SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I6X235 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I6X235
Domain Number 1 Region: 7-175
Classification Level Classification E-value
Superfamily Nudix 1.12e-77
Family MutT-like 0.000000291
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I6X235
Sequence length 207
Comment (tr|I6X235|I6X235_MYCTU) NUDIX hydrolase {ECO:0000313|EMBL:CCP44465.1} KW=Complete proteome; Reference proteome OX=83332 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv). GN=Rv1700 OC=Mycobacterium; Mycobacterium tuberculosis complex.
Sequence
MAEHDFETISSETLHTGAIFALRRDQVRMPGGGIVTREVVEHFGAVAIVAMDDNGNIPMV
YQYRHTYGRRLWELPAGLLDVAGEPPHLTAARELREEVGLQASTWQVLVDLDTAPGFSDE
SVRVYLATGLREVGRPEAHHEEADMTMGWYPIAEAARRVLRGEIVNSIAIAGVLAVHAVT
TGFAQPRPLDTEWIDRPTAFAARRAER
Download sequence
Identical sequences A0A045KHE5 A0A0D1Q0Y3 A0A0H3LDK8 A0A0H3M4J6 A0A0Y1CIL3 A0A109SN66 A0A120J138 A0A197IYE3 A0A1S1BE81 A5U358 F8M8T6 G0TK51 I6X235 L0T908 M8CN36 O33199
gi|392386372|ref|YP_005308001.1| gi|148822906|ref|YP_001287660.1| gi|392432720|ref|YP_006473764.1| 336982.TBFG_11715 410289.BCG_1738 419947.MRA_1709 478434.TBMG_02296 561275.JTY_1713 83331.MT1739 83332.Rv1700 gi|479314609|ref|YP_007854661.1| gi|449063760|ref|YP_007430843.1| gi|433626793|ref|YP_007260422.1| gi|224990082|ref|YP_002644769.1| gi|148661497|ref|YP_001283020.1| gi|385991094|ref|YP_005909392.1| gi|15608838|ref|NP_216216.1| gi|433641837|ref|YP_007287596.1| gi|494700107|ref|YP_007965589.1| gi|506926177|ref|YP_008006627.1| cath|current|1mk1A00/6-207 cath|current|1mp2A00/6-207 cath|current|1mqeA00/6-207 cath|current|1mqwA00/5-204 cath|current|1mr2A00/6-207 gi|197740356|ref|YP_002161670.1| gi|385998475|ref|YP_005916773.1| gi|339631754|ref|YP_004723396.1| NP_216216.1.84033 WP_003408399.1.100021 WP_003408399.1.100069 WP_003408399.1.100087 WP_003408399.1.10015 WP_003408399.1.100208 WP_003408399.1.100216 WP_003408399.1.10022 WP_003408399.1.100255 WP_003408399.1.100260 WP_003408399.1.100270 WP_003408399.1.100279 WP_003408399.1.100286 WP_003408399.1.100308 WP_003408399.1.100309 WP_003408399.1.100318 WP_003408399.1.100337 WP_003408399.1.100338 WP_003408399.1.100383 WP_003408399.1.100395 WP_003408399.1.100396 WP_003408399.1.1004 WP_003408399.1.100401 WP_003408399.1.100459 WP_003408399.1.100460 WP_003408399.1.100552 WP_003408399.1.100581 WP_003408399.1.100600 WP_003408399.1.100625 WP_003408399.1.100666 WP_003408399.1.100671 WP_003408399.1.100677 WP_003408399.1.100682 WP_003408399.1.100697 WP_003408399.1.100703 WP_003408399.1.100716 WP_003408399.1.100722 WP_003408399.1.100754 WP_003408399.1.100757 WP_003408399.1.100772 WP_003408399.1.1008 WP_003408399.1.100812 WP_003408399.1.100845 WP_003408399.1.100866 WP_003408399.1.10088 WP_003408399.1.100889 WP_003408399.1.10090 WP_003408399.1.100910 WP_003408399.1.100915 WP_003408399.1.100918 WP_003408399.1.100935 WP_003408399.1.100984 WP_003408399.1.100992 WP_003408399.1.100998 WP_003408399.1.101 WP_003408399.1.101025 WP_003408399.1.101028 WP_003408399.1.10104 WP_003408399.1.101048 WP_003408399.1.101054 WP_003408399.1.101075 WP_003408399.1.101143 WP_003408399.1.101146 WP_003408399.1.10116 WP_003408399.1.10117 WP_003408399.1.101209 WP_003408399.1.10125 WP_003408399.1.101290 WP_003408399.1.101323 WP_003408399.1.101324 WP_003408399.1.101350 WP_003408399.1.101367 WP_003408399.1.101398 WP_003408399.1.101403 WP_003408399.1.101421 WP_003408399.1.10144 WP_003408399.1.101442 WP_003408399.1.10145 WP_003408399.1.101452 WP_003408399.1.101456 WP_003408399.1.101481 WP_003408399.1.101493 WP_003408399.1.101496 WP_003408399.1.101525 WP_003408399.1.101533 WP_003408399.1.101535 WP_003408399.1.101553 WP_003408399.1.101558 WP_003408399.1.10156 WP_003408399.1.101573 WP_003408399.1.10159 WP_003408399.1.101592 WP_003408399.1.101604 WP_003408399.1.101607 WP_003408399.1.101622 WP_003408399.1.101644 WP_003408399.1.101671 WP_003408399.1.101687 WP_003408399.1.101698 WP_003408399.1.10170 WP_003408399.1.101713 WP_003408399.1.101722 WP_003408399.1.101733 WP_003408399.1.101743 WP_003408399.1.101754 WP_003408399.1.101764 WP_003408399.1.101795 WP_003408399.1.101797 WP_003408399.1.101798 WP_003408399.1.101802 WP_003408399.1.101826 WP_003408399.1.101858 WP_003408399.1.101859 WP_003408399.1.101862 WP_003408399.1.101888 WP_003408399.1.101894 WP_003408399.1.101899 WP_003408399.1.101923 WP_003408399.1.101925 WP_003408399.1.10193 WP_003408399.1.101996 WP_003408399.1.102 WP_003408399.1.102008 WP_003408399.1.102017 WP_003408399.1.102053 WP_003408399.1.102055 WP_003408399.1.102063 WP_003408399.1.102099 WP_003408399.1.1021 WP_003408399.1.10211 WP_003408399.1.102119 WP_003408399.1.102121 WP_003408399.1.102143 WP_003408399.1.10216 WP_003408399.1.10224 WP_003408399.1.10253 WP_003408399.1.10262 WP_003408399.1.10272 WP_003408399.1.10277 WP_003408399.1.1033 WP_003408399.1.10350 WP_003408399.1.10362 WP_003408399.1.10366 WP_003408399.1.10376 WP_003408399.1.10396 WP_003408399.1.10410 WP_003408399.1.10414 WP_003408399.1.10421 WP_003408399.1.10430 WP_003408399.1.1044 WP_003408399.1.10440 WP_003408399.1.10445 WP_003408399.1.10471 WP_003408399.1.10472 WP_003408399.1.10489 WP_003408399.1.105 WP_003408399.1.10518 WP_003408399.1.10545 WP_003408399.1.1057 WP_003408399.1.10594 WP_003408399.1.10603 WP_003408399.1.10606 WP_003408399.1.10615 WP_003408399.1.10623 WP_003408399.1.10635 WP_003408399.1.10643 WP_003408399.1.10648 WP_003408399.1.10662 WP_003408399.1.10709 WP_003408399.1.10735 WP_003408399.1.10740 WP_003408399.1.10756 WP_003408399.1.1078 WP_003408399.1.10791 WP_003408399.1.10799 WP_003408399.1.10825 WP_003408399.1.10848 WP_003408399.1.10863 WP_003408399.1.10879 WP_003408399.1.10912 WP_003408399.1.10916 WP_003408399.1.10923 WP_003408399.1.10927 WP_003408399.1.1095 WP_003408399.1.10956 WP_003408399.1.10958 WP_003408399.1.10962 WP_003408399.1.10980 WP_003408399.1.10981 WP_003408399.1.10993 WP_003408399.1.1100 WP_003408399.1.11040 WP_003408399.1.11061 WP_003408399.1.11070 WP_003408399.1.11141 WP_003408399.1.11171 WP_003408399.1.11175 WP_003408399.1.11176 WP_003408399.1.11222 WP_003408399.1.11236 WP_003408399.1.11329 WP_003408399.1.1133 WP_003408399.1.11342 WP_003408399.1.11373 WP_003408399.1.11376 WP_003408399.1.11390 WP_003408399.1.11402 WP_003408399.1.11481 WP_003408399.1.11487 WP_003408399.1.11489 WP_003408399.1.11491 WP_003408399.1.11514 WP_003408399.1.11587 WP_003408399.1.11589 WP_003408399.1.11596 WP_003408399.1.11604 WP_003408399.1.11610 WP_003408399.1.11697 WP_003408399.1.11707 WP_003408399.1.11752 WP_003408399.1.11758 WP_003408399.1.11761 WP_003408399.1.11775 WP_003408399.1.11804 WP_003408399.1.11822 WP_003408399.1.11826 WP_003408399.1.11856 WP_003408399.1.11898 WP_003408399.1.11906 WP_003408399.1.11939 WP_003408399.1.11960 WP_003408399.1.11961 WP_003408399.1.11972 WP_003408399.1.11984 WP_003408399.1.120 WP_003408399.1.12001 WP_003408399.1.12049 WP_003408399.1.12052 WP_003408399.1.12100 WP_003408399.1.12116 WP_003408399.1.12130 WP_003408399.1.12133 WP_003408399.1.12161 WP_003408399.1.12165 WP_003408399.1.12184 WP_003408399.1.12187 WP_003408399.1.12190 WP_003408399.1.12216 WP_003408399.1.12265 WP_003408399.1.12275 WP_003408399.1.12293 WP_003408399.1.12294 WP_003408399.1.123 WP_003408399.1.1231 WP_003408399.1.12314 WP_003408399.1.12327 WP_003408399.1.12338 WP_003408399.1.1236 WP_003408399.1.12371 WP_003408399.1.12372 WP_003408399.1.12389 WP_003408399.1.12406 WP_003408399.1.1241 WP_003408399.1.12421 WP_003408399.1.12424 WP_003408399.1.12446 WP_003408399.1.12464 WP_003408399.1.12479 WP_003408399.1.12519 WP_003408399.1.12523 WP_003408399.1.12526 WP_003408399.1.1255 WP_003408399.1.12550 WP_003408399.1.12551 WP_003408399.1.12611 WP_003408399.1.12669 WP_003408399.1.1267 WP_003408399.1.12672 WP_003408399.1.12692 WP_003408399.1.1271 WP_003408399.1.12768 WP_003408399.1.1279 WP_003408399.1.12794 WP_003408399.1.12801 WP_003408399.1.12804 WP_003408399.1.12821 WP_003408399.1.12854 WP_003408399.1.12871 WP_003408399.1.12901 WP_003408399.1.12941 WP_003408399.1.12947 WP_003408399.1.12957 WP_003408399.1.12972 WP_003408399.1.13028 WP_003408399.1.13043 WP_003408399.1.13086 WP_003408399.1.13087 WP_003408399.1.13090 WP_003408399.1.13096 WP_003408399.1.13163 WP_003408399.1.13175 WP_003408399.1.13183 WP_003408399.1.132 WP_003408399.1.13249 WP_003408399.1.13282 WP_003408399.1.13284 WP_003408399.1.13296 WP_003408399.1.13298 WP_003408399.1.13302 WP_003408399.1.13306 WP_003408399.1.13312 WP_003408399.1.13313 WP_003408399.1.13321 WP_003408399.1.13345 WP_003408399.1.13370 WP_003408399.1.1338 WP_003408399.1.13420 WP_003408399.1.13433 WP_003408399.1.13435 WP_003408399.1.13438 WP_003408399.1.13461 WP_003408399.1.13489 WP_003408399.1.13526 WP_003408399.1.13551 WP_003408399.1.13564 WP_003408399.1.13579 WP_003408399.1.13647 WP_003408399.1.13667 WP_003408399.1.13687 WP_003408399.1.13697 WP_003408399.1.13719 WP_003408399.1.13763 WP_003408399.1.1377 WP_003408399.1.13774 WP_003408399.1.13786 WP_003408399.1.13793 WP_003408399.1.13817 WP_003408399.1.13834 WP_003408399.1.13866 WP_003408399.1.13880 WP_003408399.1.13899 WP_003408399.1.13909 WP_003408399.1.13919 WP_003408399.1.13920 WP_003408399.1.13952 WP_003408399.1.13953 WP_003408399.1.13962 WP_003408399.1.1398 WP_003408399.1.13988 WP_003408399.1.14027 WP_003408399.1.14046 WP_003408399.1.14115 WP_003408399.1.1415 WP_003408399.1.14152 WP_003408399.1.14158 WP_003408399.1.14162 WP_003408399.1.14175 WP_003408399.1.14178 WP_003408399.1.14194 WP_003408399.1.14195 WP_003408399.1.14208 WP_003408399.1.14238 WP_003408399.1.14266 WP_003408399.1.14273 WP_003408399.1.14303 WP_003408399.1.14306 WP_003408399.1.14310 WP_003408399.1.14341 WP_003408399.1.14382 WP_003408399.1.14416 WP_003408399.1.14428 WP_003408399.1.14441 WP_003408399.1.14469 WP_003408399.1.14477 WP_003408399.1.14504 WP_003408399.1.14514 WP_003408399.1.1452 WP_003408399.1.14527 WP_003408399.1.1454 WP_003408399.1.14544 WP_003408399.1.14548 WP_003408399.1.14551 WP_003408399.1.14561 WP_003408399.1.14573 WP_003408399.1.1462 WP_003408399.1.14658 WP_003408399.1.14667 WP_003408399.1.14668 WP_003408399.1.14675 WP_003408399.1.14694 WP_003408399.1.14695 WP_003408399.1.14709 WP_003408399.1.14766 WP_003408399.1.14783 WP_003408399.1.14865 WP_003408399.1.14872 WP_003408399.1.14905 WP_003408399.1.14926 WP_003408399.1.14951 WP_003408399.1.14955 WP_003408399.1.15003 WP_003408399.1.15009 WP_003408399.1.15028 WP_003408399.1.15040 WP_003408399.1.15052 WP_003408399.1.15065 WP_003408399.1.15072 WP_003408399.1.15089 WP_003408399.1.1509 WP_003408399.1.15126 WP_003408399.1.15168 WP_003408399.1.15172 WP_003408399.1.15174 WP_003408399.1.15187 WP_003408399.1.15196 WP_003408399.1.15210 WP_003408399.1.15216 WP_003408399.1.15217 WP_003408399.1.1523 WP_003408399.1.15232 WP_003408399.1.15238 WP_003408399.1.15240 WP_003408399.1.15253 WP_003408399.1.15267 WP_003408399.1.1527 WP_003408399.1.15292 WP_003408399.1.15299 WP_003408399.1.15302 WP_003408399.1.15322 WP_003408399.1.1534 WP_003408399.1.15345 WP_003408399.1.15365 WP_003408399.1.15372 WP_003408399.1.15386 WP_003408399.1.15387 WP_003408399.1.15442 WP_003408399.1.15447 WP_003408399.1.15449 WP_003408399.1.15477 WP_003408399.1.15481 WP_003408399.1.15492 WP_003408399.1.15511 WP_003408399.1.15512 WP_003408399.1.15558 WP_003408399.1.15559 WP_003408399.1.15566 WP_003408399.1.15599 WP_003408399.1.1560 WP_003408399.1.15611 WP_003408399.1.1563 WP_003408399.1.15633 WP_003408399.1.15643 WP_003408399.1.15688 WP_003408399.1.15755 WP_003408399.1.15763 WP_003408399.1.15774 WP_003408399.1.1578 WP_003408399.1.15780 WP_003408399.1.15827 WP_003408399.1.15834 WP_003408399.1.15842 WP_003408399.1.15848 WP_003408399.1.15853 WP_003408399.1.15870 WP_003408399.1.15877 WP_003408399.1.15896 WP_003408399.1.15926 WP_003408399.1.15933 WP_003408399.1.15946 WP_003408399.1.15958 WP_003408399.1.15973 WP_003408399.1.15987 WP_003408399.1.15993 WP_003408399.1.16009 WP_003408399.1.16025 WP_003408399.1.16055 WP_003408399.1.16066 WP_003408399.1.16069 WP_003408399.1.16077 WP_003408399.1.16106 WP_003408399.1.16108 WP_003408399.1.16130 WP_003408399.1.16136 WP_003408399.1.16139 WP_003408399.1.16141 WP_003408399.1.16143 WP_003408399.1.1630 WP_003408399.1.1632 WP_003408399.1.16327 WP_003408399.1.16334 WP_003408399.1.16341 WP_003408399.1.16345 WP_003408399.1.16374 WP_003408399.1.16384 WP_003408399.1.16386 WP_003408399.1.164 WP_003408399.1.1642 WP_003408399.1.16421 WP_003408399.1.16424 WP_003408399.1.16426 WP_003408399.1.16431 WP_003408399.1.16438 WP_003408399.1.1644 WP_003408399.1.16442 WP_003408399.1.16448 WP_003408399.1.16451 WP_003408399.1.16476 WP_003408399.1.16480 WP_003408399.1.16494 WP_003408399.1.1652 WP_003408399.1.16549 WP_003408399.1.16560 WP_003408399.1.16598 WP_003408399.1.16609 WP_003408399.1.16619 WP_003408399.1.16620 WP_003408399.1.16622 WP_003408399.1.16637 WP_003408399.1.16707 WP_003408399.1.16724 WP_003408399.1.16731 WP_003408399.1.16743 WP_003408399.1.1683 WP_003408399.1.16837 WP_003408399.1.16852 WP_003408399.1.16937 WP_003408399.1.16940 WP_003408399.1.16950 WP_003408399.1.16959 WP_003408399.1.16968 WP_003408399.1.1697 WP_003408399.1.16973 WP_003408399.1.16977 WP_003408399.1.16987 WP_003408399.1.17005 WP_003408399.1.17006 WP_003408399.1.17015 WP_003408399.1.17019 WP_003408399.1.17039 WP_003408399.1.17041 WP_003408399.1.17052 WP_003408399.1.17057 WP_003408399.1.17062 WP_003408399.1.1707 WP_003408399.1.17094 WP_003408399.1.17138 WP_003408399.1.17147 WP_003408399.1.17167 WP_003408399.1.17224 WP_003408399.1.17251 WP_003408399.1.17288 WP_003408399.1.17314 WP_003408399.1.17345 WP_003408399.1.17381 WP_003408399.1.17391 WP_003408399.1.17412 WP_003408399.1.1743 WP_003408399.1.17440 WP_003408399.1.17466 WP_003408399.1.17477 