003404767.1.79615 WP_003404767.1.79684 WP_003404767.1.79698 WP_003404767.1.797 WP_003404767.1.79744 WP_003404767.1.79784 WP_003404767.1.79802 WP_003404767.1.79806 WP_003404767.1.79819 WP_003404767.1.79826 WP_003404767.1.79828 WP_003404767.1.79851 WP_003404767.1.79853 WP_003404767.1.79863 WP_003404767.1.79881 WP_003404767.1.79885 WP_003404767.1.79898 WP_003404767.1.7990 WP_003404767.1.79900 WP_003404767.1.79913 WP_003404767.1.79918 WP_003404767.1.79947 WP_003404767.1.79948 WP_003404767.1.7995 WP_003404767.1.7997 WP_003404767.1.80004 WP_003404767.1.80015 WP_003404767.1.80022 WP_003404767.1.80030 WP_003404767.1.80054 WP_003404767.1.80084 WP_003404767.1.80099 WP_003404767.1.80129 WP_003404767.1.80177 WP_003404767.1.80234 WP_003404767.1.8026 WP_003404767.1.80275 WP_003404767.1.8029 WP_003404767.1.80299 WP_003404767.1.80300 WP_003404767.1.80304 WP_003404767.1.80326 WP_003404767.1.80351 WP_003404767.1.8037 WP_003404767.1.80370 WP_003404767.1.80387 WP_003404767.1.80399 WP_003404767.1.8044 WP_003404767.1.80451 WP_003404767.1.80458 WP_003404767.1.80461 WP_003404767.1.80490 WP_003404767.1.80503 WP_003404767.1.80507 WP_003404767.1.80552 WP_003404767.1.80576 WP_003404767.1.80588 WP_003404767.1.80599 WP_003404767.1.8060 WP_003404767.1.80624 WP_003404767.1.80636 WP_003404767.1.80673 WP_003404767.1.80711 WP_003404767.1.80714 WP_003404767.1.80743 WP_003404767.1.80784 WP_003404767.1.80815 WP_003404767.1.80853 WP_003404767.1.80918 WP_003404767.1.8093 WP_003404767.1.80967 WP_003404767.1.8097 WP_003404767.1.80988 WP_003404767.1.81007 WP_003404767.1.81013 WP_003404767.1.8105 WP_003404767.1.81059 WP_003404767.1.81063 WP_003404767.1.81066 WP_003404767.1.81075 WP_003404767.1.81091 WP_003404767.1.81119 WP_003404767.1.81125 WP_003404767.1.81136 WP_003404767.1.8114 WP_003404767.1.81189 WP_003404767.1.81192 WP_003404767.1.812 WP_003404767.1.81230 WP_003404767.1.81249 WP_003404767.1.81250 WP_003404767.1.81287 WP_003404767.1.81297 WP_003404767.1.8138 WP_003404767.1.81407 WP_003404767.1.8143 WP_003404767.1.81439 WP_003404767.1.81465 WP_003404767.1.81529 WP_003404767.1.81538 WP_003404767.1.81541 WP_003404767.1.81560 WP_003404767.1.81561 WP_003404767.1.81567 WP_003404767.1.81583 WP_003404767.1.81686 WP_003404767.1.81712 WP_003404767.1.81720 WP_003404767.1.81731 WP_003404767.1.81774 WP_003404767.1.81788 WP_003404767.1.81809 WP_003404767.1.81820 WP_003404767.1.81850 WP_003404767.1.81883 WP_003404767.1.81891 WP_003404767.1.81918 WP_003404767.1.82011 WP_003404767.1.82048 WP_003404767.1.82069 WP_003404767.1.82071 WP_003404767.1.82108 WP_003404767.1.82136 WP_003404767.1.82142 WP_003404767.1.8215 WP_003404767.1.82158 WP_003404767.1.8217 WP_003404767.1.82209 WP_003404767.1.82210 WP_003404767.1.82228 WP_003404767.1.82236 WP_003404767.1.82251 WP_003404767.1.82271 WP_003404767.1.82305 WP_003404767.1.82307 WP_003404767.1.82309 WP_003404767.1.82317 WP_003404767.1.8232 WP_003404767.1.82346 WP_003404767.1.82374 WP_003404767.1.82385 WP_003404767.1.82429 WP_003404767.1.82460 WP_003404767.1.82462 WP_003404767.1.82483 WP_003404767.1.82494 WP_003404767.1.82531 WP_003404767.1.82546 WP_003404767.1.82547 WP_003404767.1.82549 