SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I6X486 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I6X486
Domain Number 1 Region: 8-90
Classification Level Classification E-value
Superfamily PE/PPE dimer-like 2.53e-20
Family PE 0.00000672
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I6X486
Sequence length 99
Comment (sp|I6X486|PE25_MYCTU) PE-PGRS family protein PE25 {ECO:0000305} KW=Complete proteome; Reference proteome OX=83332 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv). GN=LH57_13295 OC=Mycobacterium; Mycobacterium tuberculosis complex.
Sequence
MSFVITNPEALTVAATEVRRIRDRAIQSDAQVAPMTTAVRPPAADLVSEKAATFLVEYAR
KYRQTIAAAAVVLEEFAHALTTGADKYATAEADNIKTFS
Download sequence
Identical sequences A0A045IHS7 A0A083W1X4 A0A0H3LBR3 A0A0H3M771 A0A0K2HZ17 A0A109SPV1 A0A109SZ44 A0A197IXJ3 A0A1R3Y179 A0A1S1B9V0 A5U5C7 F8M206 G0TPB7 I6X486 M8DE95 Q7D756 R4M872
gi|525675007|ref|YP_008226526.1| 2g38A gi|253798489|ref|YP_003031490.1| gi|375295752|ref|YP_005100019.1| gi|57116989|ref|YP_177882.1| gi|386005345|ref|YP_005923624.1| WP_003412551.1.100000 WP_003412551.1.100021 WP_003412551.1.100069 WP_003412551.1.100087 WP_003412551.1.10015 WP_003412551.1.100208 WP_003412551.1.100216 WP_003412551.1.10022 WP_003412551.1.100255 WP_003412551.1.100260 WP_003412551.1.100270 WP_003412551.1.100279 WP_003412551.1.100286 WP_003412551.1.100308 WP_003412551.1.100309 WP_003412551.1.100318 WP_003412551.1.100337 WP_003412551.1.100338 WP_003412551.1.10037 WP_003412551.1.100383 WP_003412551.1.100395 WP_003412551.1.100396 WP_003412551.1.1004 WP_003412551.1.100401 WP_003412551.1.100459 WP_003412551.1.100460 WP_003412551.1.100552 WP_003412551.1.100581 WP_003412551.1.100600 WP_003412551.1.100625 WP_003412551.1.10064 WP_003412551.1.100666 WP_003412551.1.100671 WP_003412551.1.100677 WP_003412551.1.100682 WP_003412551.1.100697 WP_003412551.1.100703 WP_003412551.1.100716 WP_003412551.1.100722 WP_003412551.1.100754 WP_003412551.1.100757 WP_003412551.1.100772 WP_003412551.1.1008 WP_003412551.1.100812 WP_003412551.1.100845 WP_003412551.1.100866 WP_003412551.1.10088 WP_003412551.1.100889 WP_003412551.1.10090 WP_003412551.1.100910 WP_003412551.1.100915 WP_003412551.1.100918 WP_003412551.1.100935 WP_003412551.1.100984 WP_003412551.1.100992 WP_003412551.1.100998 WP_003412551.1.101 WP_003412551.1.101025 WP_003412551.1.101028 WP_003412551.1.10104 WP_003412551.1.101048 WP_003412551.1.101054 WP_003412551.1.101075 WP_003412551.1.101143 WP_003412551.1.101146 WP_003412551.1.10116 WP_003412551.1.10117 WP_003412551.1.101209 WP_003412551.1.10125 WP_003412551.1.101290 WP_003412551.1.101323 WP_003412551.1.101324 WP_003412551.1.101350 WP_003412551.1.101367 WP_003412551.1.101398 WP_003412551.1.101403 WP_003412551.1.101421 WP_003412551.1.10144 WP_003412551.1.101442 WP_003412551.1.10145 WP_003412551.1.101452 WP_003412551.1.101456 WP_003412551.1.101481 WP_003412551.1.101493 WP_003412551.1.101496 WP_003412551.1.101525 WP_003412551.1.101533 WP_003412551.1.101535 WP_003412551.1.101553 WP_003412551.1.101558 WP_003412551.1.10156 WP_003412551.1.101573 WP_003412551.1.101576 WP_003412551.1.10159 WP_003412551.1.101592 WP_003412551.1.101604 WP_003412551.1.101607 WP_003412551.1.101622 WP_003412551.1.101644 WP_003412551.1.101671 WP_003412551.1.101687 WP_003412551.1.101698 WP_003412551.1.10170 WP_003412551.1.101713 WP_003412551.1.101722 WP_003412551.1.101733 WP_003412551.1.101743 WP_003412551.1.101753 WP_003412551.1.101754 WP_003412551.1.101764 WP_003412551.1.101773 WP_003412551.1.101795 WP_003412551.1.101797 WP_003412551.1.101798 WP_003412551.1.101802 WP_003412551.1.101826 WP_003412551.1.101836 WP_003412551.1.101858 WP_003412551.1.101859 WP_003412551.1.101862 WP_003412551.1.101888 WP_003412551.1.101894 WP_003412551.1.101899 WP_003412551.1.1019 WP_003412551.1.101923 WP_003412551.1.101925 WP_003412551.1.10193 WP_003412551.1.101996 WP_003412551.1.102 WP_003412551.1.102008 WP_003412551.1.102017 WP_003412551.1.102053 WP_003412551.1.102055 WP_003412551.1.102063 WP_003412551.1.102099 WP_003412551.1.1021 WP_003412551.1.10211 WP_003412551.1.102119 WP_003412551.1.102121 WP_003412551.1.102143 WP_003412551.1.10216 WP_003412551.1.10224 WP_003412551.1.10253 WP_003412551.1.10262 WP_003412551.1.10272 WP_003412551.1.10277 WP_003412551.1.1033 WP_003412551.1.10350 WP_003412551.1.10362 WP_003412551.1.10366 WP_003412551.1.10376 WP_003412551.1.10396 WP_003412551.1.10410 WP_003412551.1.10414 WP_003412551.1.10421 WP_003412551.1.10430 WP_003412551.1.1044 WP_003412551.1.10440 WP_003412551.1.10445 WP_003412551.1.10471 WP_003412551.1.10472 WP_003412551.1.10489 WP_003412551.1.105 WP_003412551.1.10518 WP_003412551.1.10523 WP_003412551.1.10545 WP_003412551.1.1057 WP_003412551.1.10594 WP_003412551.1.10603 WP_003412551.1.10606 WP_003412551.1.10615 WP_003412551.1.10623 WP_003412551.1.10635 WP_003412551.1.10643 WP_003412551.1.10648 WP_003412551.1.10662 WP_003412551.1.10709 WP_003412551.1.10735 WP_003412551.1.10740 WP_003412551.1.10756 WP_003412551.1.1078 WP_003412551.1.10791 WP_003412551.1.10799 WP_003412551.1.10825 WP_003412551.1.10848 WP_003412551.1.10863 WP_003412551.1.10879 WP_003412551.1.10912 WP_003412551.1.10916 WP_003412551.1.10923 WP_003412551.1.10927 WP_003412551.1.1095 WP_003412551.1.10956 WP_003412551.1.10958 WP_003412551.1.10962 WP_003412551.1.10980 WP_003412551.1.10981 WP_003412551.1.10993 WP_003412551.1.1100 WP_003412551.1.11040 WP_003412551.1.11061 WP_003412551.1.11070 WP_003412551.1.11141 WP_003412551.1.11171 WP_003412551.1.11175 WP_003412551.1.11176 