WP_003408399.1.17483 WP_003408399.1.17505 WP_003408399.1.17527 WP_003408399.1.17535 WP_003408399.1.17540 WP_003408399.1.17553 WP_003408399.1.17558 WP_003408399.1.17599 WP_003408399.1.17635 WP_003408399.1.17655 WP_003408399.1.17679 WP_003408399.1.1768 WP_003408399.1.17687 WP_003408399.1.17700 WP_003408399.1.17710 WP_003408399.1.17713 WP_003408399.1.17722 WP_003408399.1.17746 WP_003408399.1.17788 WP_003408399.1.17798 WP_003408399.1.17803 WP_003408399.1.17816 WP_003408399.1.17821 WP_003408399.1.17830 WP_003408399.1.17878 WP_003408399.1.1792 WP_003408399.1.17923 WP_003408399.1.1795 WP_003408399.1.17955 WP_003408399.1.17973 WP_003408399.1.18013 WP_003408399.1.18033 WP_003408399.1.18057 WP_003408399.1.18065 WP_003408399.1.18070 WP_003408399.1.18120 WP_003408399.1.18126 WP_003408399.1.1817 WP_003408399.1.18206 WP_003408399.1.18216 WP_003408399.1.18240 WP_003408399.1.18257 WP_003408399.1.18297 WP_003408399.1.18306 WP_003408399.1.18364 WP_003408399.1.18399 WP_003408399.1.18411 WP_003408399.1.18444 WP_003408399.1.18448 WP_003408399.1.18467 WP_003408399.1.18476 WP_003408399.1.18522 WP_003408399.1.18580 WP_003408399.1.18582 WP_003408399.1.18587 WP_003408399.1.18601 WP_003408399.1.18639 WP_003408399.1.18647 WP_003408399.1.1868 WP_003408399.1.18694 WP_003408399.1.18710 WP_003408399.1.18751 WP_003408399.1.18781 WP_003408399.1.18793 WP_003408399.1.18804 WP_003408399.1.18816 WP_003408399.1.18823 WP_003408399.1.18827 WP_003408399.1.18838 WP_003408399.1.18849 WP_003408399.1.18856 WP_003408399.1.18945 WP_003408399.1.19005 WP_003408399.1.19056 WP_003408399.1.19063 WP_003408399.1.19066 WP_003408399.1.19085 WP_003408399.1.19094 WP_003408399.1.19144 WP_003408399.1.19159 WP_003408399.1.19193 WP_003408399.1.19231 WP_003408399.1.19243 WP_003408399.1.19264 WP_003408399.1.19295 WP_003408399.1.19307 WP_003408399.1.19326 WP_003408399.1.1933 WP_003408399.1.19364 WP_003408399.1.19382 WP_003408399.1.19400 WP_003408399.1.19426 WP_003408399.1.19429 WP_003408399.1.19480 WP_003408399.1.19512 WP_003408399.1.19553 WP_003408399.1.19562 WP_003408399.1.19564 WP_003408399.1.19568 WP_003408399.1.19572 WP_003408399.1.19595 WP_003408399.1.19596 WP_003408399.1.19600 WP_003408399.1.19630 WP_003408399.1.19694 WP_003408399.1.1970 WP_003408399.1.19707 WP_003408399.1.19742 WP_003408399.1.19785 WP_003408399.1.19820 WP_003408399.1.19868 WP_003408399.1.19874 WP_003408399.1.19890 WP_003408399.1.19900 WP_003408399.1.19922 WP_003408399.1.19936 WP_003408399.1.19946 WP_003408399.1.19949 WP_003408399.1.19960 WP_003408399.1.19964 WP_003408399.1.20007 WP_003408399.1.20016 WP_003408399.1.20028 WP_003408399.1.2003 WP_003408399.1.20037 WP_003408399.1.20039 WP_003408399.1.20082 WP_003408399.1.20085 WP_003408399.1.20097 WP_003408399.1.20116 WP_003408399.1.20130 WP_003408399.1.20140 WP_003408399.1.20141 WP_003408399.1.20142 WP_003408399.1.20158 WP_003408399.1.20239 WP_003408399.1.20243 WP_003408399.1.20259 WP_003408399.1.20262 WP_003408399.1.20268 WP_003408399.1.20272 WP_003408399.1.20273 WP_003408399.1.20280 WP_003408399.1.20294 WP_003408399.1.20300 WP_003408399.1.20309 WP_003408399.1.20322 WP_003408399.1.2037 WP_003408399.1.20372 WP_003408399.1.20381 WP_003408399.1.204 WP_003408399.1.20427 WP_003408399.1.20432 WP_003408399.1.20457 WP_003408399.1.20459 WP_003408399.1.20460 WP_003408399.1.20542 WP_003408399.1.20578 WP_003408399.1.20608 WP_003408399.1.20624 WP_003408399.1.20628 WP_003408399.1.2066 WP_003408399.1.20707 WP_003408399.1.20722 WP_003408399.1.20729 WP_003408399.1.20742 WP_003408399.1.20751 WP_003408399.1.20776 WP_003408399.1.20843 WP_003408399.1.20850 WP_003408399.1.2086 WP_003408399.1.20868 WP_003408399.1.20876 WP_003408399.1.20897 WP_003408399.1.20898 WP_003408399.1.2090 WP_003408399.1.20911 WP_003408399.1.20916 WP_003408399.1.20921 WP_003408399.1.20926 WP_003408399.1.20927 WP_003408399.1.20951 WP_003408399.1.20970 WP_003408399.1.2104 WP_003408399.1.21070 WP_003408399.1.21127 WP_003408399.1.21135 WP_003408399.1.21173 WP_003408399.1.21187 WP_003408399.1.212 WP_003408399.1.2120 WP_003408399.1.21219 WP_003408399.1.2123 WP_003408399.1.21231 WP_003408399.1.21234 WP_003408399.1.2126 WP_003408399.1.21292 WP_003408399.1.21307 WP_003408399.1.2131 WP_003408399.1.21311 WP_003408399.1.21321 WP_003408399.1.21365 WP_003408399.1.2137 WP_003408399.1.21392 WP_003408399.1.21397 WP_003408399.1.21403 WP_003408399.1.21415 WP_003408399.1.21418 WP_003408399.1.21430 WP_003408399.1.21434 WP_003408399.1.21444 WP_003408399.1.21468 WP_003408399.1.21498 WP_003408399.1.21509 WP_003408399.1.21513 WP_003408399.1.21560 WP_003408399.1.21565 WP_003408399.1.21586 WP_003408399.1.21591 WP_003408399.1.21594 WP_003408399.1.21602 WP_003408399.1.21615 WP_003408399.1.21638 WP_003408399.1.21639 WP_003408399.1.21655 WP_003408399.1.21658 WP_003408399.1.2168 WP_003408399.1.2174 WP_003408399.1.21741 WP_003408399.1.21777 WP_003408399.1.21786 WP_003408399.1.21795 WP_003408399.1.218 WP_003408399.1.21826 WP_003408399.1.21829 WP_003408399.1.21840 WP_003408399.1.21843 WP_003408399.1.21872 WP_003408399.1.2188 WP_003408399.1.21882 WP_003408399.1.21906 WP_003408399.1.21912 WP_003408399.1.2194 WP_003408399.1.21941 WP_003408399.1.21956 WP_003408399.1.21958 WP_003408399.1.21960 WP_003408399.1.21971 WP_003408399.1.21973 WP_003408399.1.21983 WP_003408399.1.22003 WP_003408399.1.22013 WP_003408399.1.22025 WP_003408399.1.22036 WP_003408399.1.22075 WP_003408399.1.22092 WP_003408399.1.2212 WP_003408399.1.22127 WP_003408399.1.22140 WP_003408399.1.22233 WP_003408399.1.22277 WP_003408399.1.22305 WP_003408399.1.22348 WP_003408399.1.22356 WP_003408399.1.22366 WP_003408399.1.2238 WP_003408399.1.22380 WP_003408399.1.22437 WP_003408399.1.22438 WP_003408399.1.22445 WP_003408399.1.22490 WP_003408399.1.22511 WP_003408399.1.22524 WP_003408399.1.2253 WP_003408399.1.22585 WP_003408399.1.22589 WP_003408399.1.22606 WP_003408399.1.22608 WP_003408399.1.22609 WP_003408399.1.22618 WP_003408399.1.2262 WP_003408399.1.22624 WP_003408399.1.22629 WP_003408399.1.22647 WP_003408399.1.22664 WP_003408399.1.22665 WP_003408399.1.22670 WP_003408399.1.22674 WP_003408399.1.22725 WP_003408399.1.22728 WP_003408399.1.22733 WP_003408399.1.22737 WP_003408399.1.2275 WP_003408399.1.22754 WP_003408399.1.22797 WP_003408399.1.22800 WP_003408399.1.22804 WP_003408399.1.22829 WP_003408399.1.22844 WP_003408399.1.22963 WP_003408399.1.22970 WP_003408399.1.22996 WP_003408399.1.22997 WP_003408399.1.22999 WP_003408399.1.23015 WP_003408399.1.23032 WP_003408399.1.231 WP_003408399.1.23101 WP_003408399.1.2312 WP_003408399.1.23140 WP_003408399.1.23153 WP_003408399.1.23171 WP_003408399.1.23199 WP_003408399.1.2320 WP_003408399.1.23204 WP_003408399.1.23216 WP_003408399.1.23229 WP_003408399.1.23233 WP_003408399.1.2326 WP_003408399.1.23261 WP_003408399.1.23272 WP_003408399.1.23289 WP_003408399.1.2329 WP_003408399.1.23308 WP_003408399.1.23316 WP_003408399.1.23321 WP_003408399.1.23325 WP_003408399.1.2339 WP_003408399.1.23406 WP_003408399.1.23438 WP_003408399.1.23445 WP_003408399.1.23447 WP_003408399.1.23452 WP_003408399.1.23461 WP_003408399.1.2349 WP_003408399.1.23496 WP_003408399.1.23506 WP_003408399.1.23530 WP_003408399.1.23539 WP_003408399.1.23546 WP_003408399.1.23551 WP_003408399.1.23573 WP_003408399.1.23583 WP_003408399.1.23628 WP_003408399.1.23677 WP_003408399.1.23683 WP_003408399.1.23692 WP_003408399.1.23694 WP_003408399.1.23699 WP_003408399.1.2371 WP_003408399.1.23803 WP_003408399.1.23807 WP_003408399.1.23825 WP_003408399.1.23832 WP_003408399.1.2384 WP_003408399.1.23843 WP_003408399.1.23863 WP_003408399.1.2387 WP_003408399.1.23894 WP_003408399.1.23993 WP_003408399.1.2400 WP_003408399.1.24007 WP_003408399.1.24008 WP_003408399.1.24046 WP_003408399.1.24057 WP_003408399.1.24062 WP_003408399.1.24113 WP_003408399.1.24119 WP_003408399.1.24128 WP_003408399.1.24140 WP_003408399.1.24176 WP_003408399.1.24190 WP_003408399.1.24202 WP_003408399.1.24244 WP_003408399.1.24261 WP_003408399.1.24284 WP_003408399.1.24294 WP_003408399.1.24357 WP_003408399.1.24396 WP_003408399.1.24414 WP_003408399.1.24423 WP_003408399.1.2443 WP_003408399.1.24446 WP_003408399.1.24461 WP_003408399.1.24500 WP_003408399.1.24507 WP_003408399.1.24509 WP_003408399.1.24529 WP_003408399.1.24553 WP_003408399.1.24599 WP_003408399.1.24629 WP_003408399.1.24638 WP_003408399.1.2466 WP_003408399.1.24767 WP_003408399.1.24824 WP_003408399.1.24831 WP_003408399.1.24840 WP_003408399.1.24848 WP_003408399.1.24857 WP_003408399.1.2487 WP_003408399.1.24893 WP_003408399.1.24907 WP_003408399.1.24933 WP_003408399.1.24956 WP_003408399.1.24958 WP_003408399.1.24985 WP_003408399.1.2499 WP_003408399.1.2505 WP_003408399.1.25051 WP_003408399.1.2507 WP_003408399.1.25103 WP_003408399.1.25129 WP_003408399.1.25171 WP_003408399.1.25184 WP_003408399.1.25247 WP_003408399.1.25252 WP_003408399.1.25278 WP_003408399.1.25283 WP_003408399.1.25309 WP_003408399.1.25313 WP_003408399.1.25338 WP_003408399.1.25342 WP_003408399.1.25343 WP_003408399.1.25367 WP_003408399.1.25393 WP_003408399.1.25406 WP_003408399.1.25435 WP_003408399.1.25437 WP_003408399.1.25445 WP_003408399.1.25455 WP_003408399.1.25473 WP_003408399.1.25504 WP_003408399.1.25513 WP_003408399.1.25542 WP_003408399.1.25579 WP_003408399.1.25594 WP_003408399.1.25606 WP_003408399.1.25645 WP_003408399.1.2566 WP_003408399.1.25673 WP_003408399.1.25674 WP_003408399.1.25699 WP_003408399.1.25736 WP_003408399.1.25738 WP_003408399.1.25756 WP_003408399.1.25759 WP_003408399.1.25813 WP_003408399.1.25853 WP_003408399.1.25854 WP_003408399.1.25874 WP_003408399.1.25885 WP_003408399.1.25892 WP_003408399.1.25906 WP_003408399.1.25914 WP_003408399.1.25916 WP_003408399.1.2594 WP_003408399.1.25965 WP_003408399.1.25972 WP_003408399.1.26017 WP_003408399.1.26032 WP_003408399.1.26038 WP_003408399.1.26072 WP_003408399.1.26089 WP_003408399.1.26098 WP_003408399.1.26118 WP_003408399.1.26126 WP_003408399.1.26168 WP_003408399.1.26182 WP_003408399.1.26190 WP_003408399.1.2620 WP_003408399.1.26234 WP_003408399.1.26243 WP_003408399.1.26265 WP_003408399.1.26267 WP_003408399.1.26292 WP_003408399.1.26310 WP_003408399.1.26328 WP_003408399.1.26349 WP_003408399.1.26366 WP_003408399.1.26374 WP_003408399.1.26407 WP_003408399.1.26412 WP_003408399.1.26454 WP_003408399.1.26464 WP_003408399.1.2653 WP_003408399.1.26571 WP_003408399.1.2659 WP_003408399.1.26597 WP_003408399.1.26603 WP_003408399.1.26629 WP_003408399.1.26651 WP_003408399.1.26702 WP_003408399.1.26707 WP_003408399.1.26710 WP_003408399.1.26719 WP_003408399.1.26737 WP_003408399.1.26738 WP_003408399.1.26745 WP_003408399.1.26756 WP_003408399.1.2676 WP_003408399.1.2677 WP_003408399.1.26779 WP_003408399.1.26780 WP_003408399.1.26798 WP_003408399.1.26854 WP_003408399.1.26868 WP_003408399.1.26876 WP_003408399.1.26888 WP_003408399.1.26945 WP_003408399.1.26959 WP_003408399.1.26969 WP_003408399.1.26984 WP_003408399.1.26992 WP_003408399.1.27017 WP_003408399.1.27045 WP_003408399.1.27074 WP_003408399.1.27075 WP_003408399.1.27128 WP_003408399.1.27130 WP_003408399.1.27139 WP_003408399.1.27152 WP_003408399.1.27162 WP_003408399.1.27193 WP_003408399.1.27235 WP_003408399.1.27254 WP_003408399.1.27278 WP_003408399.1.27343 WP_003408399.1.27352 WP_003408399.1.27369 WP_003408399.1.27391 WP_003408399.1.27398 WP_003408399.1.27402 WP_003408399.1.27410 WP_003408399.1.27411 WP_003408399.1.27449 WP_003408399.1.27460 WP_003408399.1.27463 WP_003408399.1.2749 WP_003408399.1.27492 WP_003408399.1.27528 WP_003408399.1.27541 WP_003408399.1.27576 WP_003408399.1.27582 WP_003408399.1.27596 WP_003408399.1.27607 WP_003408399.1.277 WP_003408399.1.27724 WP_003408399.1.27730 WP_003408399.1.27736 WP_003408399.1.27743 WP_003408399.1.27750 WP_003408399.1.27771 WP_003408399.1.27779 WP_003408399.1.27795 WP_003408399.1.27803 WP_003408399.1.27819 WP_003408399.1.27835 WP_003408399.1.27915 WP_003408399.1.27935 WP_003408399.1.27962 WP_003408399.1.28053 WP_003408399.1.28092 WP_003408399.1.28106 WP_003408399.1.28131 WP_003408399.1.28142 WP_003408399.1.28159 WP_003408399.1.2816 WP_003408399.1.28161 WP_003408399.1.28192 WP_003408399.1.28202 WP_003408399.1.28241 WP_003408399.1.28242 WP_003408399.1.28251 WP_003408399.1.28255 WP_003408399.1.28269 WP_003408399.1.28293 WP_003408399.1.28331 WP_003408399.1.28367 WP_003408399.1.28391 WP_003408399.1.2842 WP_003408399.1.28448 WP_003408399.1.28471 WP_003408399.1.28473 WP_003408399.1.28493 WP_003408399.1.28497 WP_003408399.1.28530 WP_003408399.1.28545 WP_003408399.1.28561 WP_003408399.1.28567 WP_003408399.1.28585 WP_003408399.1.286 WP_003408399.1.28610 WP_003408399.1.28617 WP_003408399.1.28634 WP_003408399.1.28642 WP_003408399.1.28671 WP_003408399.1.28682 WP_003408399.1.28698 WP_003408399.1.28703 WP_003408399.1.28739 WP_003408399.1.28758 WP_003408399.1.28781 WP_003408399.1.28787 WP_003408399.1.28827 WP_003408399.1.28839 WP_003408399.1.28847 WP_003408399.1.28850 WP_003408399.1.28851 WP_003408399.1.28897 WP_003408399.1.28914 WP_003408399.1.28935 WP_003408399.1.28939 WP_003408399.1.28943 WP_003408399.1.28952 WP_003408399.1.28975 WP_003408399.1.28993 WP_003408399.1.2901 WP_003408399.1.29028 WP_003408399.1.29033 WP_003408399.1.29058 WP_003408399.1.29078 WP_003408399.1.29102 WP_003408399.1.29115 WP_003408399.1.2916 WP_003408399.1.29217 WP_003408399.1.29223 WP_003408399.1.29234 WP_003408399.1.29264 WP_003408399.1.29275 WP_003408399.1.29306 WP_003408399.1.29339 WP_003408399.1.29348 WP_003408399.1.29364 WP_003408399.1.29367 WP_003408399.1.29399 WP_003408399.1.29426 WP_003408399.1.2944 WP_003408399.1.29449 WP_003408399.1.29450 WP_003408399.1.29452 WP_003408399.1.2949 WP_003408399.1.29510 WP_003408399.1.29515 WP_003408399.1.29525 WP_003408399.1.2953 WP_003408399.1.29559 WP_003408399.1.29587 WP_003408399.1.2959 WP_003408399.1.29592 