WP_003404767.1.82577 WP_003404767.1.82592 WP_003404767.1.82597 WP_003404767.1.82598 WP_003404767.1.82625 WP_003404767.1.82642 WP_003404767.1.82651 WP_003404767.1.82653 WP_003404767.1.82681 WP_003404767.1.82685 WP_003404767.1.8271 WP_003404767.1.82712 WP_003404767.1.8273 WP_003404767.1.82743 WP_003404767.1.82757 WP_003404767.1.82774 WP_003404767.1.82803 WP_003404767.1.82836 WP_003404767.1.82860 WP_003404767.1.82871 WP_003404767.1.82892 WP_003404767.1.82935 WP_003404767.1.82957 WP_003404767.1.82981 WP_003404767.1.82983 WP_003404767.1.83004 WP_003404767.1.83009 WP_003404767.1.83044 WP_003404767.1.83074 WP_003404767.1.83146 WP_003404767.1.83149 WP_003404767.1.83159 WP_003404767.1.8317 WP_003404767.1.83173 WP_003404767.1.83181 WP_003404767.1.83182 WP_003404767.1.83191 WP_003404767.1.83197 WP_003404767.1.83212 WP_003404767.1.8326 WP_003404767.1.83262 WP_003404767.1.83268 WP_003404767.1.83273 WP_003404767.1.83309 WP_003404767.1.83332 WP_003404767.1.83334 WP_003404767.1.83341 WP_003404767.1.83349 WP_003404767.1.8335 WP_003404767.1.83353 WP_003404767.1.83367 WP_003404767.1.83380 WP_003404767.1.83381 WP_003404767.1.83389 WP_003404767.1.83408 WP_003404767.1.83409 WP_003404767.1.83435 WP_003404767.1.83470 WP_003404767.1.83524 WP_003404767.1.83526 WP_003404767.1.8358 WP_003404767.1.83589 WP_003404767.1.83601 WP_003404767.1.83611 WP_003404767.1.83638 WP_003404767.1.83648 WP_003404767.1.83656 WP_003404767.1.83667 WP_003404767.1.83689 WP_003404767.1.83692 WP_003404767.1.83704 WP_003404767.1.83705 WP_003404767.1.83766 WP_003404767.1.83793 WP_003404767.1.83794 WP_003404767.1.83802 WP_003404767.1.83805 WP_003404767.1.83839 WP_003404767.1.83842 WP_003404767.1.83850 WP_003404767.1.83861 WP_003404767.1.83884 WP_003404767.1.83920 WP_003404767.1.83929 WP_003404767.1.83930 WP_003404767.1.83975 WP_003404767.1.83991 WP_003404767.1.8400 WP_003404767.1.84027 WP_003404767.1.8404 WP_003404767.1.84057 WP_003404767.1.84070 WP_003404767.1.8409 WP_003404767.1.84112 WP_003404767.1.84146 WP_003404767.1.8415 WP_003404767.1.84176 WP_003404767.1.84186 WP_003404767.1.84192 WP_003404767.1.84228 WP_003404767.1.8424 WP_003404767.1.84244 WP_003404767.1.84259 WP_003404767.1.8426 WP_003404767.1.84277 WP_003404767.1.84287 WP_003404767.1.8434 WP_003404767.1.84388 WP_003404767.1.84408 WP_003404767.1.84409 WP_003404767.1.84438 WP_003404767.1.84460 WP_003404767.1.84488 WP_003404767.1.84504 WP_003404767.1.84525 WP_003404767.1.84620 WP_003404767.1.84623 WP_003404767.1.84641 WP_003404767.1.84655 WP_003404767.1.84666 WP_003404767.1.84670 WP_003404767.1.84739 WP_003404767.1.84748 WP_003404767.1.84766 WP_003404767.1.84772 WP_003404767.1.84774 WP_003404767.1.848 WP_003404767.1.84812 WP_003404767.1.84836 WP_003404767.1.84839 WP_003404767.1.84846 WP_003404767.1.84873 WP_003404767.1.84911 WP_003404767.1.84938 WP_003404767.1.84968 WP_003404767.1.84973 WP_003404767.1.84981 WP_003404767.1.84985 WP_003404767.1.8503 WP_003404767.1.85038 WP_003404767.1.85041 WP_003404767.1.85043 WP_003404767.1.8505 WP_003404767.1.85074 WP_003404767.1.8509 WP_003404767.1.8512 WP_003404767.1.85148 WP_003404767.1.8518 WP_003404767.1.8522 