WP_003412551.1.11222 WP_003412551.1.11236 WP_003412551.1.11329 WP_003412551.1.1133 WP_003412551.1.11342 WP_003412551.1.11373 WP_003412551.1.11376 WP_003412551.1.11390 WP_003412551.1.11402 WP_003412551.1.11481 WP_003412551.1.11487 WP_003412551.1.11489 WP_003412551.1.11491 WP_003412551.1.11514 WP_003412551.1.11587 WP_003412551.1.11589 WP_003412551.1.11596 WP_003412551.1.11604 WP_003412551.1.11610 WP_003412551.1.11697 WP_003412551.1.11707 WP_003412551.1.11752 WP_003412551.1.11758 WP_003412551.1.11761 WP_003412551.1.11775 WP_003412551.1.11804 WP_003412551.1.11822 WP_003412551.1.11826 WP_003412551.1.11856 WP_003412551.1.11898 WP_003412551.1.11906 WP_003412551.1.11939 WP_003412551.1.11960 WP_003412551.1.11961 WP_003412551.1.11972 WP_003412551.1.11984 WP_003412551.1.120 WP_003412551.1.12001 WP_003412551.1.12049 WP_003412551.1.12052 WP_003412551.1.12100 WP_003412551.1.12116 WP_003412551.1.12130 WP_003412551.1.12133 WP_003412551.1.12161 WP_003412551.1.12165 WP_003412551.1.12184 WP_003412551.1.12187 WP_003412551.1.12190 WP_003412551.1.12216 WP_003412551.1.12265 WP_003412551.1.12275 WP_003412551.1.12293 WP_003412551.1.12294 WP_003412551.1.123 WP_003412551.1.1231 WP_003412551.1.12314 WP_003412551.1.12327 WP_003412551.1.12338 WP_003412551.1.1236 WP_003412551.1.12371 WP_003412551.1.12372 WP_003412551.1.12389 WP_003412551.1.12406 WP_003412551.1.1241 WP_003412551.1.12421 WP_003412551.1.12424 WP_003412551.1.12446 WP_003412551.1.12464 WP_003412551.1.12479 WP_003412551.1.12519 WP_003412551.1.12523 WP_003412551.1.12526 WP_003412551.1.1255 WP_003412551.1.12550 WP_003412551.1.12551 WP_003412551.1.12563 WP_003412551.1.12611 WP_003412551.1.12669 WP_003412551.1.1267 WP_003412551.1.12672 WP_003412551.1.12692 WP_003412551.1.1271 WP_003412551.1.12710 WP_003412551.1.12768 WP_003412551.1.1279 WP_003412551.1.12794 WP_003412551.1.12801 WP_003412551.1.12804 WP_003412551.1.12821 WP_003412551.1.12841 WP_003412551.1.12854 WP_003412551.1.12871 WP_003412551.1.12901 WP_003412551.1.12941 WP_003412551.1.12947 WP_003412551.1.12957 WP_003412551.1.12972 WP_003412551.1.13028 WP_003412551.1.13043 WP_003412551.1.13086 WP_003412551.1.13087 WP_003412551.1.13090 WP_003412551.1.13096 WP_003412551.1.13163 WP_003412551.1.13175 WP_003412551.1.13183 WP_003412551.1.132 WP_003412551.1.13249 WP_003412551.1.13282 WP_003412551.1.13284 WP_003412551.1.13296 WP_003412551.1.13298 WP_003412551.1.13302 WP_003412551.1.13306 WP_003412551.1.13312 WP_003412551.1.13313 WP_003412551.1.13321 WP_003412551.1.13345 WP_003412551.1.13358 WP_003412551.1.13370 WP_003412551.1.13375 WP_003412551.1.1338 WP_003412551.1.13420 WP_003412551.1.13433 WP_003412551.1.13435 WP_003412551.1.13438 WP_003412551.1.13461 WP_003412551.1.13466 WP_003412551.1.13489 WP_003412551.1.13526 WP_003412551.1.13551 WP_003412551.1.13561 WP_003412551.1.13564 WP_003412551.1.13579 WP_003412551.1.13647 WP_003412551.1.13667 WP_003412551.1.13687 WP_003412551.1.13697 WP_003412551.1.13719 WP_003412551.1.13763 WP_003412551.1.1377 WP_003412551.1.13774 WP_003412551.1.13786 WP_003412551.1.13793 WP_003412551.1.13794 WP_003412551.1.13817 WP_003412551.1.13834 WP_003412551.1.13866 WP_003412551.1.13899 WP_003412551.1.13909 WP_003412551.1.13910 WP_003412551.1.13919 WP_003412551.1.13920 WP_003412551.1.13952 WP_003412551.1.13953 WP_003412551.1.13962 WP_003412551.1.1398 WP_003412551.1.13988 WP_003412551.1.14027 WP_003412551.1.14046 WP_003412551.1.14115 WP_003412551.1.1415 WP_003412551.1.14152 WP_003412551.1.14158 WP_003412551.1.14162 WP_003412551.1.14175 WP_003412551.1.14178 WP_003412551.1.14194 WP_003412551.1.14208 WP_003412551.1.14238 WP_003412551.1.14266 WP_003412551.1.14273 WP_003412551.1.14303 WP_003412551.1.14306 WP_003412551.1.14307 WP_003412551.1.14310 WP_003412551.1.14341 WP_003412551.1.14382 WP_003412551.1.14416 WP_003412551.1.14428 WP_003412551.1.14441 WP_003412551.1.14469 WP_003412551.1.14477 WP_003412551.1.14504 WP_003412551.1.14514 WP_003412551.1.1452 WP_003412551.1.14527 WP_003412551.1.1454 WP_003412551.1.14544 WP_003412551.1.14548 WP_003412551.1.14551 WP_003412551.1.14561 WP_003412551.1.14573 WP_003412551.1.1462 WP_003412551.1.14658 WP_003412551.1.14667 WP_003412551.1.14668 WP_003412551.1.14675 WP_003412551.1.14694 WP_003412551.1.14695 WP_003412551.1.14709 WP_003412551.1.14766 WP_003412551.1.14783 WP_003412551.1.14865 WP_003412551.1.14872 WP_003412551.1.14905 WP_003412551.1.14926 WP_003412551.1.14951 WP_003412551.1.14955 WP_003412551.1.15003 WP_003412551.1.15009 WP_003412551.1.15028 WP_003412551.1.15040 WP_003412551.1.15052 WP_003412551.1.15065 WP_003412551.1.15072 WP_003412551.1.15089 WP_003412551.1.1509 WP_003412551.1.15126 WP_003412551.1.15131 WP_003412551.1.15168 WP_003412551.1.15172 WP_003412551.1.15174 WP_003412551.1.15187 WP_003412551.1.15196 WP_003412551.1.15210 WP_003412551.1.15216 WP_003412551.1.15217 WP_003412551.1.1523 WP_003412551.1.15232 WP_003412551.1.15238 WP_003412551.1.15240 WP_003412551.1.15253 WP_003412551.1.15267 WP_003412551.1.1527 WP_003412551.1.15292 WP_003412551.1.15299 WP_003412551.1.15302 WP_003412551.1.15322 WP_003412551.1.1534 WP_003412551.1.15345 WP_003412551.1.15365 WP_003412551.1.15372 WP_003412551.1.15386 WP_003412551.1.15387 WP_003412551.1.15442 WP_003412551.1.15447 WP_003412551.1.15449 WP_003412551.1.15477 WP_003412551.1.15481 WP_003412551.1.15492 WP_003412551.1.15511 WP_003412551.1.15512 WP_003412551.1.15558 WP_003412551.1.15559 WP_003412551.1.15566 WP_003412551.1.15599 WP_003412551.1.1560 WP_003412551.1.15611 WP_003412551.1.1563 