WP_003408399.1.29599 WP_003408399.1.29611 WP_003408399.1.29632 WP_003408399.1.29649 WP_003408399.1.2965 WP_003408399.1.29659 WP_003408399.1.2969 WP_003408399.1.29698 WP_003408399.1.29718 WP_003408399.1.29742 WP_003408399.1.29745 WP_003408399.1.29747 WP_003408399.1.29769 WP_003408399.1.29825 WP_003408399.1.29830 WP_003408399.1.29847 WP_003408399.1.29861 WP_003408399.1.29869 WP_003408399.1.29883 WP_003408399.1.29890 WP_003408399.1.299 WP_003408399.1.29931 WP_003408399.1.29960 WP_003408399.1.30014 WP_003408399.1.3004 WP_003408399.1.30040 WP_003408399.1.30074 WP_003408399.1.30097 WP_003408399.1.30101 WP_003408399.1.30106 WP_003408399.1.30114 WP_003408399.1.30126 WP_003408399.1.30131 WP_003408399.1.30138 WP_003408399.1.30139 WP_003408399.1.30145 WP_003408399.1.30211 WP_003408399.1.30224 WP_003408399.1.30235 WP_003408399.1.30237 WP_003408399.1.3027 WP_003408399.1.30279 WP_003408399.1.30282 WP_003408399.1.30283 WP_003408399.1.30291 WP_003408399.1.30363 WP_003408399.1.30374 WP_003408399.1.30404 WP_003408399.1.3043 WP_003408399.1.30433 WP_003408399.1.30438 WP_003408399.1.30462 WP_003408399.1.30464 WP_003408399.1.30468 WP_003408399.1.30500 WP_003408399.1.3057 WP_003408399.1.30574 WP_003408399.1.30628 WP_003408399.1.30642 WP_003408399.1.30661 WP_003408399.1.30669 WP_003408399.1.30683 WP_003408399.1.30699 WP_003408399.1.30709 WP_003408399.1.30713 WP_003408399.1.30716 WP_003408399.1.30719 WP_003408399.1.30730 WP_003408399.1.30732 WP_003408399.1.30736 WP_003408399.1.30745 WP_003408399.1.30760 WP_003408399.1.30791 WP_003408399.1.308 WP_003408399.1.30807 WP_003408399.1.30818 WP_003408399.1.30824 WP_003408399.1.30877 WP_003408399.1.30888 WP_003408399.1.30901 WP_003408399.1.30912 WP_003408399.1.30913 WP_003408399.1.30914 WP_003408399.1.30919 WP_003408399.1.30977 WP_003408399.1.3100 WP_003408399.1.31002 WP_003408399.1.3101 WP_003408399.1.31034 WP_003408399.1.31047 WP_003408399.1.31070 WP_003408399.1.31074 WP_003408399.1.31102 WP_003408399.1.31184 WP_003408399.1.31199 WP_003408399.1.31226 WP_003408399.1.31230 WP_003408399.1.31233 WP_003408399.1.31263 WP_003408399.1.31264 WP_003408399.1.31270 WP_003408399.1.31287 WP_003408399.1.31304 WP_003408399.1.31346 WP_003408399.1.31348 WP_003408399.1.31354 WP_003408399.1.31390 WP_003408399.1.31414 WP_003408399.1.31417 WP_003408399.1.31428 WP_003408399.1.3143 WP_003408399.1.31458 WP_003408399.1.31483 WP_003408399.1.3149 WP_003408399.1.31498 WP_003408399.1.31507 WP_003408399.1.31548 WP_003408399.1.316 WP_003408399.1.31629 WP_003408399.1.31666 WP_003408399.1.31693 WP_003408399.1.31703 WP_003408399.1.31744 WP_003408399.1.31745 WP_003408399.1.31770 WP_003408399.1.31776 WP_003408399.1.31783 WP_003408399.1.318 WP_003408399.1.31840 WP_003408399.1.31880 WP_003408399.1.31911 WP_003408399.1.31930 WP_003408399.1.31932 WP_003408399.1.31955 WP_003408399.1.31985 WP_003408399.1.31991 WP_003408399.1.31995 WP_003408399.1.32004 WP_003408399.1.32039 WP_003408399.1.3204 WP_003408399.1.32045 WP_003408399.1.32071 WP_003408399.1.32098 WP_003408399.1.32132 WP_003408399.1.32157 WP_003408399.1.32164 WP_003408399.1.32179 WP_003408399.1.32198 WP_003408399.1.32297 WP_003408399.1.32317 WP_003408399.1.32383 WP_003408399.1.32403 WP_003408399.1.32416 WP_003408399.1.32433 WP_003408399.1.32461 WP_003408399.1.32482 WP_003408399.1.32503 WP_003408399.1.32556 WP_003408399.1.32562 WP_003408399.1.32569 WP_003408399.1.32592 WP_003408399.1.32620 WP_003408399.1.32647 WP_003408399.1.32653 WP_003408399.1.32654 WP_003408399.1.32695 WP_003408399.1.32706 WP_003408399.1.32716 WP_003408399.1.32738 WP_003408399.1.32752 WP_003408399.1.32780 WP_003408399.1.32781 WP_003408399.1.32793 WP_003408399.1.32799 WP_003408399.1.32822 WP_003408399.1.32833 WP_003408399.1.32862 WP_003408399.1.32880 WP_003408399.1.32909 WP_003408399.1.32935 WP_003408399.1.32974 WP_003408399.1.33007 WP_003408399.1.3302 WP_003408399.1.33028 WP_003408399.1.33035 WP_003408399.1.33044 WP_003408399.1.33054 WP_003408399.1.33141 WP_003408399.1.33148 WP_003408399.1.33155 WP_003408399.1.33168 WP_003408399.1.3321 WP_003408399.1.33215 WP_003408399.1.3325 WP_003408399.1.3327 WP_003408399.1.33278 WP_003408399.1.33288 WP_003408399.1.33305 WP_003408399.1.3331 WP_003408399.1.33319 WP_003408399.1.3333 WP_003408399.1.33393 WP_003408399.1.33403 WP_003408399.1.33452 WP_003408399.1.33467 WP_003408399.1.33477 WP_003408399.1.3349 WP_003408399.1.33519 WP_003408399.1.33542 WP_003408399.1.33601 WP_003408399.1.33602 WP_003408399.1.33646 WP_003408399.1.33673 WP_003408399.1.3369 WP_003408399.1.33705 WP_003408399.1.33762 WP_003408399.1.33783 WP_003408399.1.3383 WP_003408399.1.33832 WP_003408399.1.33839 WP_003408399.1.33848 WP_003408399.1.3387 WP_003408399.1.33886 WP_003408399.1.33895 WP_003408399.1.33906 WP_003408399.1.33912 WP_003408399.1.33954 WP_003408399.1.3399 WP_003408399.1.34042 WP_003408399.1.3405 WP_003408399.1.34055 WP_003408399.1.34056 WP_003408399.1.34065 WP_003408399.1.34090 WP_003408399.1.34109 WP_003408399.1.34111 WP_003408399.1.34131 WP_003408399.1.34152 WP_003408399.1.34153 WP_003408399.1.34197 WP_003408399.1.34198 WP_003408399.1.34215 WP_003408399.1.34219 WP_003408399.1.34255 WP_003408399.1.34260 WP_003408399.1.34275 WP_003408399.1.343 WP_003408399.1.34392 WP_003408399.1.344 WP_003408399.1.34428 WP_003408399.1.3443 WP_003408399.1.34435 WP_003408399.1.34446 WP_003408399.1.34499 WP_003408399.1.34505 WP_003408399.1.34516 WP_003408399.1.34529 WP_003408399.1.34551 WP_003408399.1.34563 WP_003408399.1.34576 WP_003408399.1.34581 WP_003408399.1.34588 WP_003408399.1.34596 WP_003408399.1.34599 WP_003408399.1.34639 WP_003408399.1.34673 WP_003408399.1.34724 WP_003408399.1.34740 WP_003408399.1.34755 WP_003408399.1.34777 WP_003408399.1.34783 WP_003408399.1.34841 WP_003408399.1.34908 WP_003408399.1.34919 WP_003408399.1.3492 WP_003408399.1.34933 WP_003408399.1.34945 WP_003408399.1.34946 WP_003408399.1.34954 WP_003408399.1.34960 WP_003408399.1.34961 WP_003408399.1.34963 WP_003408399.1.34965 WP_003408399.1.34968 WP_003408399.1.35023 WP_003408399.1.35069 WP_003408399.1.35072 WP_003408399.1.35078 WP_003408399.1.35100 WP_003408399.1.35146 WP_003408399.1.35156 WP_003408399.1.35160 WP_003408399.1.35162 WP_003408399.1.35176 WP_003408399.1.3520 WP_003408399.1.35213 WP_003408399.1.35221 WP_003408399.1.35246 WP_003408399.1.35278 WP_003408399.1.35301 WP_003408399.1.35311 WP_003408399.1.35312 WP_003408399.1.35317 WP_003408399.1.35319 WP_003408399.1.35347 WP_003408399.1.35363 WP_003408399.1.35382 WP_003408399.1.35385 WP_003408399.1.35396 WP_003408399.1.35426 WP_003408399.1.35439 WP_003408399.1.3548 WP_003408399.1.35484 WP_003408399.1.35492 WP_003408399.1.3553 WP_003408399.1.35553 WP_003408399.1.35555 WP_003408399.1.35561 WP_003408399.1.35602 WP_003408399.1.35610 WP_003408399.1.35635 WP_003408399.1.35680 WP_003408399.1.35687 WP_003408399.1.35689 WP_003408399.1.35707 WP_003408399.1.35732 WP_003408399.1.35754 WP_003408399.1.35767 WP_003408399.1.35770 WP_003408399.1.35771 WP_003408399.1.35780 WP_003408399.1.35805 WP_003408399.1.35811 WP_003408399.1.35821 WP_003408399.1.3584 WP_003408399.1.35848 WP_003408399.1.35864 WP_003408399.1.35874 WP_003408399.1.35876 WP_003408399.1.35897 WP_003408399.1.35899 WP_003408399.1.35923 WP_003408399.1.3593 WP_003408399.1.35954 WP_003408399.1.36005 WP_003408399.1.36014 WP_003408399.1.36023 WP_003408399.1.36053 WP_003408399.1.36075 WP_003408399.1.36089 WP_003408399.1.36097 WP_003408399.1.36098 WP_003408399.1.36116 WP_003408399.1.36145 WP_003408399.1.36156 WP_003408399.1.36205 WP_003408399.1.36228 WP_003408399.1.36252 WP_003408399.1.36260 WP_003408399.1.36270 WP_003408399.1.36271 WP_003408399.1.36303 WP_003408399.1.36309 WP_003408399.1.36315 WP_003408399.1.36319 WP_003408399.1.36321 WP_003408399.1.36326 WP_003408399.1.3634 WP_003408399.1.36356 WP_003408399.1.36357 WP_003408399.1.3636 WP_003408399.1.36385 WP_003408399.1.36399 WP_003408399.1.36436 WP_003408399.1.36465 WP_003408399.1.36469 WP_003408399.1.36473 WP_003408399.1.36485 WP_003408399.1.36508 WP_003408399.1.36540 WP_003408399.1.36561 WP_003408399.1.36571 WP_003408399.1.36573 WP_003408399.1.36578 WP_003408399.1.36585 WP_003408399.1.36597 WP_003408399.1.36614 WP_003408399.1.36674 WP_003408399.1.36720 WP_003408399.1.36727 WP_003408399.1.36733 WP_003408399.1.36785 WP_003408399.1.36810 WP_003408399.1.36844 WP_003408399.1.36851 WP_003408399.1.36862 WP_003408399.1.36893 WP_003408399.1.36921 WP_003408399.1.36935 WP_003408399.1.36941 WP_003408399.1.3695 WP_003408399.1.36951 WP_003408399.1.36968 WP_003408399.1.3700 WP_003408399.1.37004 WP_003408399.1.37012 WP_003408399.1.37071 WP_003408399.1.37088 WP_003408399.1.37131 WP_003408399.1.37157 WP_003408399.1.37175 WP_003408399.1.37188 WP_003408399.1.37213 WP_003408399.1.37229 WP_003408399.1.3724 WP_003408399.1.37277 WP_003408399.1.37305 WP_003408399.1.37330 WP_003408399.1.37389 WP_003408399.1.37400 WP_003408399.1.37440 WP_003408399.1.37459 WP_003408399.1.37468 WP_003408399.1.37475 WP_003408399.1.37484 WP_003408399.1.37601 WP_003408399.1.37612 WP_003408399.1.37632 WP_003408399.1.37643 WP_003408399.1.37655 WP_003408399.1.37660 WP_003408399.1.37674 WP_003408399.1.37700 WP_003408399.1.37701 WP_003408399.1.37709 WP_003408399.1.37711 WP_003408399.1.37721 WP_003408399.1.37722 WP_003408399.1.37765 WP_003408399.1.37772 WP_003408399.1.37804 WP_003408399.1.37809 WP_003408399.1.37859 WP_003408399.1.37877 WP_003408399.1.37912 WP_003408399.1.37913 WP_003408399.1.37943 WP_003408399.1.37950 WP_003408399.1.37973 WP_003408399.1.37975 WP_003408399.1.37983 WP_003408399.1.38 WP_003408399.1.38002 WP_003408399.1.3802 WP_003408399.1.38039 WP_003408399.1.38040 WP_003408399.1.38067 WP_003408399.1.38068 WP_003408399.1.38135 WP_003408399.1.38138 WP_003408399.1.38144 WP_003408399.1.38158 WP_003408399.1.38159 WP_003408399.1.38210 WP_003408399.1.38240 WP_003408399.1.38299 WP_003408399.1.38332 WP_003408399.1.38347 WP_003408399.1.38354 WP_003408399.1.38380 WP_003408399.1.38384 WP_003408399.1.38389 WP_003408399.1.38398 WP_003408399.1.38402 WP_003408399.1.38418 WP_003408399.1.38421 WP_003408399.1.38466 WP_003408399.1.38477 WP_003408399.1.38483 WP_003408399.1.3849 WP_003408399.1.385 WP_003408399.1.38530 WP_003408399.1.38535 WP_003408399.1.38539 WP_003408399.1.38594 WP_003408399.1.38601 WP_003408399.1.38611 WP_003408399.1.38638 WP_003408399.1.38639 WP_003408399.1.38646 WP_003408399.1.38648 WP_003408399.1.38654 WP_003408399.1.38659 WP_003408399.1.38660 WP_003408399.1.38666 WP_003408399.1.38671 WP_003408399.1.38672 WP_003408399.1.38677 WP_003408399.1.38750 WP_003408399.1.38772 WP_003408399.1.38812 WP_003408399.1.38821 WP_003408399.1.38844 WP_003408399.1.38863 WP_003408399.1.38865 WP_003408399.1.38873 WP_003408399.1.3889 WP_003408399.1.38894 WP_003408399.1.38909 WP_003408399.1.38939 WP_003408399.1.38975 WP_003408399.1.38991 WP_003408399.1.39025 WP_003408399.1.39070 WP_003408399.1.39072 WP_003408399.1.39095 WP_003408399.1.39106 WP_003408399.1.39165 WP_003408399.1.39176 WP_003408399.1.39190 WP_003408399.1.39201 WP_003408399.1.39207 WP_003408399.1.39211 WP_003408399.1.39236 WP_003408399.1.39239 WP_003408399.1.39252 WP_003408399.1.39288 WP_003408399.1.39295 WP_003408399.1.39306 WP_003408399.1.39359 WP_003408399.1.39364 WP_003408399.1.39400 WP_003408399.1.39447 WP_003408399.1.3945 WP_003408399.1.39450 WP_003408399.1.39455 WP_003408399.1.3949 WP_003408399.1.39521 WP_003408399.1.39560 WP_003408399.1.39592 WP_003408399.1.39593 WP_003408399.1.396 WP_003408399.1.3960 WP_003408399.1.39616 WP_003408399.1.39654 WP_003408399.1.39657 WP_003408399.1.39661 WP_003408399.1.39674 WP_003408399.1.39678 WP_003408399.1.3968 WP_003408399.1.39694 WP_003408399.1.3971 WP_003408399.1.39718 WP_003408399.1.39728 WP_003408399.1.39739 WP_003408399.1.39748 WP_003408399.1.39751 WP_003408399.1.39759 WP_003408399.1.39801 WP_003408399.1.39804 WP_003408399.1.39848 WP_003408399.1.39877 WP_003408399.1.39925 WP_003408399.1.3994 WP_003408399.1.39959 WP_003408399.1.3996 WP_003408399.1.39960 WP_003408399.1.3997 WP_003408399.1.39980 WP_003408399.1.40000 WP_003408399.1.40028 WP_003408399.1.40029 WP_003408399.1.4003 WP_003408399.1.40094 WP_003408399.1.40096 WP_003408399.1.40150 WP_003408399.1.40156 WP_003408399.1.40174 WP_003408399.1.40186 WP_003408399.1.40276 WP_003408399.1.40277 WP_003408399.1.40323 WP_003408399.1.40336 WP_003408399.1.40353 WP_003408399.1.4036 WP_003408399.1.40372 WP_003408399.1.40402 WP_003408399.1.40413 WP_003408399.1.40440 WP_003408399.1.40446 WP_003408399.1.40451 WP_003408399.1.40455 WP_003408399.1.40523 WP_003408399.1.40543 WP_003408399.1.40641 WP_003408399.1.40646 WP_003408399.1.40651 WP_003408399.1.40653 WP_003408399.1.4067 WP_003408399.1.40705 WP_003408399.1.40723 WP_003408399.1.40731 WP_003408399.1.40735 WP_003408399.1.40799 WP_003408399.1.40852 WP_003408399.1.40876 WP_003408399.1.40881 WP_003408399.1.40922 WP_003408399.1.40948 WP_003408399.1.4095 WP_003408399.1.40956 WP_003408399.1.40957 WP_003408399.1.40964 WP_003408399.1.4097 WP_003408399.1.410 WP_003408399.1.41000 WP_003408399.1.41055 WP_003408399.1.41123 WP_003408399.1.41177 WP_003408399.1.41202 WP_003408399.1.41219 WP_003408399.1.41231 WP_003408399.1.41249 WP_003408399.1.4127 WP_003408399.1.41296 WP_003408399.1.41355 WP_003408399.1.41376 WP_003408399.1.41430 WP_003408399.1.41447 WP_003408399.1.41469 WP_003408399.1.41504 WP_003408399.1.41564 WP_003408399.1.41583 WP_003408399.1.41616 WP_003408399.1.41632 WP_003408399.1.41635 WP_003408399.1.41648 WP_003408399.1.41660 WP_003408399.1.41685 WP_003408399.1.41695 WP_003408399.1.41704 WP_003408399.1.4171 WP_003408399.1.41719 WP_003408399.1.41733 WP_003408399.1.41744 WP_003408399.1.41774 WP_003408399.1.41791 WP_003408399.1.41803 WP_003408399.1.41820 WP_003408399.1.41828 