WP_003404767.1.85242 WP_003404767.1.85276 WP_003404767.1.85281 WP_003404767.1.85284 WP_003404767.1.85314 WP_003404767.1.85319 WP_003404767.1.85330 WP_003404767.1.85341 WP_003404767.1.85346 WP_003404767.1.8535 WP_003404767.1.85363 WP_003404767.1.85371 WP_003404767.1.85377 WP_003404767.1.85387 WP_003404767.1.85399 WP_003404767.1.85458 WP_003404767.1.8546 WP_003404767.1.85464 WP_003404767.1.85478 WP_003404767.1.85480 WP_003404767.1.85488 WP_003404767.1.85495 WP_003404767.1.85551 WP_003404767.1.85557 WP_003404767.1.85577 WP_003404767.1.85597 WP_003404767.1.85599 WP_003404767.1.85610 WP_003404767.1.8563 WP_003404767.1.85648 WP_003404767.1.85679 WP_003404767.1.85704 WP_003404767.1.85727 WP_003404767.1.85737 WP_003404767.1.85763 WP_003404767.1.85808 WP_003404767.1.85819 WP_003404767.1.85820 WP_003404767.1.85823 WP_003404767.1.85832 WP_003404767.1.8586 WP_003404767.1.85872 WP_003404767.1.85894 WP_003404767.1.85909 WP_003404767.1.85913 WP_003404767.1.85953 WP_003404767.1.85986 WP_003404767.1.86000 WP_003404767.1.86024 WP_003404767.1.86025 WP_003404767.1.86032 WP_003404767.1.86048 WP_003404767.1.86052 WP_003404767.1.86067 WP_003404767.1.86103 WP_003404767.1.86122 WP_003404767.1.86124 WP_003404767.1.86160 WP_003404767.1.86164 WP_003404767.1.86168 WP_003404767.1.86190 WP_003404767.1.86204 WP_003404767.1.86208 WP_003404767.1.86235 WP_003404767.1.86249 WP_003404767.1.86260 WP_003404767.1.86290 WP_003404767.1.863 WP_003404767.1.86327 WP_003404767.1.86334 WP_003404767.1.86337 WP_003404767.1.86368 WP_003404767.1.86377 WP_003404767.1.86425 WP_003404767.1.86459 WP_003404767.1.8649 WP_003404767.1.86499 WP_003404767.1.86520 WP_003404767.1.86561 WP_003404767.1.86568 WP_003404767.1.86575 WP_003404767.1.86584 WP_003404767.1.86605 WP_003404767.1.86626 WP_003404767.1.86648 WP_003404767.1.8666 WP_003404767.1.86684 WP_003404767.1.86696 WP_003404767.1.86705 WP_003404767.1.86718 WP_003404767.1.86725 WP_003404767.1.86757 WP_003404767.1.86766 WP_003404767.1.86801 WP_003404767.1.86814 WP_003404767.1.86820 WP_003404767.1.86825 WP_003404767.1.86834 WP_003404767.1.8685 WP_003404767.1.86851 WP_003404767.1.86855 WP_003404767.1.86867 WP_003404767.1.86877 WP_003404767.1.86883 WP_003404767.1.8689 WP_003404767.1.86892 WP_003404767.1.86933 WP_003404767.1.86941 WP_003404767.1.86950 WP_003404767.1.86962 WP_003404767.1.86963 WP_003404767.1.86979 WP_003404767.1.8700 WP_003404767.1.87002 WP_003404767.1.87031 WP_003404767.1.87116 WP_003404767.1.87117 WP_003404767.1.8714 WP_003404767.1.87162 WP_003404767.1.87178 WP_003404767.1.87191 WP_003404767.1.87201 WP_003404767.1.87209 WP_003404767.1.87240 WP_003404767.1.87266 WP_003404767.1.87273 WP_003404767.1.87275 WP_003404767.1.8733 WP_003404767.1.87345 WP_003404767.1.8737 WP_003404767.1.87401 WP_003404767.1.87404 WP_003404767.1.87406 WP_003404767.1.87409 WP_003404767.1.87444 WP_003404767.1.87446 WP_003404767.1.87459 WP_003404767.1.87472 WP_003404767.1.87489 WP_003404767.1.87494 WP_003404767.1.87496 WP_003404767.1.87582 WP_003404767.1.87588 WP_003404767.1.87617 WP_003404767.1.87619 WP_003404767.1.87620 WP_003404767.1.87634 WP_003404767.1.87643 WP_003404767.1.8765 WP_003404767.1.87650 