WP_003412551.1.15633 WP_003412551.1.15643 WP_003412551.1.15688 WP_003412551.1.15755 WP_003412551.1.15763 WP_003412551.1.15774 WP_003412551.1.1578 WP_003412551.1.15780 WP_003412551.1.15827 WP_003412551.1.15834 WP_003412551.1.15842 WP_003412551.1.15848 WP_003412551.1.15853 WP_003412551.1.15870 WP_003412551.1.15893 WP_003412551.1.15896 WP_003412551.1.15926 WP_003412551.1.15933 WP_003412551.1.15946 WP_003412551.1.15958 WP_003412551.1.15973 WP_003412551.1.15987 WP_003412551.1.15993 WP_003412551.1.16025 WP_003412551.1.16043 WP_003412551.1.16055 WP_003412551.1.16066 WP_003412551.1.16069 WP_003412551.1.16077 WP_003412551.1.16106 WP_003412551.1.16108 WP_003412551.1.16110 WP_003412551.1.16130 WP_003412551.1.16136 WP_003412551.1.16139 WP_003412551.1.16141 WP_003412551.1.16143 WP_003412551.1.1630 WP_003412551.1.16318 WP_003412551.1.1632 WP_003412551.1.16327 WP_003412551.1.16334 WP_003412551.1.16341 WP_003412551.1.16345 WP_003412551.1.16374 WP_003412551.1.16384 WP_003412551.1.16386 WP_003412551.1.164 WP_003412551.1.1642 WP_003412551.1.16421 WP_003412551.1.16424 WP_003412551.1.16426 WP_003412551.1.16431 WP_003412551.1.16438 WP_003412551.1.1644 WP_003412551.1.16442 WP_003412551.1.16448 WP_003412551.1.16451 WP_003412551.1.16476 WP_003412551.1.16480 WP_003412551.1.16494 WP_003412551.1.1652 WP_003412551.1.16549 WP_003412551.1.16560 WP_003412551.1.16598 WP_003412551.1.16609 WP_003412551.1.16619 WP_003412551.1.16620 WP_003412551.1.16622 WP_003412551.1.16637 WP_003412551.1.1669 WP_003412551.1.16707 WP_003412551.1.16724 WP_003412551.1.16731 WP_003412551.1.16743 WP_003412551.1.1683 WP_003412551.1.16837 WP_003412551.1.16852 WP_003412551.1.16937 WP_003412551.1.16940 WP_003412551.1.16950 WP_003412551.1.16959 WP_003412551.1.16968 WP_003412551.1.1697 WP_003412551.1.16973 WP_003412551.1.16977 WP_003412551.1.16987 WP_003412551.1.17005 WP_003412551.1.17006 WP_003412551.1.17010 WP_003412551.1.17015 WP_003412551.1.17019 WP_003412551.1.17039 WP_003412551.1.17041 WP_003412551.1.17052 WP_003412551.1.17057 WP_003412551.1.17062 WP_003412551.1.1707 WP_003412551.1.17094 WP_003412551.1.17130 WP_003412551.1.17138 WP_003412551.1.17147 WP_003412551.1.17167 WP_003412551.1.17224 WP_003412551.1.17251 WP_003412551.1.17288 WP_003412551.1.17304 WP_003412551.1.17314 WP_003412551.1.17345 WP_003412551.1.17381 WP_003412551.1.17391 WP_003412551.1.17412 WP_003412551.1.1743 WP_003412551.1.17440 WP_003412551.1.17466 WP_003412551.1.17477 WP_003412551.1.17483 WP_003412551.1.17505 WP_003412551.1.17535 WP_003412551.1.17540 WP_003412551.1.17553 WP_003412551.1.17558 WP_003412551.1.17599 WP_003412551.1.17635 WP_003412551.1.17655 WP_003412551.1.17679 WP_003412551.1.1768 WP_003412551.1.17687 WP_003412551.1.17700 WP_003412551.1.17710 WP_003412551.1.17713 WP_003412551.1.17722 WP_003412551.1.17746 WP_003412551.1.17788 WP_003412551.1.17798 WP_003412551.1.17803 WP_003412551.1.17816 WP_003412551.1.17821 WP_003412551.1.17830 WP_003412551.1.17868 WP_003412551.1.17878 WP_003412551.1.1792 WP_003412551.1.17923 WP_003412551.1.1795 WP_003412551.1.17955 WP_003412551.1.17973 WP_003412551.1.18009 WP_003412551.1.18013 WP_003412551.1.18033 WP_003412551.1.18057 WP_003412551.1.18065 WP_003412551.1.18070 WP_003412551.1.18116 WP_003412551.1.18120 WP_003412551.1.18126 WP_003412551.1.1817 WP_003412551.1.18170 WP_003412551.1.18206 WP_003412551.1.18216 WP_003412551.1.18240 WP_003412551.1.18257 WP_003412551.1.18297 WP_003412551.1.18306 WP_003412551.1.18364 WP_003412551.1.18399 WP_003412551.1.18411 WP_003412551.1.18444 WP_003412551.1.18448 WP_003412551.1.18467 WP_003412551.1.18476 WP_003412551.1.18522 WP_003412551.1.18580 WP_003412551.1.18582 WP_003412551.1.18587 WP_003412551.1.186 WP_003412551.1.18601 WP_003412551.1.18639 WP_003412551.1.18646 WP_003412551.1.18647 WP_003412551.1.1868 WP_003412551.1.18694 WP_003412551.1.18710 WP_003412551.1.18751 WP_003412551.1.18781 WP_003412551.1.18793 WP_003412551.1.18804 WP_003412551.1.18816 WP_003412551.1.18823 WP_003412551.1.18827 WP_003412551.1.18838 WP_003412551.1.18849 WP_003412551.1.18856 WP_003412551.1.18945 WP_003412551.1.1898 WP_003412551.1.19005 WP_003412551.1.19056 WP_003412551.1.19063 WP_003412551.1.19066 WP_003412551.1.19071 WP_003412551.1.19085 WP_003412551.1.19094 WP_003412551.1.19144 WP_003412551.1.19159 WP_003412551.1.19193 WP_003412551.1.19231 WP_003412551.1.19243 WP_003412551.1.19264 WP_003412551.1.19295 WP_003412551.1.19307 WP_003412551.1.19326 WP_003412551.1.1933 WP_003412551.1.19364 WP_003412551.1.19382 WP_003412551.1.19400 WP_003412551.1.19426 WP_003412551.1.19429 WP_003412551.1.19464 WP_003412551.1.19480 WP_003412551.1.19512 WP_003412551.1.19553 WP_003412551.1.19562 WP_003412551.1.19564 WP_003412551.1.19568 WP_003412551.1.19572 WP_003412551.1.19595 WP_003412551.1.19596 WP_003412551.1.19600 WP_003412551.1.19630 WP_003412551.1.1967 WP_003412551.1.19694 WP_003412551.1.1970 WP_003412551.1.19707 WP_003412551.1.19742 WP_003412551.1.19785 WP_003412551.1.19820 WP_003412551.1.19868 WP_003412551.1.19874 WP_003412551.1.19890 WP_003412551.1.19900 WP_003412551.1.19922 WP_003412551.1.19936 WP_003412551.1.19946 WP_003412551.1.19949 WP_003412551.1.19960 WP_003412551.1.19964 WP_003412551.1.20007 WP_003412551.1.20016 WP_003412551.1.20028 WP_003412551.1.2003 WP_003412551.1.20037 WP_003412551.1.20039 WP_003412551.1.20082 WP_003412551.1.20085 WP_003412551.1.20097 WP_003412551.1.20116 WP_003412551.1.20130 WP_003412551.1.20141 WP_003412551.1.20142 WP_003412551.1.20158 WP_003412551.1.20239 WP_003412551.1.20243 WP_003412551.1.20259 