WP_003408399.1.41829 WP_003408399.1.41860 WP_003408399.1.41912 WP_003408399.1.41921 WP_003408399.1.41933 WP_003408399.1.41944 WP_003408399.1.42043 WP_003408399.1.42075 WP_003408399.1.42078 WP_003408399.1.42094 WP_003408399.1.42112 WP_003408399.1.4212 WP_003408399.1.42122 WP_003408399.1.42134 WP_003408399.1.42183 WP_003408399.1.42188 WP_003408399.1.42201 WP_003408399.1.42202 WP_003408399.1.42208 WP_003408399.1.42247 WP_003408399.1.42255 WP_003408399.1.42273 WP_003408399.1.42278 WP_003408399.1.42304 WP_003408399.1.42309 WP_003408399.1.42370 WP_003408399.1.42385 WP_003408399.1.42400 WP_003408399.1.42409 WP_003408399.1.42414 WP_003408399.1.42417 WP_003408399.1.42430 WP_003408399.1.42461 WP_003408399.1.42465 WP_003408399.1.42467 WP_003408399.1.42473 WP_003408399.1.42474 WP_003408399.1.42494 WP_003408399.1.42519 WP_003408399.1.42524 WP_003408399.1.42534 WP_003408399.1.4255 WP_003408399.1.42568 WP_003408399.1.42570 WP_003408399.1.42618 WP_003408399.1.42660 WP_003408399.1.42695 WP_003408399.1.42704 WP_003408399.1.42705 WP_003408399.1.42722 WP_003408399.1.42777 WP_003408399.1.42782 WP_003408399.1.42835 WP_003408399.1.42839 WP_003408399.1.42842 WP_003408399.1.42905 WP_003408399.1.42916 WP_003408399.1.42930 WP_003408399.1.42971 WP_003408399.1.43005 WP_003408399.1.43009 WP_003408399.1.43053 WP_003408399.1.43082 WP_003408399.1.43087 WP_003408399.1.43098 WP_003408399.1.43208 WP_003408399.1.43236 WP_003408399.1.43246 WP_003408399.1.43255 WP_003408399.1.43266 WP_003408399.1.43269 WP_003408399.1.43273 WP_003408399.1.43296 WP_003408399.1.4335 WP_003408399.1.43368 WP_003408399.1.43395 WP_003408399.1.43475 WP_003408399.1.43478 WP_003408399.1.43484 WP_003408399.1.43557 WP_003408399.1.43578 WP_003408399.1.43588 WP_003408399.1.43643 WP_003408399.1.43664 WP_003408399.1.43684 WP_003408399.1.43686 WP_003408399.1.43706 WP_003408399.1.43716 WP_003408399.1.4377 WP_003408399.1.43781 WP_003408399.1.43794 WP_003408399.1.43815 WP_003408399.1.43846 WP_003408399.1.43861 WP_003408399.1.43863 WP_003408399.1.43866 WP_003408399.1.43872 WP_003408399.1.43885 WP_003408399.1.43897 WP_003408399.1.4390 WP_003408399.1.43902 WP_003408399.1.43921 WP_003408399.1.43936 WP_003408399.1.43937 WP_003408399.1.43960 WP_003408399.1.43965 WP_003408399.1.4399 WP_003408399.1.43993 WP_003408399.1.43996 WP_003408399.1.44 WP_003408399.1.44001 WP_003408399.1.44008 WP_003408399.1.44016 WP_003408399.1.44033 WP_003408399.1.44041 WP_003408399.1.44070 WP_003408399.1.44071 WP_003408399.1.44076 WP_003408399.1.44104 WP_003408399.1.44111 WP_003408399.1.44124 WP_003408399.1.44169 WP_003408399.1.44219 WP_003408399.1.44237 WP_003408399.1.44277 WP_003408399.1.44279 WP_003408399.1.44336 WP_003408399.1.44355 WP_003408399.1.44358 WP_003408399.1.4438 WP_003408399.1.44392 WP_003408399.1.4441 WP_003408399.1.44415 WP_003408399.1.44464 WP_003408399.1.44466 WP_003408399.1.44489 WP_003408399.1.44492 WP_003408399.1.44494 WP_003408399.1.44500 WP_003408399.1.44519 WP_003408399.1.44526 WP_003408399.1.44532 WP_003408399.1.44534 WP_003408399.1.44562 WP_003408399.1.44589 WP_003408399.1.44597 WP_003408399.1.44600 WP_003408399.1.44602 WP_003408399.1.44615 WP_003408399.1.4464 WP_003408399.1.44651 WP_003408399.1.44659 WP_003408399.1.44665 WP_003408399.1.44694 WP_003408399.1.44700 WP_003408399.1.44713 WP_003408399.1.44735 WP_003408399.1.44740 WP_003408399.1.44757 WP_003408399.1.4476 WP_003408399.1.44761 WP_003408399.1.44767 WP_003408399.1.44776 WP_003408399.1.44779 WP_003408399.1.44786 WP_003408399.1.44808 WP_003408399.1.44864 WP_003408399.1.44901 WP_003408399.1.44908 WP_003408399.1.44913 WP_003408399.1.4492 WP_003408399.1.44939 WP_003408399.1.44979 WP_003408399.1.44981 WP_003408399.1.45002 WP_003408399.1.45011 WP_003408399.1.4504 WP_003408399.1.45062 WP_003408399.1.45066 WP_003408399.1.45081 WP_003408399.1.45113 WP_003408399.1.45129 WP_003408399.1.45135 WP_003408399.1.45147 WP_003408399.1.45168 WP_003408399.1.4517 WP_003408399.1.45181 WP_003408399.1.45185 WP_003408399.1.45192 WP_003408399.1.45200 WP_003408399.1.45205 WP_003408399.1.45211 WP_003408399.1.45249 WP_003408399.1.4526 WP_003408399.1.45286 WP_003408399.1.45326 WP_003408399.1.45347 WP_003408399.1.45374 WP_003408399.1.45390 WP_003408399.1.454 WP_003408399.1.45407 WP_003408399.1.45451 WP_003408399.1.45453 WP_003408399.1.45460 WP_003408399.1.45463 WP_003408399.1.45470 WP_003408399.1.45474 WP_003408399.1.45491 WP_003408399.1.45510 WP_003408399.1.45563 WP_003408399.1.45584 WP_003408399.1.45590 WP_003408399.1.45619 WP_003408399.1.45626 WP_003408399.1.45631 WP_003408399.1.45666 WP_003408399.1.45697 WP_003408399.1.4571 WP_003408399.1.45731 WP_003408399.1.45743 WP_003408399.1.45765 WP_003408399.1.45776 WP_003408399.1.45783 WP_003408399.1.45805 WP_003408399.1.45815 WP_003408399.1.45849 WP_003408399.1.45884 WP_003408399.1.4590 WP_003408399.1.45923 WP_003408399.1.45926 WP_003408399.1.45963 WP_003408399.1.45989 WP_003408399.1.45992 WP_003408399.1.46025 WP_003408399.1.46083 WP_003408399.1.46090 WP_003408399.1.46092 WP_003408399.1.46101 WP_003408399.1.46107 WP_003408399.1.46127 WP_003408399.1.46128 WP_003408399.1.46129 WP_003408399.1.46141 WP_003408399.1.46150 WP_003408399.1.46201 WP_003408399.1.46226 WP_003408399.1.4624 WP_003408399.1.46253 WP_003408399.1.46268 WP_003408399.1.46285 WP_003408399.1.46300 WP_003408399.1.46336 WP_003408399.1.46365 WP_003408399.1.46370 WP_003408399.1.46381 WP_003408399.1.46402 WP_003408399.1.46411 WP_003408399.1.4644 WP_003408399.1.46442 WP_003408399.1.46453 WP_003408399.1.46463 WP_003408399.1.46478 WP_003408399.1.46492 WP_003408399.1.46521 WP_003408399.1.4653 WP_003408399.1.46532 WP_003408399.1.46539 WP_003408399.1.46568 WP_003408399.1.46585 WP_003408399.1.46609 WP_003408399.1.46613 WP_003408399.1.46625 WP_003408399.1.46642 WP_003408399.1.46647 WP_003408399.1.46674 WP_003408399.1.46773 WP_003408399.1.46786 WP_003408399.1.46792 WP_003408399.1.46847 WP_003408399.1.46851 WP_003408399.1.4687 WP_003408399.1.46897 WP_003408399.1.46936 WP_003408399.1.46980 WP_003408399.1.47011 WP_003408399.1.47012 WP_003408399.1.47066 WP_003408399.1.47106 WP_003408399.1.47142 WP_003408399.1.47147 WP_003408399.1.47166 WP_003408399.1.47194 WP_003408399.1.47207 WP_003408399.1.47210 WP_003408399.1.47261 WP_003408399.1.47262 WP_003408399.1.47402 WP_003408399.1.47423 WP_003408399.1.47467 WP_003408399.1.47502 WP_003408399.1.4751 WP_003408399.1.47511 WP_003408399.1.47540 WP_003408399.1.47568 WP_003408399.1.47572 WP_003408399.1.47588 WP_003408399.1.47636 WP_003408399.1.4764 WP_003408399.1.47653 WP_003408399.1.47679 WP_003408399.1.47681 WP_003408399.1.47690 WP_003408399.1.4771 WP_003408399.1.47717 WP_003408399.1.47743 WP_003408399.1.47754 WP_003408399.1.47773 WP_003408399.1.47776 WP_003408399.1.47780 WP_003408399.1.47805 WP_003408399.1.47832 WP_003408399.1.47847 WP_003408399.1.47858 WP_003408399.1.47861 WP_003408399.1.47868 WP_003408399.1.47893 WP_003408399.1.47899 WP_003408399.1.479 WP_003408399.1.47912 WP_003408399.1.47913 WP_003408399.1.47926 WP_003408399.1.4794 WP_003408399.1.47943 WP_003408399.1.47944 WP_003408399.1.47959 WP_003408399.1.47974 WP_003408399.1.47993 WP_003408399.1.48004 WP_003408399.1.48039 WP_003408399.1.48050 WP_003408399.1.48084 WP_003408399.1.48097 WP_003408399.1.48101 WP_003408399.1.4813 WP_003408399.1.48130 WP_003408399.1.48135 WP_003408399.1.48152 WP_003408399.1.48155 WP_003408399.1.48170 WP_003408399.1.48173 WP_003408399.1.48177 WP_003408399.1.48185 WP_003408399.1.48219 WP_003408399.1.4823 WP_003408399.1.48240 WP_003408399.1.48256 WP_003408399.1.48264 WP_003408399.1.48287 WP_003408399.1.48330 WP_003408399.1.48333 WP_003408399.1.48348 WP_003408399.1.48354 WP_003408399.1.48372 WP_003408399.1.48383 WP_003408399.1.48388 WP_003408399.1.48419 WP_003408399.1.48423 WP_003408399.1.48443 WP_003408399.1.48450 WP_003408399.1.48543 WP_003408399.1.48550 WP_003408399.1.48605 WP_003408399.1.4863 WP_003408399.1.48648 WP_003408399.1.48658 WP_003408399.1.48666 WP_003408399.1.48687 WP_003408399.1.48779 WP_003408399.1.4878 WP_003408399.1.48798 WP_003408399.1.48802 WP_003408399.1.48826 WP_003408399.1.48843 WP_003408399.1.48857 WP_003408399.1.4890 WP_003408399.1.48946 WP_003408399.1.48979 WP_003408399.1.49017 WP_003408399.1.49048 WP_003408399.1.4906 WP_003408399.1.4907 WP_003408399.1.49103 WP_003408399.1.49110 WP_003408399.1.49111 WP_003408399.1.4919 WP_003408399.1.49251 WP_003408399.1.49254 WP_003408399.1.49263 WP_003408399.1.49291 WP_003408399.1.49296 WP_003408399.1.49335 WP_003408399.1.49337 WP_003408399.1.49419 WP_003408399.1.49426 WP_003408399.1.49437 WP_003408399.1.49439 WP_003408399.1.49474 WP_003408399.1.49506 WP_003408399.1.49516 WP_003408399.1.49523 WP_003408399.1.49526 WP_003408399.1.49532 WP_003408399.1.49588 WP_003408399.1.4959 WP_003408399.1.49687 WP_003408399.1.49699 WP_003408399.1.49709 WP_003408399.1.4971 WP_003408399.1.4972 WP_003408399.1.49746 WP_003408399.1.49764 WP_003408399.1.49773 WP_003408399.1.49796 WP_003408399.1.49814 WP_003408399.1.49815 WP_003408399.1.49816 WP_003408399.1.49839 WP_003408399.1.49857 WP_003408399.1.49878 WP_003408399.1.49880 WP_003408399.1.49944 WP_003408399.1.4999 WP_003408399.1.50068 WP_003408399.1.5008 WP_003408399.1.50081 WP_003408399.1.50122 WP_003408399.1.50126 WP_003408399.1.50149 WP_003408399.1.50162 WP_003408399.1.5018 WP_003408399.1.50194 WP_003408399.1.50218 WP_003408399.1.50235 WP_003408399.1.50249 WP_003408399.1.50265 WP_003408399.1.50271 WP_003408399.1.50324 WP_003408399.1.50347 WP_003408399.1.50372 WP_003408399.1.50398 WP_003408399.1.50407 WP_003408399.1.50444 WP_003408399.1.50466 WP_003408399.1.50472 WP_003408399.1.5048 WP_003408399.1.50498 WP_003408399.1.5050 WP_003408399.1.50540 WP_003408399.1.50554 WP_003408399.1.50557 WP_003408399.1.50610 WP_003408399.1.50632 WP_003408399.1.50633 WP_003408399.1.50642 WP_003408399.1.50655 WP_003408399.1.50659 WP_003408399.1.50683 WP_003408399.1.50689 WP_003408399.1.50692 WP_003408399.1.50714 WP_003408399.1.50729 WP_003408399.1.50756 WP_003408399.1.50784 WP_003408399.1.50794 WP_003408399.1.50841 WP_003408399.1.50860 WP_003408399.1.50868 WP_003408399.1.5096 WP_003408399.1.50981 WP_003408399.1.50987 WP_003408399.1.51009 WP_003408399.1.51037 WP_003408399.1.51074 WP_003408399.1.51082 WP_003408399.1.51101 WP_003408399.1.51116 WP_003408399.1.51149 WP_003408399.1.51156 WP_003408399.1.51157 WP_003408399.1.51232 WP_003408399.1.51247 WP_003408399.1.51266 WP_003408399.1.51279 WP_003408399.1.51291 WP_003408399.1.51301 WP_003408399.1.51329 WP_003408399.1.51391 WP_003408399.1.51422 WP_003408399.1.51445 WP_003408399.1.51455 WP_003408399.1.51466 WP_003408399.1.51468 WP_003408399.1.51478 WP_003408399.1.51497 WP_003408399.1.51520 WP_003408399.1.51593 WP_003408399.1.51628 WP_003408399.1.5164 WP_003408399.1.51647 WP_003408399.1.51660 WP_003408399.1.51696 WP_003408399.1.51721 WP_003408399.1.51788 WP_003408399.1.51795 WP_003408399.1.51801 WP_003408399.1.51817 WP_003408399.1.51819 WP_003408399.1.51854 WP_003408399.1.51923 WP_003408399.1.51942 WP_003408399.1.51948 WP_003408399.1.51963 WP_003408399.1.51969 WP_003408399.1.52000 WP_003408399.1.52001 WP_003408399.1.52003 WP_003408399.1.52006 WP_003408399.1.52036 WP_003408399.1.52038 WP_003408399.1.52046 WP_003408399.1.52059 WP_003408399.1.52069 WP_003408399.1.52082 WP_003408399.1.52102 WP_003408399.1.52106 WP_003408399.1.52166 WP_003408399.1.52168 WP_003408399.1.52173 WP_003408399.1.52178 WP_003408399.1.52206 WP_003408399.1.52216 WP_003408399.1.52238 WP_003408399.1.52241 WP_003408399.1.52280 WP_003408399.1.52314 WP_003408399.1.52385 WP_003408399.1.52390 WP_003408399.1.524 WP_003408399.1.52460 WP_003408399.1.52485 WP_003408399.1.52486 WP_003408399.1.52495 WP_003408399.1.52504 WP_003408399.1.52522 WP_003408399.1.52531 WP_003408399.1.52533 WP_003408399.1.52545 WP_003408399.1.52553 WP_003408399.1.52563 WP_003408399.1.52564 WP_003408399.1.52574 WP_003408399.1.52641 WP_003408399.1.52673 WP_003408399.1.52674 WP_003408399.1.52708 WP_003408399.1.52713 WP_003408399.1.52761 WP_003408399.1.52778 WP_003408399.1.52791 WP_003408399.1.52797 WP_003408399.1.52818 WP_003408399.1.52872 WP_003408399.1.52873 WP_003408399.1.52891 WP_003408399.1.52892 WP_003408399.1.52909 WP_003408399.1.52970 WP_003408399.1.52998 WP_003408399.1.53053 WP_003408399.1.53056 WP_003408399.1.5306 WP_003408399.1.53088 WP_003408399.1.5309 WP_003408399.1.531 WP_003408399.1.53117 WP_003408399.1.53118 WP_003408399.1.53142 WP_003408399.1.53143 WP_003408399.1.53157 WP_003408399.1.53167 WP_003408399.1.53200 WP_003408399.1.53204 WP_003408399.1.53213 WP_003408399.1.53217 WP_003408399.1.53226 WP_003408399.1.53229 WP_003408399.1.53230 WP_003408399.1.53237 WP_003408399.1.53254 WP_003408399.1.53257 WP_003408399.1.5327 WP_003408399.1.53276 WP_003408399.1.53278 WP_003408399.1.53302 WP_003408399.1.53306 WP_003408399.1.5334 WP_003408399.1.5335 WP_003408399.1.53353 WP_003408399.1.53381 WP_003408399.1.53413 WP_003408399.1.53458 WP_003408399.1.53460 WP_003408399.1.53480 WP_003408399.1.53517 WP_003408399.1.53522 WP_003408399.1.53525 WP_003408399.1.53526 WP_003408399.1.53553 WP_003408399.1.53606 WP_003408399.1.53609 WP_003408399.1.53628 WP_003408399.1.53643 WP_003408399.1.53667 WP_003408399.1.53679 WP_003408399.1.53715 WP_003408399.1.53730 WP_003408399.1.53742 WP_003408399.1.53743 WP_003408399.1.53754 WP_003408399.1.53775 WP_003408399.1.53787 WP_003408399.1.53803 WP_003408399.1.53818 WP_003408399.1.53822 WP_003408399.1.53853 WP_003408399.1.53865 WP_003408399.1.53888 WP_003408399.1.53912 WP_003408399.1.53914 WP_003408399.1.53952 WP_003408399.1.53973 WP_003408399.1.5398 WP_003408399.1.54089 WP_003408399.1.54093 WP_003408399.1.54099 WP_003408399.1.54112 WP_003408399.1.54125 WP_003408399.1.54141 WP_003408399.1.54162 