WP_003404767.1.87654 WP_003404767.1.87658 WP_003404767.1.87665 WP_003404767.1.87676 WP_003404767.1.87677 WP_003404767.1.87684 WP_003404767.1.87692 WP_003404767.1.87707 WP_003404767.1.87732 WP_003404767.1.87784 WP_003404767.1.87796 WP_003404767.1.87809 WP_003404767.1.87817 WP_003404767.1.87827 WP_003404767.1.87831 WP_003404767.1.87835 WP_003404767.1.87837 WP_003404767.1.87866 WP_003404767.1.8789 WP_003404767.1.87911 WP_003404767.1.87924 WP_003404767.1.87951 WP_003404767.1.87955 WP_003404767.1.87956 WP_003404767.1.87991 WP_003404767.1.88 WP_003404767.1.88002 WP_003404767.1.88037 WP_003404767.1.88039 WP_003404767.1.88072 WP_003404767.1.88077 WP_003404767.1.88121 WP_003404767.1.88180 WP_003404767.1.88191 WP_003404767.1.88205 WP_003404767.1.88217 WP_003404767.1.88219 WP_003404767.1.88245 WP_003404767.1.88253 WP_003404767.1.88294 WP_003404767.1.88315 WP_003404767.1.88316 WP_003404767.1.88320 WP_003404767.1.88338 WP_003404767.1.8840 WP_003404767.1.88437 WP_003404767.1.88453 WP_003404767.1.88469 WP_003404767.1.88489 WP_003404767.1.88507 WP_003404767.1.88521 WP_003404767.1.88530 WP_003404767.1.88537 WP_003404767.1.88592 WP_003404767.1.88616 WP_003404767.1.88618 WP_003404767.1.8862 WP_003404767.1.88625 WP_003404767.1.88632 WP_003404767.1.88634 WP_003404767.1.88649 WP_003404767.1.8870 WP_003404767.1.88737 WP_003404767.1.88756 WP_003404767.1.888 WP_003404767.1.88824 WP_003404767.1.88886 WP_003404767.1.88965 WP_003404767.1.88985 WP_003404767.1.8902 WP_003404767.1.89025 WP_003404767.1.89041 WP_003404767.1.89046 WP_003404767.1.89082 WP_003404767.1.89162 WP_003404767.1.89168 WP_003404767.1.8917 WP_003404767.1.89193 WP_003404767.1.89205 WP_003404767.1.89207 WP_003404767.1.89225 WP_003404767.1.8925 WP_003404767.1.89277 WP_003404767.1.89286 WP_003404767.1.89293 WP_003404767.1.89320 WP_003404767.1.8935 WP_003404767.1.89371 WP_003404767.1.89378 WP_003404767.1.89392 WP_003404767.1.8943 WP_003404767.1.89451 WP_003404767.1.89453 WP_003404767.1.89473 WP_003404767.1.89475 WP_003404767.1.89483 WP_003404767.1.895 WP_003404767.1.89513 WP_003404767.1.89517 WP_003404767.1.89522 WP_003404767.1.8954 WP_003404767.1.89543 WP_003404767.1.8957 WP_003404767.1.89572 WP_003404767.1.89589 WP_003404767.1.89607 WP_003404767.1.89613 WP_003404767.1.89625 WP_003404767.1.89648 WP_003404767.1.8967 WP_003404767.1.89670 WP_003404767.1.89676 WP_003404767.1.89729 WP_003404767.1.89739 WP_003404767.1.89762 WP_003404767.1.8977 WP_003404767.1.89802 WP_003404767.1.89808 WP_003404767.1.8982 WP_003404767.1.89829 WP_003404767.1.89831 WP_003404767.1.89844 WP_003404767.1.89849 WP_003404767.1.8989 WP_003404767.1.89901 WP_003404767.1.89903 WP_003404767.1.89909 WP_003404767.1.8992 WP_003404767.1.89922 WP_003404767.1.89926 WP_003404767.1.89963 WP_003404767.1.89971 WP_003404767.1.8998 WP_003404767.1.89987 WP_003404767.1.900 WP_003404767.1.90048 WP_003404767.1.9007 WP_003404767.1.90080 WP_003404767.1.90130 WP_003404767.1.90134 WP_003404767.1.90137 WP_003404767.1.90157 WP_003404767.1.90184 WP_003404767.1.90199 WP_003404767.1.90231 WP_003404767.1.90245 WP_003404767.1.90308 WP_003404767.1.90322 WP_003404767.1.90328 WP_003404767.1.90372 