WP_003412551.1.20262 WP_003412551.1.20268 WP_003412551.1.20272 WP_003412551.1.20273 WP_003412551.1.20280 WP_003412551.1.20294 WP_003412551.1.20300 WP_003412551.1.20309 WP_003412551.1.20322 WP_003412551.1.2037 WP_003412551.1.20372 WP_003412551.1.20381 WP_003412551.1.204 WP_003412551.1.20427 WP_003412551.1.20432 WP_003412551.1.20457 WP_003412551.1.20459 WP_003412551.1.20460 WP_003412551.1.20542 WP_003412551.1.20578 WP_003412551.1.20608 WP_003412551.1.20624 WP_003412551.1.20628 WP_003412551.1.2066 WP_003412551.1.20707 WP_003412551.1.20722 WP_003412551.1.20729 WP_003412551.1.20742 WP_003412551.1.20751 WP_003412551.1.20776 WP_003412551.1.20843 WP_003412551.1.20850 WP_003412551.1.2086 WP_003412551.1.20868 WP_003412551.1.20876 WP_003412551.1.20897 WP_003412551.1.20898 WP_003412551.1.2090 WP_003412551.1.20911 WP_003412551.1.20916 WP_003412551.1.20921 WP_003412551.1.20926 WP_003412551.1.20927 WP_003412551.1.20951 WP_003412551.1.20970 WP_003412551.1.2104 WP_003412551.1.21070 WP_003412551.1.21127 WP_003412551.1.21135 WP_003412551.1.21173 WP_003412551.1.21187 WP_003412551.1.212 WP_003412551.1.2120 WP_003412551.1.21218 WP_003412551.1.21219 WP_003412551.1.2123 WP_003412551.1.21231 WP_003412551.1.21234 WP_003412551.1.2126 WP_003412551.1.21292 WP_003412551.1.21307 WP_003412551.1.2131 WP_003412551.1.21311 WP_003412551.1.21321 WP_003412551.1.21365 WP_003412551.1.2137 WP_003412551.1.21392 WP_003412551.1.21397 WP_003412551.1.21403 WP_003412551.1.21415 WP_003412551.1.21418 WP_003412551.1.21430 WP_003412551.1.21434 WP_003412551.1.21444 WP_003412551.1.21468 WP_003412551.1.21498 WP_003412551.1.21509 WP_003412551.1.21513 WP_003412551.1.21560 WP_003412551.1.21565 WP_003412551.1.21586 WP_003412551.1.21591 WP_003412551.1.21594 WP_003412551.1.21602 WP_003412551.1.21615 WP_003412551.1.21638 WP_003412551.1.21639 WP_003412551.1.21655 WP_003412551.1.21658 WP_003412551.1.2168 WP_003412551.1.2174 WP_003412551.1.21741 WP_003412551.1.21742 WP_003412551.1.21777 WP_003412551.1.21786 WP_003412551.1.21795 WP_003412551.1.218 WP_003412551.1.21826 WP_003412551.1.21829 WP_003412551.1.21840 WP_003412551.1.21843 WP_003412551.1.21872 WP_003412551.1.2188 WP_003412551.1.21882 WP_003412551.1.21906 WP_003412551.1.21912 WP_003412551.1.2194 WP_003412551.1.21941 WP_003412551.1.21956 WP_003412551.1.21958 WP_003412551.1.21960 WP_003412551.1.21973 WP_003412551.1.21983 WP_003412551.1.22003 WP_003412551.1.22013 WP_003412551.1.22025 WP_003412551.1.22036 WP_003412551.1.22075 WP_003412551.1.22092 WP_003412551.1.2212 WP_003412551.1.22127 WP_003412551.1.22140 WP_003412551.1.22233 WP_003412551.1.22255 WP_003412551.1.22277 WP_003412551.1.22305 WP_003412551.1.22348 WP_003412551.1.22356 WP_003412551.1.22366 WP_003412551.1.2238 WP_003412551.1.22380 WP_003412551.1.22437 WP_003412551.1.22438 WP_003412551.1.22445 WP_003412551.1.22490 WP_003412551.1.22511 WP_003412551.1.22524 WP_003412551.1.2253 WP_003412551.1.22585 WP_003412551.1.22589 WP_003412551.1.22606 WP_003412551.1.22608 WP_003412551.1.22609 WP_003412551.1.22618 WP_003412551.1.2262 WP_003412551.1.22624 WP_003412551.1.22629 WP_003412551.1.22647 WP_003412551.1.22664 WP_003412551.1.22665 WP_003412551.1.22670 WP_003412551.1.22674 WP_003412551.1.22680 WP_003412551.1.22725 WP_003412551.1.22728 WP_003412551.1.22733 WP_003412551.1.22737 WP_003412551.1.2275 WP_003412551.1.22754 WP_003412551.1.22797 WP_003412551.1.22800 WP_003412551.1.22804 WP_003412551.1.22829 WP_003412551.1.22840 WP_003412551.1.22844 WP_003412551.1.22963 WP_003412551.1.22970 WP_003412551.1.22996 WP_003412551.1.22997 WP_003412551.1.22999 WP_003412551.1.23015 WP_003412551.1.23032 WP_003412551.1.231 WP_003412551.1.23101 WP_003412551.1.2312 WP_003412551.1.23140 WP_003412551.1.23153 WP_003412551.1.23171 WP_003412551.1.23199 WP_003412551.1.2320 WP_003412551.1.23204 WP_003412551.1.23216 WP_003412551.1.23229 WP_003412551.1.23233 WP_003412551.1.2326 WP_003412551.1.23261 WP_003412551.1.23272 WP_003412551.1.23289 WP_003412551.1.2329 WP_003412551.1.23308 WP_003412551.1.23316 WP_003412551.1.23321 WP_003412551.1.23325 WP_003412551.1.2339 WP_003412551.1.23406 WP_003412551.1.23438 WP_003412551.1.23445 WP_003412551.1.23447 WP_003412551.1.23452 WP_003412551.1.23461 WP_003412551.1.2349 WP_003412551.1.23496 WP_003412551.1.23497 WP_003412551.1.23506 WP_003412551.1.23530 WP_003412551.1.23539 WP_003412551.1.23546 WP_003412551.1.23551 WP_003412551.1.23573 WP_003412551.1.23583 WP_003412551.1.23588 WP_003412551.1.23628 WP_003412551.1.23677 WP_003412551.1.23683 WP_003412551.1.23694 WP_003412551.1.23699 WP_003412551.1.2371 WP_003412551.1.23803 WP_003412551.1.23807 WP_003412551.1.23825 WP_003412551.1.23832 WP_003412551.1.2384 WP_003412551.1.23843 WP_003412551.1.23863 WP_003412551.1.2387 WP_003412551.1.23894 WP_003412551.1.23993 WP_003412551.1.2400 WP_003412551.1.24007 WP_003412551.1.24008 WP_003412551.1.24046 WP_003412551.1.24057 WP_003412551.1.24062 WP_003412551.1.24113 WP_003412551.1.24119 WP_003412551.1.24128 WP_003412551.1.24140 WP_003412551.1.24176 WP_003412551.1.24190 WP_003412551.1.24202 WP_003412551.1.24244 WP_003412551.1.24261 WP_003412551.1.24284 WP_003412551.1.24294 WP_003412551.1.24357 WP_003412551.1.24396 WP_003412551.1.24414 WP_003412551.1.24423 WP_003412551.1.2443 WP_003412551.1.24446 WP_003412551.1.24461 WP_003412551.1.24500 WP_003412551.1.24507 WP_003412551.1.24509 WP_003412551.1.24529 WP_003412551.1.24553 WP_003412551.1.24599 WP_003412551.1.24629 WP_003412551.1.24638 WP_003412551.1.24648 WP_003412551.1.2466 WP_003412551.1.24767 