WP_003408399.1.54179 WP_003408399.1.54218 WP_003408399.1.54225 WP_003408399.1.54227 WP_003408399.1.54232 WP_003408399.1.54241 WP_003408399.1.54247 WP_003408399.1.54260 WP_003408399.1.54275 WP_003408399.1.54280 WP_003408399.1.5429 WP_003408399.1.54294 WP_003408399.1.54314 WP_003408399.1.54347 WP_003408399.1.54351 WP_003408399.1.54370 WP_003408399.1.54428 WP_003408399.1.54449 WP_003408399.1.54494 WP_003408399.1.54502 WP_003408399.1.54514 WP_003408399.1.54519 WP_003408399.1.5452 WP_003408399.1.54531 WP_003408399.1.54537 WP_003408399.1.54553 WP_003408399.1.54555 WP_003408399.1.54575 WP_003408399.1.54633 WP_003408399.1.54686 WP_003408399.1.54687 WP_003408399.1.54705 WP_003408399.1.54730 WP_003408399.1.54732 WP_003408399.1.5475 WP_003408399.1.54797 WP_003408399.1.54807 WP_003408399.1.54836 WP_003408399.1.54838 WP_003408399.1.54860 WP_003408399.1.54888 WP_003408399.1.54897 WP_003408399.1.54905 WP_003408399.1.54909 WP_003408399.1.54937 WP_003408399.1.54939 WP_003408399.1.54944 WP_003408399.1.54945 WP_003408399.1.54953 WP_003408399.1.54964 WP_003408399.1.55015 WP_003408399.1.55022 WP_003408399.1.55023 WP_003408399.1.55051 WP_003408399.1.55072 WP_003408399.1.55088 WP_003408399.1.55106 WP_003408399.1.55126 WP_003408399.1.55128 WP_003408399.1.55140 WP_003408399.1.55150 WP_003408399.1.55210 WP_003408399.1.55227 WP_003408399.1.55248 WP_003408399.1.55257 WP_003408399.1.55258 WP_003408399.1.55267 WP_003408399.1.55279 WP_003408399.1.55307 WP_003408399.1.55326 WP_003408399.1.55328 WP_003408399.1.5533 WP_003408399.1.55345 WP_003408399.1.55396 WP_003408399.1.55398 WP_003408399.1.55441 WP_003408399.1.55459 WP_003408399.1.55501 WP_003408399.1.55504 WP_003408399.1.55578 WP_003408399.1.55626 WP_003408399.1.55641 WP_003408399.1.5569 WP_003408399.1.55723 WP_003408399.1.55735 WP_003408399.1.5574 WP_003408399.1.55772 WP_003408399.1.55802 WP_003408399.1.55807 WP_003408399.1.55819 WP_003408399.1.55821 WP_003408399.1.5583 WP_003408399.1.55849 WP_003408399.1.55856 WP_003408399.1.55882 WP_003408399.1.55883 WP_003408399.1.55894 WP_003408399.1.55902 WP_003408399.1.55909 WP_003408399.1.5591 WP_003408399.1.55961 WP_003408399.1.55977 WP_003408399.1.55983 WP_003408399.1.56028 WP_003408399.1.56057 WP_003408399.1.56060 WP_003408399.1.56107 WP_003408399.1.56132 WP_003408399.1.56163 WP_003408399.1.56167 WP_003408399.1.56178 WP_003408399.1.56287 WP_003408399.1.56292 WP_003408399.1.56327 WP_003408399.1.56341 WP_003408399.1.56359 WP_003408399.1.56365 WP_003408399.1.56394 WP_003408399.1.56443 WP_003408399.1.56473 WP_003408399.1.56478 WP_003408399.1.56500 WP_003408399.1.56517 WP_003408399.1.56534 WP_003408399.1.5656 WP_003408399.1.56577 WP_003408399.1.56593 WP_003408399.1.56625 WP_003408399.1.56637 WP_003408399.1.56670 WP_003408399.1.56697 WP_003408399.1.567 WP_003408399.1.56701 WP_003408399.1.56709 WP_003408399.1.56729 WP_003408399.1.56743 WP_003408399.1.56755 WP_003408399.1.56764 WP_003408399.1.56769 WP_003408399.1.56770 WP_003408399.1.56795 WP_003408399.1.5681 WP_003408399.1.56827 WP_003408399.1.56839 WP_003408399.1.56863 WP_003408399.1.56868 WP_003408399.1.56869 WP_003408399.1.56915 WP_003408399.1.56926 WP_003408399.1.56961 WP_003408399.1.56971 WP_003408399.1.56972 WP_003408399.1.57023 WP_003408399.1.57035 WP_003408399.1.57077 WP_003408399.1.57087 WP_003408399.1.57094 WP_003408399.1.57134 WP_003408399.1.57151 WP_003408399.1.57169 WP_003408399.1.57208 WP_003408399.1.57212 WP_003408399.1.57230 WP_003408399.1.5724 WP_003408399.1.5725 WP_003408399.1.5727 WP_003408399.1.57273 WP_003408399.1.573 WP_003408399.1.57314 WP_003408399.1.57326 WP_003408399.1.57328 WP_003408399.1.57331 WP_003408399.1.57340 WP_003408399.1.57351 WP_003408399.1.57352 WP_003408399.1.57380 WP_003408399.1.57430 WP_003408399.1.5744 WP_003408399.1.57440 WP_003408399.1.5745 WP_003408399.1.57461 WP_003408399.1.57469 WP_003408399.1.57489 WP_003408399.1.575 WP_003408399.1.57509 WP_003408399.1.57519 WP_003408399.1.57525 WP_003408399.1.57551 WP_003408399.1.5758 WP_003408399.1.57596 WP_003408399.1.57604 WP_003408399.1.57616 WP_003408399.1.57617 WP_003408399.1.57619 WP_003408399.1.57627 WP_003408399.1.57642 WP_003408399.1.57658 WP_003408399.1.57667 WP_003408399.1.57675 WP_003408399.1.57689 WP_003408399.1.57708 WP_003408399.1.57794 WP_003408399.1.57821 WP_003408399.1.57825 WP_003408399.1.57843 WP_003408399.1.57906 WP_003408399.1.57924 WP_003408399.1.57926 WP_003408399.1.57930 WP_003408399.1.57957 WP_003408399.1.57960 WP_003408399.1.57964 WP_003408399.1.57991 WP_003408399.1.58000 WP_003408399.1.58086 WP_003408399.1.58101 WP_003408399.1.58103 WP_003408399.1.58108 WP_003408399.1.5811 WP_003408399.1.58121 WP_003408399.1.58145 WP_003408399.1.58164 WP_003408399.1.58174 WP_003408399.1.582 WP_003408399.1.58202 WP_003408399.1.5824 WP_003408399.1.58259 WP_003408399.1.58283 WP_003408399.1.58288 WP_003408399.1.5830 WP_003408399.1.58303 WP_003408399.1.58311 WP_003408399.1.58330 WP_003408399.1.58359 WP_003408399.1.58386 WP_003408399.1.58393 WP_003408399.1.58431 WP_003408399.1.5844 WP_003408399.1.58488 WP_003408399.1.58518 WP_003408399.1.58534 WP_003408399.1.58559 WP_003408399.1.58567 WP_003408399.1.58573 WP_003408399.1.58602 WP_003408399.1.58619 WP_003408399.1.58630 WP_003408399.1.5865 WP_003408399.1.58671 WP_003408399.1.58690 WP_003408399.1.58702 WP_003408399.1.58743 WP_003408399.1.58754 WP_003408399.1.5879 WP_003408399.1.5881 WP_003408399.1.58848 WP_003408399.1.58857 WP_003408399.1.58891 WP_003408399.1.58892 WP_003408399.1.5890 WP_003408399.1.58921 WP_003408399.1.58939 WP_003408399.1.58941 WP_003408399.1.58953 WP_003408399.1.5898 WP_003408399.1.59025 WP_003408399.1.59029 WP_003408399.1.59037 WP_003408399.1.59044 WP_003408399.1.59085 WP_003408399.1.59088 WP_003408399.1.59130 WP_003408399.1.5914 WP_003408399.1.59147 WP_003408399.1.59166 WP_003408399.1.59205 WP_003408399.1.59209 WP_003408399.1.59237 WP_003408399.1.59240 WP_003408399.1.59254 WP_003408399.1.59262 WP_003408399.1.59270 WP_003408399.1.5928 WP_003408399.1.59304 WP_003408399.1.59305 WP_003408399.1.59309 WP_003408399.1.59316 WP_003408399.1.59326 WP_003408399.1.59328 WP_003408399.1.59333 WP_003408399.1.59338 WP_003408399.1.59388 WP_003408399.1.59428 WP_003408399.1.59487 WP_003408399.1.59537 WP_003408399.1.59561 WP_003408399.1.59677 WP_003408399.1.59722 WP_003408399.1.59732 WP_003408399.1.59738 WP_003408399.1.59750 WP_003408399.1.59757 WP_003408399.1.59808 WP_003408399.1.59850 WP_003408399.1.59856 WP_003408399.1.59860 WP_003408399.1.59861 WP_003408399.1.5987 WP_003408399.1.59878 WP_003408399.1.59888 WP_003408399.1.59952 WP_003408399.1.5996 WP_003408399.1.59961 WP_003408399.1.59974 WP_003408399.1.6000 WP_003408399.1.60007 WP_003408399.1.60016 WP_003408399.1.6003 WP_003408399.1.60047 WP_003408399.1.6007 WP_003408399.1.60091 WP_003408399.1.60121 WP_003408399.1.60125 WP_003408399.1.60135 WP_003408399.1.60139 WP_003408399.1.60152 WP_003408399.1.60171 WP_003408399.1.60197 WP_003408399.1.6020 WP_003408399.1.60205 WP_003408399.1.60207 WP_003408399.1.60215 WP_003408399.1.60267 WP_003408399.1.60288 WP_003408399.1.60291 WP_003408399.1.60301 WP_003408399.1.60305 WP_003408399.1.60312 WP_003408399.1.60313 WP_003408399.1.60314 WP_003408399.1.60413 WP_003408399.1.60421 WP_003408399.1.60451 WP_003408399.1.60460 WP_003408399.1.60479 WP_003408399.1.60487 WP_003408399.1.60512 WP_003408399.1.60573 WP_003408399.1.60583 WP_003408399.1.60632 WP_003408399.1.60657 WP_003408399.1.60687 WP_003408399.1.60689 WP_003408399.1.60727 WP_003408399.1.60738 WP_003408399.1.60763 WP_003408399.1.6077 WP_003408399.1.60791 WP_003408399.1.60834 WP_003408399.1.60870 WP_003408399.1.60878 WP_003408399.1.60879 WP_003408399.1.60913 WP_003408399.1.60978 WP_003408399.1.61000 WP_003408399.1.61001 WP_003408399.1.61012 WP_003408399.1.61014 WP_003408399.1.61015 WP_003408399.1.61037 WP_003408399.1.61052 WP_003408399.1.61065 WP_003408399.1.61100 WP_003408399.1.61101 WP_003408399.1.61138 WP_003408399.1.61142 WP_003408399.1.61198 WP_003408399.1.612 WP_003408399.1.61234 WP_003408399.1.61256 WP_003408399.1.61281 WP_003408399.1.61314 WP_003408399.1.61321 WP_003408399.1.61326 WP_003408399.1.61328 WP_003408399.1.61368 WP_003408399.1.61391 WP_003408399.1.61406 WP_003408399.1.61409 WP_003408399.1.61420 WP_003408399.1.61422 WP_003408399.1.61425 WP_003408399.1.61428 WP_003408399.1.61469 WP_003408399.1.61494 WP_003408399.1.61522 WP_003408399.1.61552 WP_003408399.1.61557 WP_003408399.1.61567 WP_003408399.1.61571 WP_003408399.1.61573 WP_003408399.1.61584 WP_003408399.1.61586 WP_003408399.1.6159 WP_003408399.1.61592 WP_003408399.1.6160 WP_003408399.1.61614 WP_003408399.1.6163 WP_003408399.1.61655 WP_003408399.1.61665 WP_003408399.1.61669 WP_003408399.1.61682 WP_003408399.1.61692 WP_003408399.1.61719 WP_003408399.1.61728 WP_003408399.1.61750 WP_003408399.1.61754 WP_003408399.1.61755 WP_003408399.1.61757 WP_003408399.1.61778 WP_003408399.1.6179 WP_003408399.1.61816 WP_003408399.1.61842 WP_003408399.1.61850 WP_003408399.1.61862 WP_003408399.1.61865 WP_003408399.1.61868 WP_003408399.1.61911 WP_003408399.1.61925 WP_003408399.1.61941 WP_003408399.1.61953 WP_003408399.1.61979 WP_003408399.1.61986 WP_003408399.1.61987 WP_003408399.1.61998 WP_003408399.1.62021 WP_003408399.1.62087 WP_003408399.1.62089 WP_003408399.1.62101 WP_003408399.1.62104 WP_003408399.1.6211 WP_003408399.1.62132 WP_003408399.1.62162 WP_003408399.1.62225 WP_003408399.1.62238 WP_003408399.1.62249 WP_003408399.1.62270 WP_003408399.1.62281 WP_003408399.1.62307 WP_003408399.1.6231 WP_003408399.1.62359 WP_003408399.1.62360 WP_003408399.1.62371 WP_003408399.1.62379 WP_003408399.1.62395 WP_003408399.1.62408 WP_003408399.1.62468 WP_003408399.1.6248 WP_003408399.1.62508 WP_003408399.1.62565 WP_003408399.1.62594 WP_003408399.1.62606 WP_003408399.1.62616 WP_003408399.1.62687 WP_003408399.1.62715 WP_003408399.1.62730 WP_003408399.1.62738 WP_003408399.1.62761 WP_003408399.1.62766 WP_003408399.1.62786 WP_003408399.1.62813 WP_003408399.1.62839 WP_003408399.1.62909 WP_003408399.1.62936 WP_003408399.1.6294 WP_003408399.1.6295 WP_003408399.1.62962 WP_003408399.1.63007 WP_003408399.1.63019 WP_003408399.1.63032 WP_003408399.1.63037 WP_003408399.1.63064 WP_003408399.1.63066 WP_003408399.1.63072 WP_003408399.1.6308 WP_003408399.1.63081 WP_003408399.1.63096 WP_003408399.1.63106 WP_003408399.1.6314 WP_003408399.1.63144 WP_003408399.1.63154 WP_003408399.1.63160 WP_003408399.1.63161 WP_003408399.1.63166 WP_003408399.1.63194 WP_003408399.1.6322 WP_003408399.1.63222 WP_003408399.1.63247 WP_003408399.1.6328 WP_003408399.1.63291 WP_003408399.1.63317 WP_003408399.1.63331 WP_003408399.1.63373 WP_003408399.1.63384 WP_003408399.1.63403 WP_003408399.1.63424 WP_003408399.1.63428 WP_003408399.1.6345 WP_003408399.1.63464 WP_003408399.1.63483 WP_003408399.1.63502 WP_003408399.1.63504 WP_003408399.1.63522 WP_003408399.1.63538 WP_003408399.1.63564 WP_003408399.1.63567 WP_003408399.1.63596 WP_003408399.1.63600 WP_003408399.1.63623 WP_003408399.1.63624 WP_003408399.1.63625 WP_003408399.1.63627 WP_003408399.1.63654 WP_003408399.1.63662 WP_003408399.1.63711 WP_003408399.1.63734 WP_003408399.1.63807 WP_003408399.1.63819 WP_003408399.1.63844 WP_003408399.1.63888 WP_003408399.1.63913 WP_003408399.1.63915 WP_003408399.1.63918 WP_003408399.1.63961 WP_003408399.1.63970 WP_003408399.1.64000 WP_003408399.1.64027 WP_003408399.1.64058 WP_003408399.1.64065 WP_003408399.1.6407 WP_003408399.1.64082 WP_003408399.1.64091 WP_003408399.1.64102 WP_003408399.1.64104 WP_003408399.1.64119 WP_003408399.1.64219 WP_003408399.1.6422 WP_003408399.1.64222 WP_003408399.1.64223 WP_003408399.1.64228 WP_003408399.1.64235 WP_003408399.1.64249 WP_003408399.1.6427 WP_003408399.1.64278 WP_003408399.1.64414 WP_003408399.1.64419 WP_003408399.1.6443 WP_003408399.1.64463 WP_003408399.1.64480 WP_003408399.1.64497 WP_003408399.1.64506 WP_003408399.1.64513 WP_003408399.1.64514 WP_003408399.1.64515 WP_003408399.1.64522 WP_003408399.1.64526 WP_003408399.1.64543 WP_003408399.1.6456 WP_003408399.1.64567 WP_003408399.1.64588 WP_003408399.1.64589 WP_003408399.1.64594 WP_003408399.1.64595 WP_003408399.1.64608 WP_003408399.1.64619 WP_003408399.1.64629 WP_003408399.1.6464 WP_003408399.1.64664 WP_003408399.1.64669 WP_003408399.1.64672 WP_003408399.1.64680 WP_003408399.1.64682 WP_003408399.1.64727 WP_003408399.1.64729 WP_003408399.1.64774 WP_003408399.1.64776 WP_003408399.1.64802 WP_003408399.1.64832 WP_003408399.1.6486 WP_003408399.1.64870 WP_003408399.1.64898 WP_003408399.1.64922 WP_003408399.1.64924 WP_003408399.1.6493 WP_003408399.1.64937 WP_003408399.1.64941 WP_003408399.1.64966 WP_003408399.1.64973 WP_003408399.1.65001 WP_003408399.1.65026 WP_003408399.1.65053 WP_003408399.1.65070 WP_003408399.1.65079 WP_003408399.1.65102 WP_003408399.1.65157 WP_003408399.1.65181 WP_003408399.1.65212 WP_003408399.1.65229 WP_003408399.1.6523 WP_003408399.1.65253 WP_003408399.1.65289 WP_003408399.1.65291 WP_003408399.1.65315 WP_003408399.1.65329 WP_003408399.1.65359 WP_003408399.1.6536 WP_003408399.1.65374 WP_003408399.1.65386 WP_003408399.1.65414 WP_003408399.1.65416 WP_003408399.1.65433 WP_003408399.1.65455 WP_003408399.1.65467 WP_003408399.1.65488 WP_003408399.1.65529 WP_003408399.1.65539 WP_003408399.1.65583 WP_003408399.1.65612 WP_003408399.1.65635 WP_003408399.1.65637 WP_003408399.1.65648 WP_003408399.1.65683 WP_003408399.1.65686 WP_003408399.1.65688 WP_003408399.1.65707 WP_003408399.1.65733 WP_003408399.1.65746 WP_003408399.1.65747 WP_003408399.1.65759 WP_003408399.1.65816 WP_003408399.1.65830 WP_003408399.1.65858 WP_003408399.1.65862 WP_003408399.1.65869 WP_003408399.1.65929 WP_003408399.1.65958 WP_003408399.1.65974 WP_003408399.1.66004 WP_003408399.1.66013 