WP_003404767.1.90439 WP_003404767.1.90481 WP_003404767.1.90499 WP_003404767.1.9050 WP_003404767.1.90527 WP_003404767.1.90550 WP_003404767.1.90560 WP_003404767.1.90612 WP_003404767.1.90640 WP_003404767.1.90672 WP_003404767.1.90687 WP_003404767.1.90691 WP_003404767.1.90711 WP_003404767.1.90722 WP_003404767.1.90744 WP_003404767.1.9075 WP_003404767.1.90756 WP_003404767.1.90767 WP_003404767.1.90771 WP_003404767.1.90785 WP_003404767.1.90788 WP_003404767.1.90800 WP_003404767.1.90816 WP_003404767.1.90819 WP_003404767.1.9082 WP_003404767.1.90831 WP_003404767.1.90884 WP_003404767.1.90899 WP_003404767.1.90906 WP_003404767.1.90958 WP_003404767.1.90976 WP_003404767.1.90977 WP_003404767.1.90987 WP_003404767.1.9102 WP_003404767.1.91026 WP_003404767.1.91032 WP_003404767.1.91043 WP_003404767.1.91053 WP_003404767.1.91082 WP_003404767.1.91106 WP_003404767.1.91112 WP_003404767.1.91144 WP_003404767.1.91151 WP_003404767.1.91157 WP_003404767.1.91167 WP_003404767.1.91169 WP_003404767.1.91192 WP_003404767.1.91201 WP_003404767.1.91207 WP_003404767.1.91208 WP_003404767.1.91211 WP_003404767.1.91214 WP_003404767.1.91230 WP_003404767.1.91244 WP_003404767.1.91251 WP_003404767.1.91260 WP_003404767.1.91265 WP_003404767.1.9128 WP_003404767.1.91284 WP_003404767.1.91294 WP_003404767.1.91303 WP_003404767.1.91322 WP_003404767.1.91352 WP_003404767.1.91386 WP_003404767.1.9139 WP_003404767.1.91398 WP_003404767.1.91411 WP_003404767.1.91430 WP_003404767.1.91436 WP_003404767.1.91496 WP_003404767.1.91507 WP_003404767.1.91508 WP_003404767.1.91576 WP_003404767.1.91589 WP_003404767.1.91694 WP_003404767.1.91695 WP_003404767.1.91713 WP_003404767.1.91716 WP_003404767.1.91717 WP_003404767.1.91728 WP_003404767.1.91743 WP_003404767.1.91759 WP_003404767.1.91784 WP_003404767.1.91785 WP_003404767.1.91786 WP_003404767.1.91802 WP_003404767.1.91822 WP_003404767.1.91828 WP_003404767.1.9189 WP_003404767.1.91896 WP_003404767.1.9190 WP_003404767.1.91915 WP_003404767.1.91931 WP_003404767.1.91937 WP_003404767.1.91944 WP_003404767.1.91957 WP_003404767.1.91976 WP_003404767.1.91978 WP_003404767.1.92083 WP_003404767.1.92127 WP_003404767.1.92144 WP_003404767.1.92150 WP_003404767.1.92153 WP_003404767.1.92190 WP_003404767.1.92192 WP_003404767.1.92200 WP_003404767.1.92220 WP_003404767.1.92221 WP_003404767.1.92222 WP_003404767.1.92273 WP_003404767.1.92289 WP_003404767.1.9229 WP_003404767.1.92294 WP_003404767.1.92300 WP_003404767.1.92317 WP_003404767.1.92334 WP_003404767.1.92338 WP_003404767.1.92345 WP_003404767.1.92356 WP_003404767.1.92364 WP_003404767.1.92380 WP_003404767.1.92416 WP_003404767.1.92428 WP_003404767.1.92447 WP_003404767.1.92456 WP_003404767.1.92467 WP_003404767.1.92471 WP_003404767.1.92490 WP_003404767.1.92508 WP_003404767.1.9251 WP_003404767.1.92511 WP_003404767.1.92523 WP_003404767.1.92527 WP_003404767.1.92592 WP_003404767.1.92603 WP_003404767.1.92606 WP_003404767.1.92610 WP_003404767.1.92613 WP_003404767.1.9263 WP_003404767.1.9265 WP_003404767.1.92650 WP_003404767.1.92660 WP_003404767.1.92677 WP_003404767.1.92685 WP_003404767.1.92689 WP_003404767.1.92690 WP_003404767.1.92706 WP_003404767.1.92714 WP_003404767.1.92736 