WP_003412551.1.24824 WP_003412551.1.24831 WP_003412551.1.24840 WP_003412551.1.24848 WP_003412551.1.24857 WP_003412551.1.2487 WP_003412551.1.24893 WP_003412551.1.24907 WP_003412551.1.24933 WP_003412551.1.24956 WP_003412551.1.24958 WP_003412551.1.24985 WP_003412551.1.2499 WP_003412551.1.25004 WP_003412551.1.2505 WP_003412551.1.25051 WP_003412551.1.2507 WP_003412551.1.25096 WP_003412551.1.25103 WP_003412551.1.25129 WP_003412551.1.25171 WP_003412551.1.25184 WP_003412551.1.25247 WP_003412551.1.25252 WP_003412551.1.25278 WP_003412551.1.25283 WP_003412551.1.25309 WP_003412551.1.25313 WP_003412551.1.25338 WP_003412551.1.25342 WP_003412551.1.25343 WP_003412551.1.25367 WP_003412551.1.25393 WP_003412551.1.25406 WP_003412551.1.25435 WP_003412551.1.25437 WP_003412551.1.25445 WP_003412551.1.25455 WP_003412551.1.25473 WP_003412551.1.25504 WP_003412551.1.25513 WP_003412551.1.25542 WP_003412551.1.25579 WP_003412551.1.25594 WP_003412551.1.25606 WP_003412551.1.25645 WP_003412551.1.2566 WP_003412551.1.25673 WP_003412551.1.25674 WP_003412551.1.25693 WP_003412551.1.25699 WP_003412551.1.25727 WP_003412551.1.25736 WP_003412551.1.25738 WP_003412551.1.25756 WP_003412551.1.25759 WP_003412551.1.2580 WP_003412551.1.25813 WP_003412551.1.25853 WP_003412551.1.25854 WP_003412551.1.25874 WP_003412551.1.25885 WP_003412551.1.25892 WP_003412551.1.25906 WP_003412551.1.25914 WP_003412551.1.25916 WP_003412551.1.2594 WP_003412551.1.25954 WP_003412551.1.25965 WP_003412551.1.25972 WP_003412551.1.26017 WP_003412551.1.26032 WP_003412551.1.26038 WP_003412551.1.26072 WP_003412551.1.26089 WP_003412551.1.26097 WP_003412551.1.26098 WP_003412551.1.26108 WP_003412551.1.26109 WP_003412551.1.26118 WP_003412551.1.26126 WP_003412551.1.2614 WP_003412551.1.26168 WP_003412551.1.26182 WP_003412551.1.26190 WP_003412551.1.2620 WP_003412551.1.26234 WP_003412551.1.26243 WP_003412551.1.26265 WP_003412551.1.26267 WP_003412551.1.26292 WP_003412551.1.26310 WP_003412551.1.26328 WP_003412551.1.26349 WP_003412551.1.26366 WP_003412551.1.26374 WP_003412551.1.26407 WP_003412551.1.26412 WP_003412551.1.26454 WP_003412551.1.26464 WP_003412551.1.2653 WP_003412551.1.26571 WP_003412551.1.2659 WP_003412551.1.26597 WP_003412551.1.26603 WP_003412551.1.26629 WP_003412551.1.26651 WP_003412551.1.26702 WP_003412551.1.26707 WP_003412551.1.26710 WP_003412551.1.26719 WP_003412551.1.26737 WP_003412551.1.26738 WP_003412551.1.26745 WP_003412551.1.26756 WP_003412551.1.2676 WP_003412551.1.2677 WP_003412551.1.26779 WP_003412551.1.26780 WP_003412551.1.26798 WP_003412551.1.26854 WP_003412551.1.26868 WP_003412551.1.26876 WP_003412551.1.26888 WP_003412551.1.26914 WP_003412551.1.26945 WP_003412551.1.26959 WP_003412551.1.26969 WP_003412551.1.26984 WP_003412551.1.26992 WP_003412551.1.27004 WP_003412551.1.27017 WP_003412551.1.27045 WP_003412551.1.27074 WP_003412551.1.27075 WP_003412551.1.27128 WP_003412551.1.27130 WP_003412551.1.27139 WP_003412551.1.27152 WP_003412551.1.27162 WP_003412551.1.27164 WP_003412551.1.27193 WP_003412551.1.27235 WP_003412551.1.27254 WP_003412551.1.27278 WP_003412551.1.27343 WP_003412551.1.27352 WP_003412551.1.27369 WP_003412551.1.27391 WP_003412551.1.27398 WP_003412551.1.27402 WP_003412551.1.27410 WP_003412551.1.27411 WP_003412551.1.27449 WP_003412551.1.27460 WP_003412551.1.27463 WP_003412551.1.2749 WP_003412551.1.27492 WP_003412551.1.27528 WP_003412551.1.27541 WP_003412551.1.27576 WP_003412551.1.27582 WP_003412551.1.27596 WP_003412551.1.27607 WP_003412551.1.2766 WP_003412551.1.277 WP_003412551.1.27724 WP_003412551.1.27730 WP_003412551.1.27736 WP_003412551.1.27743 WP_003412551.1.27750 WP_003412551.1.27771 WP_003412551.1.27779 WP_003412551.1.27795 WP_003412551.1.27803 WP_003412551.1.27819 WP_003412551.1.27835 WP_003412551.1.27915 WP_003412551.1.27935 WP_003412551.1.27962 WP_003412551.1.28053 WP_003412551.1.28092 WP_003412551.1.28106 WP_003412551.1.28131 WP_003412551.1.28142 WP_003412551.1.28159 WP_003412551.1.2816 WP_003412551.1.28161 WP_003412551.1.28192 WP_003412551.1.28202 WP_003412551.1.28241 WP_003412551.1.28242 WP_003412551.1.28251 WP_003412551.1.28255 WP_003412551.1.28269 WP_003412551.1.28276 WP_003412551.1.28293 WP_003412551.1.28331 WP_003412551.1.28367 WP_003412551.1.28378 WP_003412551.1.28391 WP_003412551.1.2842 WP_003412551.1.28448 WP_003412551.1.2847 WP_003412551.1.28471 WP_003412551.1.28473 WP_003412551.1.28493 WP_003412551.1.28497 WP_003412551.1.28530 WP_003412551.1.28545 WP_003412551.1.28561 WP_003412551.1.28567 WP_003412551.1.28585 WP_003412551.1.286 WP_003412551.1.28610 WP_003412551.1.28617 WP_003412551.1.28634 WP_003412551.1.28642 WP_003412551.1.28671 WP_003412551.1.28682 WP_003412551.1.28698 WP_003412551.1.28739 WP_003412551.1.28758 WP_003412551.1.28781 WP_003412551.1.28787 WP_003412551.1.28827 WP_003412551.1.28839 WP_003412551.1.28847 WP_003412551.1.28850 WP_003412551.1.28851 WP_003412551.1.28865 WP_003412551.1.28897 WP_003412551.1.28935 WP_003412551.1.28936 WP_003412551.1.28939 WP_003412551.1.28943 WP_003412551.1.28952 WP_003412551.1.28975 WP_003412551.1.2899 WP_003412551.1.28993 WP_003412551.1.29000 WP_003412551.1.2901 WP_003412551.1.29028 WP_003412551.1.29033 WP_003412551.1.29058 WP_003412551.1.29078 WP_003412551.1.29102 WP_003412551.1.29115 WP_003412551.1.2916 WP_003412551.1.29217 WP_003412551.1.29223 WP_003412551.1.29234 WP_003412551.1.29264 WP_003412551.1.29275 WP_003412551.1.29306 WP_003412551.1.29339 WP_003412551.1.29348 WP_003412551.1.29364 WP_003412551.1.29367 WP_003412551.1.2938 WP_003412551.1.29399 WP_003412551.1.29426 