WP_003408399.1.6606 WP_003408399.1.66149 WP_003408399.1.66151 WP_003408399.1.66229 WP_003408399.1.66276 WP_003408399.1.66293 WP_003408399.1.66297 WP_003408399.1.66323 WP_003408399.1.66325 WP_003408399.1.6633 WP_003408399.1.66334 WP_003408399.1.66355 WP_003408399.1.66367 WP_003408399.1.66394 WP_003408399.1.66396 WP_003408399.1.66451 WP_003408399.1.66455 WP_003408399.1.66457 WP_003408399.1.66460 WP_003408399.1.66464 WP_003408399.1.66466 WP_003408399.1.66487 WP_003408399.1.66504 WP_003408399.1.66558 WP_003408399.1.66580 WP_003408399.1.66582 WP_003408399.1.66612 WP_003408399.1.66615 WP_003408399.1.66617 WP_003408399.1.66635 WP_003408399.1.66656 WP_003408399.1.66663 WP_003408399.1.66675 WP_003408399.1.66715 WP_003408399.1.66718 WP_003408399.1.66762 WP_003408399.1.66776 WP_003408399.1.66808 WP_003408399.1.66817 WP_003408399.1.66819 WP_003408399.1.66826 WP_003408399.1.66830 WP_003408399.1.66868 WP_003408399.1.66878 WP_003408399.1.66880 WP_003408399.1.66893 WP_003408399.1.66961 WP_003408399.1.67005 WP_003408399.1.6704 WP_003408399.1.67044 WP_003408399.1.67061 WP_003408399.1.67089 WP_003408399.1.67098 WP_003408399.1.67146 WP_003408399.1.67170 WP_003408399.1.67197 WP_003408399.1.67198 WP_003408399.1.6720 WP_003408399.1.67207 WP_003408399.1.67218 WP_003408399.1.67220 WP_003408399.1.67225 WP_003408399.1.67231 WP_003408399.1.6724 WP_003408399.1.67257 WP_003408399.1.67298 WP_003408399.1.67307 WP_003408399.1.67324 WP_003408399.1.67332 WP_003408399.1.67346 WP_003408399.1.67354 WP_003408399.1.67360 WP_003408399.1.67381 WP_003408399.1.67396 WP_003408399.1.67417 WP_003408399.1.67422 WP_003408399.1.67453 WP_003408399.1.67459 WP_003408399.1.6746 WP_003408399.1.67473 WP_003408399.1.67481 WP_003408399.1.67482 WP_003408399.1.67496 WP_003408399.1.67499 WP_003408399.1.67516 WP_003408399.1.67523 WP_003408399.1.67536 WP_003408399.1.67575 WP_003408399.1.67598 WP_003408399.1.67600 WP_003408399.1.67602 WP_003408399.1.67692 WP_003408399.1.67744 WP_003408399.1.6775 WP_003408399.1.67750 WP_003408399.1.6777 WP_003408399.1.67809 WP_003408399.1.67816 WP_003408399.1.67844 WP_003408399.1.67848 WP_003408399.1.67870 WP_003408399.1.67888 WP_003408399.1.67915 WP_003408399.1.67945 WP_003408399.1.67949 WP_003408399.1.67980 WP_003408399.1.67982 WP_003408399.1.68029 WP_003408399.1.68037 WP_003408399.1.68038 WP_003408399.1.68045 WP_003408399.1.68057 WP_003408399.1.68083 WP_003408399.1.68088 WP_003408399.1.68106 WP_003408399.1.68164 WP_003408399.1.68169 WP_003408399.1.68193 WP_003408399.1.68212 WP_003408399.1.68227 WP_003408399.1.68243 WP_003408399.1.6825 WP_003408399.1.68297 WP_003408399.1.68309 WP_003408399.1.68325 WP_003408399.1.68329 WP_003408399.1.68340 WP_003408399.1.68384 WP_003408399.1.68388 WP_003408399.1.68429 WP_003408399.1.6843 WP_003408399.1.68433 WP_003408399.1.68444 WP_003408399.1.68465 WP_003408399.1.68484 WP_003408399.1.68518 WP_003408399.1.68569 WP_003408399.1.68576 WP_003408399.1.68586 WP_003408399.1.68623 WP_003408399.1.68624 WP_003408399.1.68637 WP_003408399.1.68646 WP_003408399.1.68667 WP_003408399.1.68669 WP_003408399.1.68672 WP_003408399.1.68684 WP_003408399.1.68704 WP_003408399.1.68708 WP_003408399.1.68730 WP_003408399.1.68734 WP_003408399.1.68748 WP_003408399.1.68754 WP_003408399.1.6876 WP_003408399.1.68761 WP_003408399.1.68763 WP_003408399.1.68766 WP_003408399.1.68774 WP_003408399.1.68796 WP_003408399.1.68824 WP_003408399.1.68832 WP_003408399.1.68833 WP_003408399.1.68841 WP_003408399.1.68859 WP_003408399.1.68876 WP_003408399.1.68906 WP_003408399.1.68916 WP_003408399.1.68923 WP_003408399.1.68945 WP_003408399.1.6896 WP_003408399.1.68981 WP_003408399.1.68984 WP_003408399.1.68997 WP_003408399.1.69008 WP_003408399.1.69076 WP_003408399.1.69079 WP_003408399.1.6908 WP_003408399.1.69082 WP_003408399.1.69178 WP_003408399.1.69181 WP_003408399.1.69208 WP_003408399.1.69231 WP_003408399.1.69256 WP_003408399.1.69311 WP_003408399.1.69315 WP_003408399.1.69322 WP_003408399.1.69342 WP_003408399.1.6935 WP_003408399.1.6936 WP_003408399.1.69374 WP_003408399.1.69398 WP_003408399.1.69401 WP_003408399.1.69426 WP_003408399.1.69427 WP_003408399.1.69429 WP_003408399.1.6949 WP_003408399.1.6951 WP_003408399.1.69511 WP_003408399.1.69526 WP_003408399.1.69528 WP_003408399.1.69547 WP_003408399.1.69573 WP_003408399.1.69581 WP_003408399.1.6960 WP_003408399.1.69617 WP_003408399.1.69634 WP_003408399.1.69647 WP_003408399.1.69659 WP_003408399.1.69673 WP_003408399.1.69682 WP_003408399.1.69684 WP_003408399.1.69686 WP_003408399.1.69707 WP_003408399.1.69709 WP_003408399.1.69723 WP_003408399.1.69736 WP_003408399.1.69778 WP_003408399.1.69800 WP_003408399.1.69802 WP_003408399.1.69845 WP_003408399.1.69870 WP_003408399.1.69873 WP_003408399.1.69898 WP_003408399.1.69913 WP_003408399.1.69925 WP_003408399.1.69931 WP_003408399.1.69938 WP_003408399.1.69955 WP_003408399.1.69957 WP_003408399.1.69981 WP_003408399.1.69990 WP_003408399.1.70 WP_003408399.1.70000 WP_003408399.1.70017 WP_003408399.1.70032 WP_003408399.1.70055 WP_003408399.1.70062 WP_003408399.1.70072 WP_003408399.1.70131 WP_003408399.1.70132 WP_003408399.1.7022 WP_003408399.1.70227 WP_003408399.1.70255 WP_003408399.1.70271 WP_003408399.1.70274 WP_003408399.1.7029 WP_003408399.1.70325 WP_003408399.1.70328 WP_003408399.1.70356 WP_003408399.1.70364 WP_003408399.1.70368 WP_003408399.1.70369 WP_003408399.1.70418 WP_003408399.1.70422 WP_003408399.1.70435 WP_003408399.1.70444 WP_003408399.1.70463 WP_003408399.1.70471 WP_003408399.1.70480 WP_003408399.1.70494 WP_003408399.1.70498 WP_003408399.1.70505 WP_003408399.1.70525 WP_003408399.1.70573 WP_003408399.1.70577 WP_003408399.1.70610 WP_003408399.1.70615 WP_003408399.1.70618 WP_003408399.1.70622 WP_003408399.1.70626 WP_003408399.1.70668 WP_003408399.1.70699 WP_003408399.1.70704 WP_003408399.1.70729 WP_003408399.1.70757 WP_003408399.1.70782 WP_003408399.1.70796 WP_003408399.1.70830 WP_003408399.1.70834 WP_003408399.1.7084 WP_003408399.1.70840 WP_003408399.1.70864 WP_003408399.1.70871 WP_003408399.1.70915 WP_003408399.1.70955 WP_003408399.1.70958 WP_003408399.1.70964 WP_003408399.1.70976 WP_003408399.1.71015 WP_003408399.1.71026 WP_003408399.1.71063 WP_003408399.1.71076 WP_003408399.1.71083 WP_003408399.1.7111 WP_003408399.1.71118 WP_003408399.1.71128 WP_003408399.1.7113 WP_003408399.1.71187 WP_003408399.1.71191 WP_003408399.1.71255 WP_003408399.1.71258 WP_003408399.1.71259 WP_003408399.1.71289 WP_003408399.1.71326 WP_003408399.1.71329 WP_003408399.1.71331 WP_003408399.1.71344 WP_003408399.1.71390 WP_003408399.1.71399 WP_003408399.1.71440 WP_003408399.1.71457 WP_003408399.1.7146 WP_003408399.1.71464 WP_003408399.1.71490 WP_003408399.1.71492 WP_003408399.1.71509 WP_003408399.1.71516 WP_003408399.1.71517 WP_003408399.1.71527 WP_003408399.1.71532 WP_003408399.1.71545 WP_003408399.1.71546 WP_003408399.1.71569 WP_003408399.1.71604 WP_003408399.1.71621 WP_003408399.1.71630 WP_003408399.1.71638 WP_003408399.1.71654 WP_003408399.1.71664 WP_003408399.1.71665 WP_003408399.1.71683 WP_003408399.1.71701 WP_003408399.1.71718 WP_003408399.1.71731 WP_003408399.1.71778 WP_003408399.1.71781 WP_003408399.1.71803 WP_003408399.1.71820 WP_003408399.1.71847 WP_003408399.1.7185 WP_003408399.1.71851 WP_003408399.1.71871 WP_003408399.1.71909 WP_003408399.1.71957 WP_003408399.1.71970 WP_003408399.1.72047 WP_003408399.1.72061 WP_003408399.1.72072 WP_003408399.1.72111 WP_003408399.1.72122 WP_003408399.1.72128 WP_003408399.1.72143 WP_003408399.1.7216 WP_003408399.1.72168 WP_003408399.1.72179 WP_003408399.1.72209 WP_003408399.1.72218 WP_003408399.1.72227 WP_003408399.1.7224 WP_003408399.1.72268 WP_003408399.1.72332 WP_003408399.1.72380 WP_003408399.1.72401 WP_003408399.1.72405 WP_003408399.1.72420 WP_003408399.1.72441 WP_003408399.1.72451 WP_003408399.1.72452 WP_003408399.1.72457 WP_003408399.1.72459 WP_003408399.1.72460 WP_003408399.1.72466 WP_003408399.1.72487 WP_003408399.1.72488 WP_003408399.1.72492 WP_003408399.1.72506 WP_003408399.1.72543 WP_003408399.1.7256 WP_003408399.1.72576 WP_003408399.1.72578 WP_003408399.1.72585 WP_003408399.1.72591 WP_003408399.1.72592 WP_003408399.1.72640 WP_003408399.1.7266 WP_003408399.1.72684 WP_003408399.1.72739 WP_003408399.1.72744 WP_003408399.1.72755 WP_003408399.1.72759 WP_003408399.1.72784 WP_003408399.1.72792 WP_003408399.1.72826 WP_003408399.1.72831 WP_003408399.1.72852 WP_003408399.1.72853 WP_003408399.1.72879 WP_003408399.1.72880 WP_003408399.1.72954 WP_003408399.1.72957 WP_003408399.1.72959 WP_003408399.1.72973 WP_003408399.1.7298 WP_003408399.1.72988 WP_003408399.1.72993 WP_003408399.1.73006 WP_003408399.1.73013 WP_003408399.1.73025 WP_003408399.1.73028 WP_003408399.1.73042 WP_003408399.1.73092 WP_003408399.1.73118 WP_003408399.1.7312 WP_003408399.1.73127 WP_003408399.1.73134 WP_003408399.1.73150 WP_003408399.1.73154 WP_003408399.1.73163 WP_003408399.1.73182 WP_003408399.1.73205 WP_003408399.1.7321 WP_003408399.1.73310 WP_003408399.1.73315 WP_003408399.1.73365 WP_003408399.1.73391 WP_003408399.1.73404 WP_003408399.1.73424 WP_003408399.1.73436 WP_003408399.1.73445 WP_003408399.1.73453 WP_003408399.1.73465 WP_003408399.1.73466 WP_003408399.1.73470 WP_003408399.1.73471 WP_003408399.1.73478 WP_003408399.1.73482 WP_003408399.1.73507 WP_003408399.1.73532 WP_003408399.1.73550 WP_003408399.1.73564 WP_003408399.1.73623 WP_003408399.1.73629 WP_003408399.1.73644 WP_003408399.1.73661 WP_003408399.1.7368 WP_003408399.1.73688 WP_003408399.1.73723 WP_003408399.1.73744 WP_003408399.1.73750 WP_003408399.1.73760 WP_003408399.1.73774 WP_003408399.1.7379 WP_003408399.1.73813 WP_003408399.1.73840 WP_003408399.1.73876 WP_003408399.1.7389 WP_003408399.1.73986 WP_003408399.1.74016 WP_003408399.1.74039 WP_003408399.1.74083 WP_003408399.1.74101 WP_003408399.1.74107 WP_003408399.1.74120 WP_003408399.1.74129 WP_003408399.1.74144 WP_003408399.1.7417 WP_003408399.1.74190 WP_003408399.1.74210 WP_003408399.1.7423 WP_003408399.1.74259 WP_003408399.1.74262 WP_003408399.1.74269 WP_003408399.1.74282 WP_003408399.1.74291 WP_003408399.1.74296 WP_003408399.1.74304 WP_003408399.1.7432 WP_003408399.1.74347 WP_003408399.1.7436 WP_003408399.1.74378 WP_003408399.1.74395 WP_003408399.1.74400 WP_003408399.1.74401 WP_003408399.1.74432 WP_003408399.1.74442 WP_003408399.1.74477 WP_003408399.1.74487 WP_003408399.1.74499 WP_003408399.1.74504 WP_003408399.1.74511 WP_003408399.1.74523 WP_003408399.1.74525 WP_003408399.1.74551 WP_003408399.1.74555 WP_003408399.1.74628 WP_003408399.1.74641 WP_003408399.1.74653 WP_003408399.1.74660 WP_003408399.1.74683 WP_003408399.1.7469 WP_003408399.1.74725 WP_003408399.1.74760 WP_003408399.1.74786 WP_003408399.1.74809 WP_003408399.1.74820 WP_003408399.1.74870 WP_003408399.1.74881 WP_003408399.1.74888 WP_003408399.1.74952 WP_003408399.1.7496 WP_003408399.1.74988 WP_003408399.1.75043 WP_003408399.1.75045 WP_003408399.1.75078 WP_003408399.1.75081 WP_003408399.1.75120 WP_003408399.1.75163 WP_003408399.1.75188 WP_003408399.1.75200 WP_003408399.1.75202 WP_003408399.1.75234 WP_003408399.1.75239 WP_003408399.1.75250 WP_003408399.1.75263 WP_003408399.1.75281 WP_003408399.1.75342 WP_003408399.1.7535 WP_003408399.1.75376 WP_003408399.1.75391 WP_003408399.1.75395 WP_003408399.1.75441 WP_003408399.1.75510 WP_003408399.1.75581 WP_003408399.1.75598 WP_003408399.1.75635 WP_003408399.1.75645 WP_003408399.1.75665 WP_003408399.1.75671 WP_003408399.1.75741 WP_003408399.1.75749 WP_003408399.1.75772 WP_003408399.1.75774 WP_003408399.1.75811 WP_003408399.1.75833 WP_003408399.1.7585 WP_003408399.1.75868 WP_003408399.1.75878 WP_003408399.1.75927 WP_003408399.1.75946 WP_003408399.1.75968 WP_003408399.1.75974 WP_003408399.1.76007 WP_003408399.1.76016 WP_003408399.1.76032 WP_003408399.1.76037 WP_003408399.1.7604 WP_003408399.1.76045 WP_003408399.1.76052 WP_003408399.1.76058 WP_003408399.1.76064 WP_003408399.1.76110 WP_003408399.1.76126 WP_003408399.1.76138 WP_003408399.1.76157 WP_003408399.1.76172 WP_003408399.1.76177 WP_003408399.1.76183 WP_003408399.1.76239 WP_003408399.1.76272 WP_003408399.1.76277 WP_003408399.1.76280 WP_003408399.1.76281 WP_003408399.1.76291 WP_003408399.1.76297 WP_003408399.1.76360 WP_003408399.1.76379 WP_003408399.1.76403 WP_003408399.1.76414 WP_003408399.1.76427 WP_003408399.1.76436 WP_003408399.1.76442 WP_003408399.1.76443 WP_003408399.1.76456 WP_003408399.1.76521 WP_003408399.1.76533 WP_003408399.1.76616 WP_003408399.1.76625 WP_003408399.1.76629 WP_003408399.1.76635 WP_003408399.1.76638 WP_003408399.1.76639 WP_003408399.1.76640 WP_003408399.1.76644 WP_003408399.1.76677 WP_003408399.1.76678 WP_003408399.1.76679 WP_003408399.1.76734 WP_003408399.1.76744 WP_003408399.1.76750 WP_003408399.1.76754 WP_003408399.1.76757 WP_003408399.1.76781 WP_003408399.1.76818 WP_003408399.1.76824 WP_003408399.1.76835 WP_003408399.1.76873 WP_003408399.1.76888 WP_003408399.1.76900 WP_003408399.1.7691 WP_003408399.1.76947 WP_003408399.1.76954 WP_003408399.1.76955 WP_003408399.1.76963 WP_003408399.1.76976 WP_003408399.1.770 WP_003408399.1.77000 WP_003408399.1.77008 WP_003408399.1.77021 WP_003408399.1.77056 WP_003408399.1.77065 WP_003408399.1.77075 WP_003408399.1.77093 WP_003408399.1.77107 WP_003408399.1.77115 WP_003408399.1.77118 WP_003408399.1.77125 WP_003408399.1.77141 WP_003408399.1.77142 WP_003408399.1.77166 WP_003408399.1.77250 WP_003408399.1.77252 WP_003408399.1.77260 WP_003408399.1.77266 WP_003408399.1.77280 WP_003408399.1.77285 WP_003408399.1.77312 WP_003408399.1.77348 WP_003408399.1.77351 WP_003408399.1.77352 WP_003408399.1.77361 WP_003408399.1.774 WP_003408399.1.7740 WP_003408399.1.77404 WP_003408399.1.77425 WP_003408399.1.77463 WP_003408399.1.77474 WP_003408399.1.7748 WP_003408399.1.77491 