WP_003404767.1.9274 WP_003404767.1.92752 WP_003404767.1.92760 WP_003404767.1.92777 WP_003404767.1.92803 WP_003404767.1.92833 WP_003404767.1.92856 WP_003404767.1.92881 WP_003404767.1.92892 WP_003404767.1.92907 WP_003404767.1.92908 WP_003404767.1.9291 WP_003404767.1.92917 WP_003404767.1.92996 WP_003404767.1.93006 WP_003404767.1.93008 WP_003404767.1.93009 WP_003404767.1.93015 WP_003404767.1.93043 WP_003404767.1.9307 WP_003404767.1.93083 WP_003404767.1.93097 WP_003404767.1.93137 WP_003404767.1.93192 WP_003404767.1.93199 WP_003404767.1.93203 WP_003404767.1.93212 WP_003404767.1.93234 WP_003404767.1.93245 WP_003404767.1.93257 WP_003404767.1.93265 WP_003404767.1.93297 WP_003404767.1.93320 WP_003404767.1.93328 WP_003404767.1.93337 WP_003404767.1.93343 WP_003404767.1.93349 WP_003404767.1.93363 WP_003404767.1.93377 WP_003404767.1.9338 WP_003404767.1.93407 WP_003404767.1.93417 WP_003404767.1.93419 WP_003404767.1.93426 WP_003404767.1.9344 WP_003404767.1.93443 WP_003404767.1.93447 WP_003404767.1.93470 WP_003404767.1.93483 WP_003404767.1.93487 WP_003404767.1.93495 WP_003404767.1.93499 WP_003404767.1.93516 WP_003404767.1.93536 WP_003404767.1.93544 WP_003404767.1.93555 WP_003404767.1.93560 WP_003404767.1.93564 WP_003404767.1.9357 WP_003404767.1.93573 WP_003404767.1.93576 WP_003404767.1.93588 WP_003404767.1.9363 WP_003404767.1.93645 WP_003404767.1.93649 WP_003404767.1.93659 WP_003404767.1.93677 WP_003404767.1.9368 WP_003404767.1.93689 WP_003404767.1.93693 WP_003404767.1.93698 WP_003404767.1.93706 WP_003404767.1.9371 WP_003404767.1.93792 WP_003404767.1.93823 WP_003404767.1.93871 WP_003404767.1.9388 WP_003404767.1.93894 WP_003404767.1.93903 WP_003404767.1.93907 WP_003404767.1.93913 WP_003404767.1.93946 WP_003404767.1.93950 WP_003404767.1.93953 WP_003404767.1.93954 WP_003404767.1.93988 WP_003404767.1.9407 WP_003404767.1.94143 WP_003404767.1.94154 WP_003404767.1.94184 WP_003404767.1.94204 WP_003404767.1.94205 WP_003404767.1.94226 WP_003404767.1.94231 WP_003404767.1.94256 WP_003404767.1.94281 WP_003404767.1.94292 WP_003404767.1.94297 WP_003404767.1.9431 WP_003404767.1.94326 WP_003404767.1.94339 WP_003404767.1.94392 WP_003404767.1.94416 WP_003404767.1.94421 WP_003404767.1.94456 WP_003404767.1.94470 WP_003404767.1.94480 WP_003404767.1.94495 WP_003404767.1.94511 WP_003404767.1.94512 WP_003404767.1.94525 WP_003404767.1.94528 WP_003404767.1.94564 WP_003404767.1.946 WP_003404767.1.94602 WP_003404767.1.94623 WP_003404767.1.94629 WP_003404767.1.9465 WP_003404767.1.94673 WP_003404767.1.94714 WP_003404767.1.94730 WP_003404767.1.94736 WP_003404767.1.94776 WP_003404767.1.9478 WP_003404767.1.94834 WP_003404767.1.94852 WP_003404767.1.94872 WP_003404767.1.9488 WP_003404767.1.94902 WP_003404767.1.94916 WP_003404767.1.94979 WP_003404767.1.94994 WP_003404767.1.94996 WP_003404767.1.94998 WP_003404767.1.95007 WP_003404767.1.95010 WP_003404767.1.95015 WP_003404767.1.95034 WP_003404767.1.95068 WP_003404767.1.95081 WP_003404767.1.95082 WP_003404767.1.9509 WP_003404767.1.95096 WP_003404767.1.95112 WP_003404767.1.95138 WP_003404767.1.9514 WP_003404767.1.95179 WP_003404767.1.95188 WP_003404767.1.95190 