WP_003412551.1.2944 WP_003412551.1.29449 WP_003412551.1.29450 WP_003412551.1.29452 WP_003412551.1.2949 WP_003412551.1.29510 WP_003412551.1.29515 WP_003412551.1.29525 WP_003412551.1.2953 WP_003412551.1.29559 WP_003412551.1.29587 WP_003412551.1.2959 WP_003412551.1.29592 WP_003412551.1.29599 WP_003412551.1.29611 WP_003412551.1.29632 WP_003412551.1.29649 WP_003412551.1.2965 WP_003412551.1.29659 WP_003412551.1.2969 WP_003412551.1.29696 WP_003412551.1.29698 WP_003412551.1.29718 WP_003412551.1.29742 WP_003412551.1.29745 WP_003412551.1.29747 WP_003412551.1.29769 WP_003412551.1.29825 WP_003412551.1.29830 WP_003412551.1.29847 WP_003412551.1.29861 WP_003412551.1.29869 WP_003412551.1.29883 WP_003412551.1.29890 WP_003412551.1.299 WP_003412551.1.29931 WP_003412551.1.29960 WP_003412551.1.30014 WP_003412551.1.3004 WP_003412551.1.30040 WP_003412551.1.30043 WP_003412551.1.30074 WP_003412551.1.30097 WP_003412551.1.30101 WP_003412551.1.30106 WP_003412551.1.30114 WP_003412551.1.30126 WP_003412551.1.30131 WP_003412551.1.30138 WP_003412551.1.30139 WP_003412551.1.30145 WP_003412551.1.30211 WP_003412551.1.30224 WP_003412551.1.30235 WP_003412551.1.30237 WP_003412551.1.3027 WP_003412551.1.30279 WP_003412551.1.30282 WP_003412551.1.30283 WP_003412551.1.30288 WP_003412551.1.30291 WP_003412551.1.30363 WP_003412551.1.30374 WP_003412551.1.30404 WP_003412551.1.3043 WP_003412551.1.30433 WP_003412551.1.30438 WP_003412551.1.30462 WP_003412551.1.30464 WP_003412551.1.30468 WP_003412551.1.30500 WP_003412551.1.3057 WP_003412551.1.30574 WP_003412551.1.30628 WP_003412551.1.30641 WP_003412551.1.30642 WP_003412551.1.30661 WP_003412551.1.30669 WP_003412551.1.30683 WP_003412551.1.30699 WP_003412551.1.30709 WP_003412551.1.30713 WP_003412551.1.30716 WP_003412551.1.30719 WP_003412551.1.30730 WP_003412551.1.30732 WP_003412551.1.30736 WP_003412551.1.30745 WP_003412551.1.30760 WP_003412551.1.30791 WP_003412551.1.308 WP_003412551.1.30807 WP_003412551.1.30818 WP_003412551.1.30824 WP_003412551.1.30848 WP_003412551.1.30877 WP_003412551.1.30888 WP_003412551.1.30901 WP_003412551.1.30903 WP_003412551.1.30912 WP_003412551.1.30913 WP_003412551.1.30914 WP_003412551.1.30919 WP_003412551.1.30977 WP_003412551.1.3100 WP_003412551.1.31002 WP_003412551.1.3101 WP_003412551.1.31034 WP_003412551.1.31047 WP_003412551.1.31070 WP_003412551.1.31074 WP_003412551.1.31102 WP_003412551.1.31127 WP_003412551.1.31184 WP_003412551.1.31199 WP_003412551.1.31226 WP_003412551.1.31230 WP_003412551.1.31233 WP_003412551.1.31263 WP_003412551.1.31264 WP_003412551.1.31270 WP_003412551.1.31287 WP_003412551.1.31290 WP_003412551.1.31304 WP_003412551.1.31346 WP_003412551.1.31348 WP_003412551.1.31354 WP_003412551.1.31390 WP_003412551.1.31414 WP_003412551.1.31417 WP_003412551.1.31428 WP_003412551.1.3143 WP_003412551.1.31458 WP_003412551.1.31483 WP_003412551.1.3149 WP_003412551.1.31498 WP_003412551.1.31507 WP_003412551.1.31537 WP_003412551.1.31548 WP_003412551.1.31569 WP_003412551.1.316 WP_003412551.1.31629 WP_003412551.1.31666 WP_003412551.1.31693 WP_003412551.1.31703 WP_003412551.1.31744 WP_003412551.1.31745 WP_003412551.1.31770 WP_003412551.1.31776 WP_003412551.1.31783 WP_003412551.1.318 WP_003412551.1.3184 WP_003412551.1.31840 WP_003412551.1.31880 WP_003412551.1.31911 WP_003412551.1.31930 WP_003412551.1.31932 WP_003412551.1.31955 WP_003412551.1.31985 WP_003412551.1.31991 WP_003412551.1.31995 WP_003412551.1.32004 WP_003412551.1.32039 WP_003412551.1.3204 WP_003412551.1.32045 WP_003412551.1.32071 WP_003412551.1.32098 WP_003412551.1.32132 WP_003412551.1.32157 WP_003412551.1.32164 WP_003412551.1.32179 WP_003412551.1.32198 WP_003412551.1.32297 WP_003412551.1.32317 WP_003412551.1.32383 WP_003412551.1.32400 WP_003412551.1.32403 WP_003412551.1.32416 WP_003412551.1.32421 WP_003412551.1.32433 WP_003412551.1.32461 WP_003412551.1.32503 WP_003412551.1.32556 WP_003412551.1.32562 WP_003412551.1.32569 WP_003412551.1.32592 WP_003412551.1.32620 WP_003412551.1.32647 WP_003412551.1.32653 WP_003412551.1.32654 WP_003412551.1.3268 WP_003412551.1.32695 WP_003412551.1.32706 WP_003412551.1.32716 WP_003412551.1.32738 WP_003412551.1.32752 WP_003412551.1.32780 WP_003412551.1.32781 WP_003412551.1.32793 WP_003412551.1.32799 WP_003412551.1.32822 WP_003412551.1.32833 WP_003412551.1.32862 WP_003412551.1.32880 WP_003412551.1.32897 WP_003412551.1.32909 WP_003412551.1.32935 WP_003412551.1.32974 WP_003412551.1.33007 WP_003412551.1.3302 WP_003412551.1.33028 WP_003412551.1.33035 WP_003412551.1.33044 WP_003412551.1.33054 WP_003412551.1.33082 WP_003412551.1.33141 WP_003412551.1.33148 WP_003412551.1.33155 WP_003412551.1.33168 WP_003412551.1.3321 WP_003412551.1.33215 WP_003412551.1.3325 WP_003412551.1.3327 WP_003412551.1.33278 WP_003412551.1.33288 WP_003412551.1.33305 WP_003412551.1.3331 WP_003412551.1.33319 WP_003412551.1.3333 WP_003412551.1.33393 WP_003412551.1.33403 WP_003412551.1.33452 WP_003412551.1.33467 WP_003412551.1.33477 WP_003412551.1.3349 WP_003412551.1.33519 WP_003412551.1.33542 WP_003412551.1.33601 WP_003412551.1.33602 WP_003412551.1.33633 WP_003412551.1.33646 WP_003412551.1.33673 WP_003412551.1.3369 WP_003412551.1.33705 WP_003412551.1.33762 WP_003412551.1.33783 WP_003412551.1.33789 WP_003412551.1.3383 WP_003412551.1.33832 WP_003412551.1.33839 WP_003412551.1.33848 WP_003412551.1.3387 WP_003412551.1.33886 WP_003412551.1.33895 WP_003412551.1.33906 WP_003412551.1.33912 WP_003412551.1.33954 WP_003412551.1.3399 WP_003412551.1.34042 WP_003412551.1.3405 WP_003412551.1.34055 WP_003412551.1.34056 WP_003412551.1.34065 