WP_003408399.1.77499 WP_003408399.1.77510 WP_003408399.1.77530 WP_003408399.1.77554 WP_003408399.1.77599 WP_003408399.1.77605 WP_003408399.1.7762 WP_003408399.1.77627 WP_003408399.1.77649 WP_003408399.1.77654 WP_003408399.1.7766 WP_003408399.1.77667 WP_003408399.1.77704 WP_003408399.1.77706 WP_003408399.1.77726 WP_003408399.1.77774 WP_003408399.1.7778 WP_003408399.1.77790 WP_003408399.1.77809 WP_003408399.1.77820 WP_003408399.1.77843 WP_003408399.1.77855 WP_003408399.1.77865 WP_003408399.1.77868 WP_003408399.1.77879 WP_003408399.1.77909 WP_003408399.1.77911 WP_003408399.1.77931 WP_003408399.1.77984 WP_003408399.1.78020 WP_003408399.1.78024 WP_003408399.1.78075 WP_003408399.1.78084 WP_003408399.1.78086 WP_003408399.1.7809 WP_003408399.1.78098 WP_003408399.1.78105 WP_003408399.1.78113 WP_003408399.1.78136 WP_003408399.1.78162 WP_003408399.1.7817 WP_003408399.1.78200 WP_003408399.1.78216 WP_003408399.1.78236 WP_003408399.1.78238 WP_003408399.1.78322 WP_003408399.1.78338 WP_003408399.1.7836 WP_003408399.1.78360 WP_003408399.1.78386 WP_003408399.1.78429 WP_003408399.1.78435 WP_003408399.1.78459 WP_003408399.1.78488 WP_003408399.1.7849 WP_003408399.1.78499 WP_003408399.1.785 WP_003408399.1.78516 WP_003408399.1.78524 WP_003408399.1.78526 WP_003408399.1.78544 WP_003408399.1.78545 WP_003408399.1.78547 WP_003408399.1.78574 WP_003408399.1.78580 WP_003408399.1.7860 WP_003408399.1.78620 WP_003408399.1.78646 WP_003408399.1.78648 WP_003408399.1.78649 WP_003408399.1.78655 WP_003408399.1.78657 WP_003408399.1.78659 WP_003408399.1.7869 WP_003408399.1.78692 WP_003408399.1.78760 WP_003408399.1.78766 WP_003408399.1.78776 WP_003408399.1.78778 WP_003408399.1.78784 WP_003408399.1.78788 WP_003408399.1.78790 WP_003408399.1.78793 WP_003408399.1.78848 WP_003408399.1.78860 WP_003408399.1.7887 WP_003408399.1.78884 WP_003408399.1.78932 WP_003408399.1.78969 WP_003408399.1.78977 WP_003408399.1.78980 WP_003408399.1.79005 WP_003408399.1.79016 WP_003408399.1.79033 WP_003408399.1.79064 WP_003408399.1.79066 WP_003408399.1.79068 WP_003408399.1.79077 WP_003408399.1.79112 WP_003408399.1.79122 WP_003408399.1.79145 WP_003408399.1.79152 WP_003408399.1.79163 WP_003408399.1.79182 WP_003408399.1.79198 WP_003408399.1.79213 WP_003408399.1.79218 WP_003408399.1.79268 WP_003408399.1.79273 WP_003408399.1.79290 WP_003408399.1.79319 WP_003408399.1.79326 WP_003408399.1.79330 WP_003408399.1.79339 WP_003408399.1.79394 WP_003408399.1.79399 WP_003408399.1.79413 WP_003408399.1.79422 WP_003408399.1.79445 WP_003408399.1.79447 WP_003408399.1.79455 WP_003408399.1.79471 WP_003408399.1.79480 WP_003408399.1.79482 WP_003408399.1.79488 WP_003408399.1.79500 WP_003408399.1.79502 WP_003408399.1.79508 WP_003408399.1.79514 WP_003408399.1.79561 WP_003408399.1.79565 WP_003408399.1.79578 WP_003408399.1.79588 WP_003408399.1.79598 WP_003408399.1.79615 WP_003408399.1.79684 WP_003408399.1.79698 WP_003408399.1.797 WP_003408399.1.79744 WP_003408399.1.79784 WP_003408399.1.79802 WP_003408399.1.79806 WP_003408399.1.79819 WP_003408399.1.79826 WP_003408399.1.79828 WP_003408399.1.79851 WP_003408399.1.79853 WP_003408399.1.79863 WP_003408399.1.79881 WP_003408399.1.79885 WP_003408399.1.7990 WP_003408399.1.79913 WP_003408399.1.79918 WP_003408399.1.79947 WP_003408399.1.79948 WP_003408399.1.7995 WP_003408399.1.7997 WP_003408399.1.80004 WP_003408399.1.80015 WP_003408399.1.80022 WP_003408399.1.80030 WP_003408399.1.80054 WP_003408399.1.80084 WP_003408399.1.80099 WP_003408399.1.80129 WP_003408399.1.80177 WP_003408399.1.80234 WP_003408399.1.8026 WP_003408399.1.80275 WP_003408399.1.8029 WP_003408399.1.80299 WP_003408399.1.80300 WP_003408399.1.80304 WP_003408399.1.80326 WP_003408399.1.80351 WP_003408399.1.8037 WP_003408399.1.80370 WP_003408399.1.80387 WP_003408399.1.80399 WP_003408399.1.8044 WP_003408399.1.80451 WP_003408399.1.80458 WP_003408399.1.80461 WP_003408399.1.80490 WP_003408399.1.80503 WP_003408399.1.80507 WP_003408399.1.80552 WP_003408399.1.80576 WP_003408399.1.80588 WP_003408399.1.80599 WP_003408399.1.8060 WP_003408399.1.80624 WP_003408399.1.80636 WP_003408399.1.80669 WP_003408399.1.80673 WP_003408399.1.80711 WP_003408399.1.80714 WP_003408399.1.80743 WP_003408399.1.80784 WP_003408399.1.80815 WP_003408399.1.80853 WP_003408399.1.80918 WP_003408399.1.8093 WP_003408399.1.80967 WP_003408399.1.8097 WP_003408399.1.80988 WP_003408399.1.81007 WP_003408399.1.81013 WP_003408399.1.8105 WP_003408399.1.81059 WP_003408399.1.81063 WP_003408399.1.81066 WP_003408399.1.81075 WP_003408399.1.81091 WP_003408399.1.81119 WP_003408399.1.81125 WP_003408399.1.81136 WP_003408399.1.8114 WP_003408399.1.81189 WP_003408399.1.81192 WP_003408399.1.81230 WP_003408399.1.81249 WP_003408399.1.81250 WP_003408399.1.8128 WP_003408399.1.81287 WP_003408399.1.81297 WP_003408399.1.8138 WP_003408399.1.81407 WP_003408399.1.8143 WP_003408399.1.81439 WP_003408399.1.81465 WP_003408399.1.81505 WP_003408399.1.81529 WP_003408399.1.81538 WP_003408399.1.81541 WP_003408399.1.81560 WP_003408399.1.81561 WP_003408399.1.81567 WP_003408399.1.81583 WP_003408399.1.81712 WP_003408399.1.81720 WP_003408399.1.81731 WP_003408399.1.81774 WP_003408399.1.81788 WP_003408399.1.81809 WP_003408399.1.81820 WP_003408399.1.81850 WP_003408399.1.81883 WP_003408399.1.81891 WP_003408399.1.81911 WP_003408399.1.81918 WP_003408399.1.82011 WP_003408399.1.82048 WP_003408399.1.82069 WP_003408399.1.82071 WP_003408399.1.82108 WP_003408399.1.82136 WP_003408399.1.82142 WP_003408399.1.8215 WP_003408399.1.82158 WP_003408399.1.8217 WP_003408399.1.82209 WP_003408399.1.82210 WP_003408399.1.82228 WP_003408399.1.82236 WP_003408399.1.82251 WP_003408399.1.82271 WP_003408399.1.82305 WP_003408399.1.82307 WP_003408399.1.82309 WP_003408399.1.82317 WP_003408399.1.8232 WP_003408399.1.82346 WP_003408399.1.82374 WP_003408399.1.82385 WP_003408399.1.82429 WP_003408399.1.82460 WP_003408399.1.82462 WP_003408399.1.82483 WP_003408399.1.82494 WP_003408399.1.82531 WP_003408399.1.82546 WP_003408399.1.82547 WP_003408399.1.82549 WP_003408399.1.82577 WP_003408399.1.82592 WP_003408399.1.82597 WP_003408399.1.82598 WP_003408399.1.82625 WP_003408399.1.82642 WP_003408399.1.82651 WP_003408399.1.82653 WP_003408399.1.82681 WP_003408399.1.82685 WP_003408399.1.8271 WP_003408399.1.82712 WP_003408399.1.8273 WP_003408399.1.82743 WP_003408399.1.82757 WP_003408399.1.82774 WP_003408399.1.82803 WP_003408399.1.82836 WP_003408399.1.82860 WP_003408399.1.82892 WP_003408399.1.82935 WP_003408399.1.82957 WP_003408399.1.82973 WP_003408399.1.82981 WP_003408399.1.82983 WP_003408399.1.83004 WP_003408399.1.83009 WP_003408399.1.83044 WP_003408399.1.83065 WP_003408399.1.83074 WP_003408399.1.83110 WP_003408399.1.83146 WP_003408399.1.83149 WP_003408399.1.83159 WP_003408399.1.8317 WP_003408399.1.83173 WP_003408399.1.83181 WP_003408399.1.83182 WP_003408399.1.83191 WP_003408399.1.83197 WP_003408399.1.83212 WP_003408399.1.8326 WP_003408399.1.83262 WP_003408399.1.83268 WP_003408399.1.83273 WP_003408399.1.83309 WP_003408399.1.83332 WP_003408399.1.83334 WP_003408399.1.83341 WP_003408399.1.83349 WP_003408399.1.8335 WP_003408399.1.83353 WP_003408399.1.83367 WP_003408399.1.83380 WP_003408399.1.83381 WP_003408399.1.83389 WP_003408399.1.83408 WP_003408399.1.83409 WP_003408399.1.83435 WP_003408399.1.83470 WP_003408399.1.83524 WP_003408399.1.83526 WP_003408399.1.8358 WP_003408399.1.83589 WP_003408399.1.83601 WP_003408399.1.83638 WP_003408399.1.83648 WP_003408399.1.83656 WP_003408399.1.83667 WP_003408399.1.83692 WP_003408399.1.83704 WP_003408399.1.83705 WP_003408399.1.83766 WP_003408399.1.83793 WP_003408399.1.83794 WP_003408399.1.83802 WP_003408399.1.83805 WP_003408399.1.83839 WP_003408399.1.83842 WP_003408399.1.83850 WP_003408399.1.83861 WP_003408399.1.83884 WP_003408399.1.83920 WP_003408399.1.83929 WP_003408399.1.83930 WP_003408399.1.83975 WP_003408399.1.83991 WP_003408399.1.8400 WP_003408399.1.84027 WP_003408399.1.8404 WP_003408399.1.84057 WP_003408399.1.84070 WP_003408399.1.8409 WP_003408399.1.84112 WP_003408399.1.84146 WP_003408399.1.8415 WP_003408399.1.84176 WP_003408399.1.84186 WP_003408399.1.84192 WP_003408399.1.8424 WP_003408399.1.84244 WP_003408399.1.84259 WP_003408399.1.8426 WP_003408399.1.84277 WP_003408399.1.84287 WP_003408399.1.8434 WP_003408399.1.84388 WP_003408399.1.84408 WP_003408399.1.84409 WP_003408399.1.84438 WP_003408399.1.84460 WP_003408399.1.84488 WP_003408399.1.84504 WP_003408399.1.84525 WP_003408399.1.84620 WP_003408399.1.84623 WP_003408399.1.84641 WP_003408399.1.84655 WP_003408399.1.84666 WP_003408399.1.84670 WP_003408399.1.84739 WP_003408399.1.84748 WP_003408399.1.84766 WP_003408399.1.84772 WP_003408399.1.84774 WP_003408399.1.848 WP_003408399.1.84812 WP_003408399.1.84836 WP_003408399.1.84839 WP_003408399.1.84846 WP_003408399.1.84873 WP_003408399.1.84911 WP_003408399.1.84938 WP_003408399.1.84968 WP_003408399.1.84973 WP_003408399.1.84985 WP_003408399.1.8503 WP_003408399.1.85038 WP_003408399.1.85041 WP_003408399.1.85043 WP_003408399.1.8505 WP_003408399.1.85074 WP_003408399.1.8509 WP_003408399.1.8512 WP_003408399.1.85148 WP_003408399.1.8518 WP_003408399.1.8522 WP_003408399.1.85242 WP_003408399.1.85276 WP_003408399.1.85281 WP_003408399.1.85284 WP_003408399.1.85314 WP_003408399.1.85319 WP_003408399.1.85330 WP_003408399.1.85341 WP_003408399.1.85346 WP_003408399.1.8535 WP_003408399.1.85363 WP_003408399.1.85371 WP_003408399.1.85377 WP_003408399.1.85387 WP_003408399.1.85399 WP_003408399.1.85458 WP_003408399.1.8546 WP_003408399.1.85464 WP_003408399.1.85478 WP_003408399.1.85480 WP_003408399.1.85488 WP_003408399.1.85495 WP_003408399.1.85551 WP_003408399.1.85557 WP_003408399.1.85577 WP_003408399.1.85597 WP_003408399.1.85599 WP_003408399.1.85610 WP_003408399.1.8563 WP_003408399.1.85648 WP_003408399.1.85679 WP_003408399.1.85704 WP_003408399.1.85727 WP_003408399.1.85737 WP_003408399.1.85808 WP_003408399.1.85819 WP_003408399.1.85820 WP_003408399.1.85823 WP_003408399.1.8586 WP_003408399.1.85872 WP_003408399.1.85894 WP_003408399.1.85913 WP_003408399.1.85953 WP_003408399.1.85986 WP_003408399.1.86024 WP_003408399.1.86025 WP_003408399.1.86032 WP_003408399.1.86048 WP_003408399.1.86052 WP_003408399.1.86067 WP_003408399.1.86103 WP_003408399.1.86122 WP_003408399.1.86124 WP_003408399.1.86160 WP_003408399.1.86164 WP_003408399.1.86168 WP_003408399.1.86190 WP_003408399.1.86204 WP_003408399.1.86208 WP_003408399.1.86235 WP_003408399.1.86249 WP_003408399.1.86260 WP_003408399.1.86290 WP_003408399.1.863 WP_003408399.1.86327 WP_003408399.1.86334 WP_003408399.1.86337 WP_003408399.1.86368 WP_003408399.1.86377 WP_003408399.1.86425 WP_003408399.1.86459 WP_003408399.1.8649 WP_003408399.1.86499 WP_003408399.1.86520 WP_003408399.1.86561 WP_003408399.1.86568 WP_003408399.1.86575 WP_003408399.1.86584 WP_003408399.1.86605 WP_003408399.1.86626 WP_003408399.1.86648 WP_003408399.1.8666 WP_003408399.1.86684 WP_003408399.1.86696 WP_003408399.1.86705 WP_003408399.1.86718 WP_003408399.1.86725 WP_003408399.1.86757 WP_003408399.1.86766 WP_003408399.1.86801 WP_003408399.1.86814 WP_003408399.1.86820 WP_003408399.1.86825 WP_003408399.1.86834 WP_003408399.1.8685 WP_003408399.1.86851 WP_003408399.1.86867 WP_003408399.1.86877 WP_003408399.1.86883 WP_003408399.1.8689 WP_003408399.1.86892 WP_003408399.1.86933 WP_003408399.1.86941 WP_003408399.1.86950 WP_003408399.1.86962 WP_003408399.1.86963 WP_003408399.1.86979 WP_003408399.1.8700 WP_003408399.1.87001 WP_003408399.1.87002 WP_003408399.1.87031 WP_003408399.1.87116 WP_003408399.1.87117 WP_003408399.1.8714 WP_003408399.1.87162 WP_003408399.1.87178 WP_003408399.1.87191 WP_003408399.1.87201 WP_003408399.1.87209 WP_003408399.1.87240 WP_003408399.1.87266 WP_003408399.1.87273 WP_003408399.1.87275 WP_003408399.1.8733 WP_003408399.1.87345 WP_003408399.1.87369 WP_003408399.1.8737 WP_003408399.1.87401 WP_003408399.1.87404 WP_003408399.1.87406 WP_003408399.1.87409 WP_003408399.1.87444 WP_003408399.1.87446 WP_003408399.1.87459 WP_003408399.1.87472 WP_003408399.1.87489 WP_003408399.1.87494 WP_003408399.1.87496 WP_003408399.1.87582 WP_003408399.1.87588 WP_003408399.1.87619 WP_003408399.1.87620 WP_003408399.1.87634 WP_003408399.1.87643 WP_003408399.1.8765 WP_003408399.1.87650 WP_003408399.1.87654 WP_003408399.1.87658 WP_003408399.1.87665 WP_003408399.1.87676 WP_003408399.1.87677 WP_003408399.1.87684 WP_003408399.1.87692 WP_003408399.1.87707 WP_003408399.1.87732 WP_003408399.1.87784 WP_003408399.1.87796 WP_003408399.1.87809 WP_003408399.1.87817 WP_003408399.1.87827 WP_003408399.1.87831 WP_003408399.1.87835 WP_003408399.1.87837 WP_003408399.1.87866 WP_003408399.1.8789 WP_003408399.1.87911 WP_003408399.1.87924 WP_003408399.1.87951 WP_003408399.1.87955 WP_003408399.1.87956 WP_003408399.1.87991 WP_003408399.1.88 WP_003408399.1.88002 WP_003408399.1.88037 WP_003408399.1.88039 WP_003408399.1.88072 WP_003408399.1.88077 WP_003408399.1.88121 WP_003408399.1.88180 WP_003408399.1.88205 WP_003408399.1.88217 WP_003408399.1.88219 WP_003408399.1.88245 WP_003408399.1.88253 WP_003408399.1.88294 WP_003408399.1.88315 WP_003408399.1.88316 WP_003408399.1.88320 WP_003408399.1.88338 WP_003408399.1.8840 WP_003408399.1.88437 WP_003408399.1.88453 WP_003408399.1.88469 WP_003408399.1.88489 WP_003408399.1.88507 WP_003408399.1.88521 WP_003408399.1.88530 WP_003408399.1.88537 WP_003408399.1.88541 WP_003408399.1.88592 WP_003408399.1.88616 WP_003408399.1.88618 WP_003408399.1.8862 WP_003408399.1.88625 WP_003408399.1.88632 WP_003408399.1.88634 WP_003408399.1.88649 WP_003408399.1.8870 WP_003408399.1.88737 WP_003408399.1.888 WP_003408399.1.88824 WP_003408399.1.88886 WP_003408399.1.88965 WP_003408399.1.88985 WP_003408399.1.8902 WP_003408399.1.89025 WP_003408399.1.89041 WP_003408399.1.89046 WP_003408399.1.89082 