WP_003404767.1.95241 WP_003404767.1.95245 WP_003404767.1.95257 WP_003404767.1.95279 WP_003404767.1.9531 WP_003404767.1.95335 WP_003404767.1.95344 WP_003404767.1.9535 WP_003404767.1.95370 WP_003404767.1.95392 WP_003404767.1.95416 WP_003404767.1.95417 WP_003404767.1.95454 WP_003404767.1.95455 WP_003404767.1.95491 WP_003404767.1.95497 WP_003404767.1.95508 WP_003404767.1.95509 WP_003404767.1.95529 WP_003404767.1.95556 WP_003404767.1.95557 WP_003404767.1.95565 WP_003404767.1.95578 WP_003404767.1.95580 WP_003404767.1.95585 WP_003404767.1.95643 WP_003404767.1.95679 WP_003404767.1.95685 WP_003404767.1.957 WP_003404767.1.95724 WP_003404767.1.95727 WP_003404767.1.95730 WP_003404767.1.95735 WP_003404767.1.95758 WP_003404767.1.95772 WP_003404767.1.95797 WP_003404767.1.95839 WP_003404767.1.9585 WP_003404767.1.9590 WP_003404767.1.95902 WP_003404767.1.95908 WP_003404767.1.95924 WP_003404767.1.95926 WP_003404767.1.95953 WP_003404767.1.95958 WP_003404767.1.95964 WP_003404767.1.95973 WP_003404767.1.96006 WP_003404767.1.9602 WP_003404767.1.96036 WP_003404767.1.96062 WP_003404767.1.96065 WP_003404767.1.96098 WP_003404767.1.96146 WP_003404767.1.96171 WP_003404767.1.96182 WP_003404767.1.96204 WP_003404767.1.96230 WP_003404767.1.96235 WP_003404767.1.96242 WP_003404767.1.96245 WP_003404767.1.96254 WP_003404767.1.96259 WP_003404767.1.96286 WP_003404767.1.96313 WP_003404767.1.96318 WP_003404767.1.96345 WP_003404767.1.96360 WP_003404767.1.96373 WP_003404767.1.96456 WP_003404767.1.96486 WP_003404767.1.96569 WP_003404767.1.96573 WP_003404767.1.96576 WP_003404767.1.96611 WP_003404767.1.96621 WP_003404767.1.9667 WP_003404767.1.96681 WP_003404767.1.96726 WP_003404767.1.96733 WP_003404767.1.96742 WP_003404767.1.96754 WP_003404767.1.9678 WP_003404767.1.96832 WP_003404767.1.9685 WP_003404767.1.97008 WP_003404767.1.97009 WP_003404767.1.97056 WP_003404767.1.97084 WP_003404767.1.97087 WP_003404767.1.97094 WP_003404767.1.97096 WP_003404767.1.97099 WP_003404767.1.97108 WP_003404767.1.97113 WP_003404767.1.97122 WP_003404767.1.97129 WP_003404767.1.97136 WP_003404767.1.9716 WP_003404767.1.97176 WP_003404767.1.97222 WP_003404767.1.97223 WP_003404767.1.97237 WP_003404767.1.97242 WP_003404767.1.97270 WP_003404767.1.97283 WP_003404767.1.97296 WP_003404767.1.97325 WP_003404767.1.97330 WP_003404767.1.97366 WP_003404767.1.97376 WP_003404767.1.97380 WP_003404767.1.9739 WP_003404767.1.97462 WP_003404767.1.97517 WP_003404767.1.97519 WP_003404767.1.97535 WP_003404767.1.97540 WP_003404767.1.97545 WP_003404767.1.97546 WP_003404767.1.97550 WP_003404767.1.97568 WP_003404767.1.97577 WP_003404767.1.97584 WP_003404767.1.9759 WP_003404767.1.97591 WP_003404767.1.97596 WP_003404767.1.97609 WP_003404767.1.97618 WP_003404767.1.9763 WP_003404767.1.97669 WP_003404767.1.97673 WP_003404767.1.97700 WP_003404767.1.97701 WP_003404767.1.9773 WP_003404767.1.97730 WP_003404767.1.97740 WP_003404767.1.97751 WP_003404767.1.97754 WP_003404767.1.97797 WP_003404767.1.9782 WP_003404767.1.9784 WP_003404767.1.97888 WP_003404767.1.9790 WP_003404767.1.9795 WP_003404767.1.97951 WP_003404767.1.97958 WP_003404767.1.97966 WP_003404767.1.97977 WP_003404767.1.97979 