WP_003412551.1.3408 WP_003412551.1.34090 WP_003412551.1.34109 WP_003412551.1.34111 WP_003412551.1.34131 WP_003412551.1.34152 WP_003412551.1.34153 WP_003412551.1.34163 WP_003412551.1.34181 WP_003412551.1.34197 WP_003412551.1.34198 WP_003412551.1.34215 WP_003412551.1.34219 WP_003412551.1.34255 WP_003412551.1.34260 WP_003412551.1.34275 WP_003412551.1.343 WP_003412551.1.34347 WP_003412551.1.34358 WP_003412551.1.34392 WP_003412551.1.344 WP_003412551.1.34428 WP_003412551.1.3443 WP_003412551.1.34435 WP_003412551.1.34446 WP_003412551.1.34499 WP_003412551.1.34505 WP_003412551.1.34516 WP_003412551.1.34529 WP_003412551.1.34551 WP_003412551.1.34563 WP_003412551.1.34576 WP_003412551.1.34581 WP_003412551.1.34588 WP_003412551.1.34596 WP_003412551.1.34599 WP_003412551.1.34639 WP_003412551.1.34673 WP_003412551.1.34724 WP_003412551.1.34740 WP_003412551.1.34755 WP_003412551.1.34777 WP_003412551.1.34783 WP_003412551.1.34841 WP_003412551.1.34908 WP_003412551.1.34919 WP_003412551.1.3492 WP_003412551.1.34933 WP_003412551.1.34945 WP_003412551.1.34946 WP_003412551.1.34954 WP_003412551.1.34960 WP_003412551.1.34961 WP_003412551.1.34963 WP_003412551.1.34965 WP_003412551.1.34968 WP_003412551.1.35023 WP_003412551.1.35069 WP_003412551.1.35072 WP_003412551.1.35078 WP_003412551.1.35100 WP_003412551.1.35146 WP_003412551.1.35156 WP_003412551.1.35160 WP_003412551.1.35162 WP_003412551.1.35173 WP_003412551.1.35176 WP_003412551.1.3520 WP_003412551.1.35213 WP_003412551.1.35221 WP_003412551.1.35246 WP_003412551.1.35278 WP_003412551.1.35301 WP_003412551.1.35311 WP_003412551.1.35312 WP_003412551.1.35317 WP_003412551.1.35319 WP_003412551.1.35347 WP_003412551.1.35363 WP_003412551.1.35382 WP_003412551.1.35385 WP_003412551.1.35396 WP_003412551.1.35397 WP_003412551.1.35403 WP_003412551.1.35426 WP_003412551.1.35439 WP_003412551.1.35455 WP_003412551.1.3548 WP_003412551.1.35484 WP_003412551.1.35492 WP_003412551.1.3553 WP_003412551.1.35553 WP_003412551.1.35555 WP_003412551.1.35561 WP_003412551.1.35602 WP_003412551.1.35610 WP_003412551.1.35635 WP_003412551.1.35657 WP_003412551.1.35680 WP_003412551.1.35687 WP_003412551.1.35689 WP_003412551.1.35707 WP_003412551.1.35732 WP_003412551.1.35754 WP_003412551.1.35767 WP_003412551.1.35770 WP_003412551.1.35771 WP_003412551.1.35780 WP_003412551.1.35805 WP_003412551.1.35811 WP_003412551.1.35821 WP_003412551.1.3584 WP_003412551.1.35848 WP_003412551.1.35864 WP_003412551.1.35874 WP_003412551.1.35876 WP_003412551.1.35897 WP_003412551.1.35899 WP_003412551.1.35923 WP_003412551.1.3593 WP_003412551.1.35954 WP_003412551.1.36005 WP_003412551.1.36014 WP_003412551.1.36023 WP_003412551.1.36051 WP_003412551.1.36053 WP_003412551.1.36075 WP_003412551.1.36089 WP_003412551.1.36097 WP_003412551.1.36098 WP_003412551.1.36116 WP_003412551.1.36145 WP_003412551.1.36156 WP_003412551.1.36205 WP_003412551.1.36228 WP_003412551.1.36246 WP_003412551.1.36252 WP_003412551.1.36260 WP_003412551.1.36270 WP_003412551.1.36271 WP_003412551.1.36303 WP_003412551.1.36309 WP_003412551.1.36315 WP_003412551.1.36319 WP_003412551.1.36321 WP_003412551.1.36326 WP_003412551.1.3634 WP_003412551.1.36356 WP_003412551.1.36357 WP_003412551.1.3636 WP_003412551.1.36385 WP_003412551.1.36399 WP_003412551.1.36436 WP_003412551.1.36465 WP_003412551.1.36469 WP_003412551.1.36473 WP_003412551.1.36485 WP_003412551.1.36508 WP_003412551.1.36540 WP_003412551.1.36561 WP_003412551.1.36571 WP_003412551.1.36573 WP_003412551.1.36578 WP_003412551.1.36585 WP_003412551.1.36597 WP_003412551.1.36614 WP_003412551.1.36657 WP_003412551.1.36674 WP_003412551.1.36720 WP_003412551.1.36727 WP_003412551.1.36733 WP_003412551.1.36785 WP_003412551.1.36810 WP_003412551.1.36844 WP_003412551.1.36851 WP_003412551.1.36862 WP_003412551.1.36893 WP_003412551.1.36901 WP_003412551.1.36921 WP_003412551.1.36935 WP_003412551.1.36941 WP_003412551.1.3695 WP_003412551.1.36951 WP_003412551.1.36968 WP_003412551.1.3700 WP_003412551.1.37004 WP_003412551.1.37012 WP_003412551.1.37071 WP_003412551.1.37088 WP_003412551.1.37131 WP_003412551.1.37157 WP_003412551.1.37175 WP_003412551.1.37188 WP_003412551.1.37213 WP_003412551.1.37229 WP_003412551.1.3724 WP_003412551.1.37277 WP_003412551.1.37305 WP_003412551.1.37330 WP_003412551.1.37389 WP_003412551.1.37400 WP_003412551.1.37440 WP_003412551.1.37459 WP_003412551.1.37468 WP_003412551.1.37475 WP_003412551.1.37484 WP_003412551.1.37601 WP_003412551.1.37612 WP_003412551.1.37632 WP_003412551.1.37643 WP_003412551.1.37655 WP_003412551.1.37660 WP_003412551.1.37674 WP_003412551.1.37700 WP_003412551.1.37701 WP_003412551.1.37709 WP_003412551.1.37711 WP_003412551.1.37721 WP_003412551.1.37722 WP_003412551.1.37747 WP_003412551.1.37765 WP_003412551.1.37772 WP_003412551.1.37804 WP_003412551.1.37809 WP_003412551.1.37859 WP_003412551.1.37877 WP_003412551.1.37912 WP_003412551.1.37913 WP_003412551.1.37943 WP_003412551.1.37950 WP_003412551.1.37973 WP_003412551.1.37975 WP_003412551.1.37983 WP_003412551.1.38 WP_003412551.1.38002 WP_003412551.1.3802 WP_003412551.1.38039 WP_003412551.1.38040 WP_003412551.1.38067 WP_003412551.1.38068 WP_003412551.1.38135 WP_003412551.1.38138 WP_003412551.1.38144 WP_003412551.1.38158 WP_003412551.1.38159 WP_003412551.1.38210 WP_003412551.1.38233 WP_003412551.1.38240 WP_003412551.1.38299 WP_003412551.1.38332 WP_003412551.1.38347 WP_003412551.1.38354 WP_003412551.1.38380 WP_003412551.1.38384 WP_003412551.1.38389 WP_003412551.1.38398 WP_003412551.1.38402 WP_003412551.1.38418 WP_003412551.1.38421 WP_003412551.1.38466 WP_003412551.1.38477 