WP_003408399.1.89162 WP_003408399.1.89168 WP_003408399.1.8917 WP_003408399.1.89193 WP_003408399.1.89205 WP_003408399.1.89207 WP_003408399.1.89225 WP_003408399.1.8925 WP_003408399.1.89277 WP_003408399.1.89286 WP_003408399.1.89293 WP_003408399.1.89320 WP_003408399.1.89371 WP_003408399.1.89378 WP_003408399.1.89392 WP_003408399.1.89406 WP_003408399.1.8943 WP_003408399.1.89451 WP_003408399.1.89453 WP_003408399.1.89473 WP_003408399.1.89475 WP_003408399.1.89483 WP_003408399.1.895 WP_003408399.1.89513 WP_003408399.1.89517 WP_003408399.1.89522 WP_003408399.1.8954 WP_003408399.1.89543 WP_003408399.1.89567 WP_003408399.1.8957 WP_003408399.1.89572 WP_003408399.1.89589 WP_003408399.1.89607 WP_003408399.1.89613 WP_003408399.1.89625 WP_003408399.1.89648 WP_003408399.1.8967 WP_003408399.1.89670 WP_003408399.1.89676 WP_003408399.1.89729 WP_003408399.1.89739 WP_003408399.1.89762 WP_003408399.1.8977 WP_003408399.1.89808 WP_003408399.1.8982 WP_003408399.1.89829 WP_003408399.1.89831 WP_003408399.1.89844 WP_003408399.1.89849 WP_003408399.1.8989 WP_003408399.1.89901 WP_003408399.1.89903 WP_003408399.1.89909 WP_003408399.1.8992 WP_003408399.1.89922 WP_003408399.1.89926 WP_003408399.1.89963 WP_003408399.1.89971 WP_003408399.1.8998 WP_003408399.1.89987 WP_003408399.1.900 WP_003408399.1.90048 WP_003408399.1.9007 WP_003408399.1.90080 WP_003408399.1.90130 WP_003408399.1.90134 WP_003408399.1.90137 WP_003408399.1.90157 WP_003408399.1.90184 WP_003408399.1.90199 WP_003408399.1.90231 WP_003408399.1.90245 WP_003408399.1.90308 WP_003408399.1.90322 WP_003408399.1.90328 WP_003408399.1.90372 WP_003408399.1.90439 WP_003408399.1.90481 WP_003408399.1.90499 WP_003408399.1.9050 WP_003408399.1.90550 WP_003408399.1.90560 WP_003408399.1.90612 WP_003408399.1.90640 WP_003408399.1.90672 WP_003408399.1.90691 WP_003408399.1.90711 WP_003408399.1.90722 WP_003408399.1.90744 WP_003408399.1.9075 WP_003408399.1.90756 WP_003408399.1.90767 WP_003408399.1.90771 WP_003408399.1.90785 WP_003408399.1.90788 WP_003408399.1.90800 WP_003408399.1.90810 WP_003408399.1.90816 WP_003408399.1.90819 WP_003408399.1.9082 WP_003408399.1.90884 WP_003408399.1.90899 WP_003408399.1.90906 WP_003408399.1.90958 WP_003408399.1.90976 WP_003408399.1.90977 WP_003408399.1.90987 WP_003408399.1.9102 WP_003408399.1.91026 WP_003408399.1.91043 WP_003408399.1.91053 WP_003408399.1.91082 WP_003408399.1.91106 WP_003408399.1.91112 WP_003408399.1.91144 WP_003408399.1.91157 WP_003408399.1.91167 WP_003408399.1.91169 WP_003408399.1.91192 WP_003408399.1.91201 WP_003408399.1.91207 WP_003408399.1.91208 WP_003408399.1.91211 WP_003408399.1.91214 WP_003408399.1.91230 WP_003408399.1.91244 WP_003408399.1.91251 WP_003408399.1.91260 WP_003408399.1.91265 WP_003408399.1.9128 WP_003408399.1.91284 WP_003408399.1.91294 WP_003408399.1.91303 WP_003408399.1.91322 WP_003408399.1.91352 WP_003408399.1.91386 WP_003408399.1.9139 WP_003408399.1.91398 WP_003408399.1.91411 WP_003408399.1.91430 WP_003408399.1.91436 WP_003408399.1.91483 WP_003408399.1.91496 WP_003408399.1.91508 WP_003408399.1.91576 WP_003408399.1.91589 WP_003408399.1.91694 WP_003408399.1.91695 WP_003408399.1.91713 WP_003408399.1.91716 WP_003408399.1.91717 WP_003408399.1.91728 WP_003408399.1.91743 WP_003408399.1.91759 WP_003408399.1.91784 WP_003408399.1.91786 WP_003408399.1.91802 WP_003408399.1.91822 WP_003408399.1.91828 WP_003408399.1.9189 WP_003408399.1.91896 WP_003408399.1.9190 WP_003408399.1.91915 WP_003408399.1.91937 WP_003408399.1.91944 WP_003408399.1.91953 WP_003408399.1.91957 WP_003408399.1.91978 WP_003408399.1.92021 WP_003408399.1.92083 WP_003408399.1.92127 WP_003408399.1.92144 WP_003408399.1.92150 WP_003408399.1.92153 WP_003408399.1.92190 WP_003408399.1.92192 WP_003408399.1.92200 WP_003408399.1.92221 WP_003408399.1.92222 WP_003408399.1.92273 WP_003408399.1.92289 WP_003408399.1.9229 WP_003408399.1.92294 WP_003408399.1.92300 WP_003408399.1.92317 WP_003408399.1.92334 WP_003408399.1.92338 WP_003408399.1.92345 WP_003408399.1.92364 WP_003408399.1.92380 WP_003408399.1.92416 WP_003408399.1.92428 WP_003408399.1.92447 WP_003408399.1.92456 WP_003408399.1.92467 WP_003408399.1.92471 WP_003408399.1.92490 WP_003408399.1.92508 WP_003408399.1.9251 WP_003408399.1.92511 WP_003408399.1.92523 WP_003408399.1.92536 WP_003408399.1.92592 WP_003408399.1.92597 WP_003408399.1.92603 WP_003408399.1.92606 WP_003408399.1.92610 WP_003408399.1.92613 WP_003408399.1.9263 WP_003408399.1.9265 WP_003408399.1.92650 WP_003408399.1.92660 WP_003408399.1.92677 WP_003408399.1.92685 WP_003408399.1.92689 WP_003408399.1.92690 WP_003408399.1.92706 WP_003408399.1.92714 WP_003408399.1.92736 WP_003408399.1.9274 WP_003408399.1.92752 WP_003408399.1.92777 WP_003408399.1.92803 WP_003408399.1.92833 WP_003408399.1.92856 WP_003408399.1.92881 WP_003408399.1.92892 WP_003408399.1.92907 WP_003408399.1.92908 WP_003408399.1.9291 WP_003408399.1.92917 WP_003408399.1.92996 WP_003408399.1.93006 WP_003408399.1.93008 WP_003408399.1.93009 WP_003408399.1.93015 WP_003408399.1.93043 WP_003408399.1.9307 WP_003408399.1.93083 WP_003408399.1.93097 WP_003408399.1.93137 WP_003408399.1.93192 WP_003408399.1.93199 WP_003408399.1.93203 WP_003408399.1.93212 WP_003408399.1.93234 WP_003408399.1.93245 WP_003408399.1.93257 WP_003408399.1.93265 WP_003408399.1.93297 WP_003408399.1.93320 WP_003408399.1.93328 WP_003408399.1.93337 WP_003408399.1.93343 WP_003408399.1.93349 WP_003408399.1.93363 WP_003408399.1.93377 WP_003408399.1.9338 WP_003408399.1.93407 WP_003408399.1.93417 WP_003408399.1.93419 WP_003408399.1.93426 WP_003408399.1.9344 WP_003408399.1.93443 WP_003408399.1.93447 WP_003408399.1.93470 WP_003408399.1.93483 WP_003408399.1.93487 WP_003408399.1.93495 WP_003408399.1.93499 WP_003408399.1.93516 WP_003408399.1.93536 WP_003408399.1.93544 WP_003408399.1.93555 WP_003408399.1.93560 WP_003408399.1.93564 WP_003408399.1.9357 WP_003408399.1.93573 WP_003408399.1.93576 WP_003408399.1.93588 WP_003408399.1.9363 WP_003408399.1.93645 WP_003408399.1.93649 WP_003408399.1.93659 WP_003408399.1.93677 WP_003408399.1.9368 WP_003408399.1.93689 WP_003408399.1.93693 WP_003408399.1.93698 WP_003408399.1.93706 WP_003408399.1.9371 WP_003408399.1.93792 WP_003408399.1.93823 WP_003408399.1.93871 WP_003408399.1.9388 WP_003408399.1.93894 WP_003408399.1.93903 WP_003408399.1.93907 WP_003408399.1.93913 WP_003408399.1.93946 WP_003408399.1.93950 WP_003408399.1.93953 WP_003408399.1.93954 WP_003408399.1.93988 WP_003408399.1.9407 WP_003408399.1.94143 WP_003408399.1.94154 WP_003408399.1.94184 WP_003408399.1.94204 WP_003408399.1.94205 WP_003408399.1.94226 WP_003408399.1.94231 WP_003408399.1.94256 WP_003408399.1.94261 WP_003408399.1.94281 WP_003408399.1.94292 WP_003408399.1.94297 WP_003408399.1.9431 WP_003408399.1.94326 WP_003408399.1.94339 WP_003408399.1.94392 WP_003408399.1.94416 WP_003408399.1.94421 WP_003408399.1.94456 WP_003408399.1.94470 WP_003408399.1.94480 WP_003408399.1.94495 WP_003408399.1.94511 WP_003408399.1.94512 WP_003408399.1.94525 WP_003408399.1.94528 WP_003408399.1.94564 WP_003408399.1.94602 WP_003408399.1.94623 WP_003408399.1.9465 WP_003408399.1.94673 WP_003408399.1.94714 WP_003408399.1.94730 WP_003408399.1.94776 WP_003408399.1.9478 WP_003408399.1.94834 WP_003408399.1.94872 WP_003408399.1.9488 WP_003408399.1.94902 WP_003408399.1.94916 WP_003408399.1.94979 WP_003408399.1.94994 WP_003408399.1.94996 WP_003408399.1.94998 WP_003408399.1.95007 WP_003408399.1.95015 WP_003408399.1.95034 WP_003408399.1.95068 WP_003408399.1.95081 WP_003408399.1.95082 WP_003408399.1.95096 WP_003408399.1.95112 WP_003408399.1.95138 WP_003408399.1.9514 WP_003408399.1.95179 WP_003408399.1.95188 WP_003408399.1.95190 WP_003408399.1.95234 WP_003408399.1.95241 WP_003408399.1.95245 WP_003408399.1.95257 WP_003408399.1.95279 WP_003408399.1.9531 WP_003408399.1.95335 WP_003408399.1.9535 WP_003408399.1.95370 WP_003408399.1.95392 WP_003408399.1.95416 WP_003408399.1.95417 WP_003408399.1.95454 WP_003408399.1.95455 WP_003408399.1.95491 WP_003408399.1.95508 WP_003408399.1.95509 WP_003408399.1.95529 WP_003408399.1.95556 WP_003408399.1.95565 WP_003408399.1.95578 WP_003408399.1.95580 WP_003408399.1.95585 WP_003408399.1.95643 WP_003408399.1.95679 WP_003408399.1.95685 WP_003408399.1.957 WP_003408399.1.95724 WP_003408399.1.95727 WP_003408399.1.95730 WP_003408399.1.95735 WP_003408399.1.95758 WP_003408399.1.95772 WP_003408399.1.95797 WP_003408399.1.95839 WP_003408399.1.9585 WP_003408399.1.9590 WP_003408399.1.95902 WP_003408399.1.95908 WP_003408399.1.95924 WP_003408399.1.95926 WP_003408399.1.95953 WP_003408399.1.95958 WP_003408399.1.95964 WP_003408399.1.95973 WP_003408399.1.96006 WP_003408399.1.9602 WP_003408399.1.96036 WP_003408399.1.96062 WP_003408399.1.96065 WP_003408399.1.96098 WP_003408399.1.96166 WP_003408399.1.96171 WP_003408399.1.96204 WP_003408399.1.96230 WP_003408399.1.96235 WP_003408399.1.96242 WP_003408399.1.96245 WP_003408399.1.96254 WP_003408399.1.96259 WP_003408399.1.96313 WP_003408399.1.96318 WP_003408399.1.96345 WP_003408399.1.96360 WP_003408399.1.96373 WP_003408399.1.96456 WP_003408399.1.96486 WP_003408399.1.96569 WP_003408399.1.96573 WP_003408399.1.96575 WP_003408399.1.96576 WP_003408399.1.96611 WP_003408399.1.96621 WP_003408399.1.9667 WP_003408399.1.96681 WP_003408399.1.96726 WP_003408399.1.96733 WP_003408399.1.96742 WP_003408399.1.96754 WP_003408399.1.9678 WP_003408399.1.96832 WP_003408399.1.9685 WP_003408399.1.97008 WP_003408399.1.97009 WP_003408399.1.97056 WP_003408399.1.97084 WP_003408399.1.97087 WP_003408399.1.97094 WP_003408399.1.97096 WP_003408399.1.97099 WP_003408399.1.97108 WP_003408399.1.97113 WP_003408399.1.97122 WP_003408399.1.97127 WP_003408399.1.97129 WP_003408399.1.97136 WP_003408399.1.9716 WP_003408399.1.97176 WP_003408399.1.97222 WP_003408399.1.97223 WP_003408399.1.97237 WP_003408399.1.97242 WP_003408399.1.97270 WP_003408399.1.97283 WP_003408399.1.97296 WP_003408399.1.97321 WP_003408399.1.97330 WP_003408399.1.97366 WP_003408399.1.97376 WP_003408399.1.97380 WP_003408399.1.9739 WP_003408399.1.97462 WP_003408399.1.97517 WP_003408399.1.97519 WP_003408399.1.97535 WP_003408399.1.97540 WP_003408399.1.97546 WP_003408399.1.97550 WP_003408399.1.97568 WP_003408399.1.97577 WP_003408399.1.97584 WP_003408399.1.9759 WP_003408399.1.97591 WP_003408399.1.97596 WP_003408399.1.97609 WP_003408399.1.97618 WP_003408399.1.9763 WP_003408399.1.97669 WP_003408399.1.97673 WP_003408399.1.97700 WP_003408399.1.97701 WP_003408399.1.9773 WP_003408399.1.97730 WP_003408399.1.97740 WP_003408399.1.97751 WP_003408399.1.97754 WP_003408399.1.97797 WP_003408399.1.9782 WP_003408399.1.9784 WP_003408399.1.97888 WP_003408399.1.9795 WP_003408399.1.97951 WP_003408399.1.97958 WP_003408399.1.97966 WP_003408399.1.97979 WP_003408399.1.97995 WP_003408399.1.98018 WP_003408399.1.98034 WP_003408399.1.98052 WP_003408399.1.98071 WP_003408399.1.98072 WP_003408399.1.98113 WP_003408399.1.98114 WP_003408399.1.98128 WP_003408399.1.98181 WP_003408399.1.98188 WP_003408399.1.98189 WP_003408399.1.98213 WP_003408399.1.98225 WP_003408399.1.98291 WP_003408399.1.98335 WP_003408399.1.98350 WP_003408399.1.98395 WP_003408399.1.98412 WP_003408399.1.98443 WP_003408399.1.98462 WP_003408399.1.9848 WP_003408399.1.98482 WP_003408399.1.98486 WP_003408399.1.98488 WP_003408399.1.98503 WP_003408399.1.98516 WP_003408399.1.98524 WP_003408399.1.98536 WP_003408399.1.98541 WP_003408399.1.98576 WP_003408399.1.98590 WP_003408399.1.98594 WP_003408399.1.98599 WP_003408399.1.98629 WP_003408399.1.98645 WP_003408399.1.98646 WP_003408399.1.98649 WP_003408399.1.98656 WP_003408399.1.9867 WP_003408399.1.98674 WP_003408399.1.98697 WP_003408399.1.98701 WP_003408399.1.98739 WP_003408399.1.98749 WP_003408399.1.98765 WP_003408399.1.98770 WP_003408399.1.98777 WP_003408399.1.98778 WP_003408399.1.98802 WP_003408399.1.98838 WP_003408399.1.98850 WP_003408399.1.98906 WP_003408399.1.98935 WP_003408399.1.98948 WP_003408399.1.98953 WP_003408399.1.98984 WP_003408399.1.99000 WP_003408399.1.99023 WP_003408399.1.99030 WP_003408399.1.99037 WP_003408399.1.99055 WP_003408399.1.99062 WP_003408399.1.99086 WP_003408399.1.99115 WP_003408399.1.99117 WP_003408399.1.99161 WP_003408399.1.99205 WP_003408399.1.99211 WP_003408399.1.99216 WP_003408399.1.99222 WP_003408399.1.99251 WP_003408399.1.99269 WP_003408399.1.99294 WP_003408399.1.99312 WP_003408399.1.99315 WP_003408399.1.99316 WP_003408399.1.99322 WP_003408399.1.99328 WP_003408399.1.99365 WP_003408399.1.99368 WP_003408399.1.99379 WP_003408399.1.99396 WP_003408399.1.99402 WP_003408399.1.99404 WP_003408399.1.99419 WP_003408399.1.99438 WP_003408399.1.99460 WP_003408399.1.99468 WP_003408399.1.99473 WP_003408399.1.99513 WP_003408399.1.99529 WP_003408399.1.99548 WP_003408399.1.99572 WP_003408399.1.99578 WP_003408399.1.99605 WP_003408399.1.99609 WP_003408399.1.99617 WP_003408399.1.99635 WP_003408399.1.99650 WP_003408399.1.99701 WP_003408399.1.99711 WP_003408399.1.99716 WP_003408399.1.99740 WP_003408399.1.99745 WP_003408399.1.99749 WP_003408399.1.9976 WP_003408399.1.99817 WP_003408399.1.99832 WP_003408399.1.99847 WP_003408399.1.99852 WP_003408399.1.99886 WP_003408399.1.99897 WP_003408399.1.99899 WP_003408399.1.99915 WP_003408399.1.9993 WP_003408399.1.99982 WP_003408399.1.99991 gi|383307530|ref|YP_005360341.1| gi|433634750|ref|YP_007268377.1| gi|121637607|ref|YP_977830.1| gi|471337625|ref|YP_007610338.1| 1mqeA gi|506926177|ref|YP_008006627.1| 1mk1_A 1mp2_A 1mqe_A 1mqw_A 1mr2_A gi|525674383|ref|YP_008225804.1| gi|340626705|ref|YP_004745157.1| gi|479055654|ref|YP_007351460.1| gi|253799262|ref|YP_003032263.1| gi|375296509|ref|YP_005100776.1| gi|15841157|ref|NP_336194.1| gi|15608838|ref|NP_216216.1| gi|378771441|ref|YP_005171174.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]