WP_003404767.1.97995 WP_003404767.1.98018 WP_003404767.1.98034 WP_003404767.1.98052 WP_003404767.1.98071 WP_003404767.1.98072 WP_003404767.1.98113 WP_003404767.1.98114 WP_003404767.1.98128 WP_003404767.1.98181 WP_003404767.1.98188 WP_003404767.1.98189 WP_003404767.1.98213 WP_003404767.1.98225 WP_003404767.1.98291 WP_003404767.1.98335 WP_003404767.1.98350 WP_003404767.1.98395 WP_003404767.1.98412 WP_003404767.1.98441 WP_003404767.1.98443 WP_003404767.1.98462 WP_003404767.1.9848 WP_003404767.1.98482 WP_003404767.1.98486 WP_003404767.1.98488 WP_003404767.1.98503 WP_003404767.1.98516 WP_003404767.1.98536 WP_003404767.1.98541 WP_003404767.1.98566 WP_003404767.1.98576 WP_003404767.1.98590 WP_003404767.1.98594 WP_003404767.1.98599 WP_003404767.1.98629 WP_003404767.1.98645 WP_003404767.1.98646 WP_003404767.1.98649 WP_003404767.1.9867 WP_003404767.1.98674 WP_003404767.1.98697 WP_003404767.1.98701 WP_003404767.1.98739 WP_003404767.1.98749 WP_003404767.1.98765 WP_003404767.1.98770 WP_003404767.1.98777 WP_003404767.1.98778 WP_003404767.1.98802 WP_003404767.1.98838 WP_003404767.1.98850 WP_003404767.1.98906 WP_003404767.1.98935 WP_003404767.1.98948 WP_003404767.1.98953 WP_003404767.1.98984 WP_003404767.1.99000 WP_003404767.1.99023 WP_003404767.1.99030 WP_003404767.1.99037 WP_003404767.1.99055 WP_003404767.1.99062 WP_003404767.1.99086 WP_003404767.1.99115 WP_003404767.1.99117 WP_003404767.1.99161 WP_003404767.1.99176 WP_003404767.1.99205 WP_003404767.1.99211 WP_003404767.1.99216 WP_003404767.1.99222 WP_003404767.1.99251 WP_003404767.1.99269 WP_003404767.1.99294 WP_003404767.1.99312 WP_003404767.1.99315 WP_003404767.1.99316 WP_003404767.1.99322 WP_003404767.1.99328 WP_003404767.1.99365 WP_003404767.1.99368 WP_003404767.1.99379 WP_003404767.1.99396 WP_003404767.1.99402 WP_003404767.1.99404 WP_003404767.1.99419 WP_003404767.1.99438 WP_003404767.1.99460 WP_003404767.1.99468 WP_003404767.1.99473 WP_003404767.1.99513 WP_003404767.1.99529 WP_003404767.1.99548 WP_003404767.1.99572 WP_003404767.1.99578 WP_003404767.1.99605 WP_003404767.1.99609 WP_003404767.1.99617 WP_003404767.1.99635 WP_003404767.1.99650 WP_003404767.1.99672 WP_003404767.1.99701 WP_003404767.1.99711 WP_003404767.1.99716 WP_003404767.1.99740 WP_003404767.1.99745 WP_003404767.1.99749 WP_003404767.1.9976 WP_003404767.1.99798 WP_003404767.1.99817 WP_003404767.1.99847 WP_003404767.1.99852 WP_003404767.1.99886 WP_003404767.1.99897 WP_003404767.1.99899 WP_003404767.1.99915 WP_003404767.1.9993 WP_003404767.1.99991 NYSGXRC-11141n gi|339630989|ref|YP_004722631.1| gi|494695325|ref|YP_007960828.1| gi|378770683|ref|YP_005170416.1| gi|494699319|ref|YP_007964801.1| gi|340625935|ref|YP_004744387.1| gi|433626010|ref|YP_007259639.1| gi|525673709|ref|YP_008225027.1| gi|15608066|ref|NP_215441.1| gi|148660705|ref|YP_001282228.1| gi|506925360|ref|YP_008005810.1| gi|392433487|ref|YP_006474531.1| gi|197739671|ref|YP_002160985.1| gi|506925360|ref|YP_008005810.1| 233413.Mb0949c 336982.TBFG_10944 410289.BCG_0978c 419947.MRA_0934 478434.TBMG_03063 561275.JTY_0948 83331.MT0953 83332.Rv0926c

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]