WP_003412551.1.38483 WP_003412551.1.3849 WP_003412551.1.385 WP_003412551.1.38530 WP_003412551.1.38535 WP_003412551.1.38539 WP_003412551.1.38594 WP_003412551.1.38601 WP_003412551.1.38611 WP_003412551.1.38638 WP_003412551.1.38639 WP_003412551.1.38646 WP_003412551.1.38648 WP_003412551.1.38654 WP_003412551.1.38659 WP_003412551.1.38660 WP_003412551.1.38666 WP_003412551.1.38671 WP_003412551.1.38672 WP_003412551.1.38677 WP_003412551.1.38750 WP_003412551.1.38772 WP_003412551.1.38812 WP_003412551.1.38821 WP_003412551.1.38844 WP_003412551.1.38863 WP_003412551.1.38865 WP_003412551.1.38873 WP_003412551.1.3889 WP_003412551.1.38894 WP_003412551.1.38909 WP_003412551.1.38939 WP_003412551.1.38974 WP_003412551.1.38975 WP_003412551.1.38991 WP_003412551.1.39025 WP_003412551.1.39070 WP_003412551.1.39072 WP_003412551.1.39095 WP_003412551.1.39106 WP_003412551.1.39165 WP_003412551.1.39174 WP_003412551.1.39176 WP_003412551.1.39178 WP_003412551.1.39190 WP_003412551.1.39201 WP_003412551.1.39207 WP_003412551.1.39211 WP_003412551.1.39236 WP_003412551.1.39239 WP_003412551.1.39252 WP_003412551.1.39288 WP_003412551.1.39295 WP_003412551.1.39306 WP_003412551.1.39359 WP_003412551.1.39364 WP_003412551.1.39400 WP_003412551.1.39447 WP_003412551.1.3945 WP_003412551.1.39450 WP_003412551.1.39455 WP_003412551.1.3949 WP_003412551.1.39521 WP_003412551.1.39560 WP_003412551.1.39592 WP_003412551.1.39593 WP_003412551.1.396 WP_003412551.1.3960 WP_003412551.1.39616 WP_003412551.1.39654 WP_003412551.1.39657 WP_003412551.1.39661 WP_003412551.1.39674 WP_003412551.1.39678 WP_003412551.1.3968 WP_003412551.1.39694 WP_003412551.1.3971 WP_003412551.1.39718 WP_003412551.1.39728 WP_003412551.1.39739 WP_003412551.1.39748 WP_003412551.1.39751 WP_003412551.1.39759 WP_003412551.1.39801 WP_003412551.1.39804 WP_003412551.1.39848 WP_003412551.1.39877 WP_003412551.1.39925 WP_003412551.1.3994 WP_003412551.1.39959 WP_003412551.1.3996 WP_003412551.1.39960 WP_003412551.1.3997 WP_003412551.1.39980 WP_003412551.1.40000 WP_003412551.1.40028 WP_003412551.1.40029 WP_003412551.1.4003 WP_003412551.1.40094 WP_003412551.1.40096 WP_003412551.1.40150 WP_003412551.1.40156 WP_003412551.1.40174 WP_003412551.1.40186 WP_003412551.1.40276 WP_003412551.1.40277 WP_003412551.1.40323 WP_003412551.1.40336 WP_003412551.1.40353 WP_003412551.1.4036 WP_003412551.1.40372 WP_003412551.1.40402 WP_003412551.1.40413 WP_003412551.1.40440 WP_003412551.1.40446 WP_003412551.1.40451 WP_003412551.1.40455 WP_003412551.1.40523 WP_003412551.1.40543 WP_003412551.1.40641 WP_003412551.1.40646 WP_003412551.1.40651 WP_003412551.1.40653 WP_003412551.1.4067 WP_003412551.1.40705 WP_003412551.1.40723 WP_003412551.1.40731 WP_003412551.1.40735 WP_003412551.1.40795 WP_003412551.1.40799 WP_003412551.1.40852 WP_003412551.1.40876 WP_003412551.1.40881 WP_003412551.1.40922 WP_003412551.1.40948 WP_003412551.1.4095 WP_003412551.1.40956 WP_003412551.1.40957 WP_003412551.1.40964 WP_003412551.1.4097 WP_003412551.1.410 WP_003412551.1.41000 WP_003412551.1.41055 WP_003412551.1.41108 WP_003412551.1.41123 WP_003412551.1.41177 WP_003412551.1.41202 WP_003412551.1.41219 WP_003412551.1.41231 WP_003412551.1.41249 WP_003412551.1.4127 WP_003412551.1.41296 WP_003412551.1.41355 WP_003412551.1.41376 WP_003412551.1.41430 WP_003412551.1.41447 WP_003412551.1.41469 WP_003412551.1.41504 WP_003412551.1.41553 WP_003412551.1.41564 WP_003412551.1.41583 WP_003412551.1.41616 WP_003412551.1.41632 WP_003412551.1.41635 WP_003412551.1.41636 WP_003412551.1.41648 WP_003412551.1.41660 WP_003412551.1.41685 WP_003412551.1.41695 WP_003412551.1.41704 WP_003412551.1.4171 WP_003412551.1.41719 WP_003412551.1.41733 WP_003412551.1.41744 WP_003412551.1.41774 WP_003412551.1.41791 WP_003412551.1.41803 WP_003412551.1.41820 WP_003412551.1.41828 WP_003412551.1.41829 WP_003412551.1.41860 WP_003412551.1.41912 WP_003412551.1.41921 WP_003412551.1.41933 WP_003412551.1.41944 WP_003412551.1.42043 WP_003412551.1.42075 WP_003412551.1.42078 WP_003412551.1.42094 WP_003412551.1.42112 WP_003412551.1.4212 WP_003412551.1.42122 WP_003412551.1.42134 WP_003412551.1.42183 WP_003412551.1.42188 WP_003412551.1.42201 WP_003412551.1.42202 WP_003412551.1.42208 WP_003412551.1.42247 WP_003412551.1.42255 WP_003412551.1.42273 WP_003412551.1.42278 WP_003412551.1.42304 WP_003412551.1.42309 WP_003412551.1.42370 WP_003412551.1.42385 WP_003412551.1.42400 WP_003412551.1.42409 WP_003412551.1.42414 WP_003412551.1.42417 WP_003412551.1.42430 WP_003412551.1.42461 WP_003412551.1.42465 WP_003412551.1.42467 WP_003412551.1.42473 WP_003412551.1.42474 WP_003412551.1.4248 WP_003412551.1.42494 WP_003412551.1.42519 WP_003412551.1.42524 WP_003412551.1.42534 WP_003412551.1.4255 WP_003412551.1.42562 WP_003412551.1.42568 WP_003412551.1.42570 WP_003412551.1.42618 WP_003412551.1.42660 WP_003412551.1.42695 WP_003412551.1.42704 WP_003412551.1.42705 WP_003412551.1.42722 WP_003412551.1.42777 WP_003412551.1.42782 WP_003412551.1.42835 WP_003412551.1.42839 WP_003412551.1.42842 WP_003412551.1.42905 WP_003412551.1.42916 WP_003412551.1.42930 WP_003412551.1.42971 WP_003412551.1.43005 WP_003412551.1.43009 WP_003412551.1.43053 WP_003412551.1.43082 WP_003412551.1.43087 WP_003412551.1.43098 WP_003412551.1.43208 WP_003412551.1.43236 WP_003412551.1.43246 WP_003412551.1.43255 WP_003412551.1.43266 WP_003412551.1.43269 WP_003412551.1.43273 WP_003412551.1.43296 WP_003412551.1.43306 WP_003412551.1.4335 WP_003412551.1.43368 WP_003412551.1.43395 WP_003412551.1.43457 WP_003412551.1.43475 WP_003412551.1.43478 WP_003412551.1.43484 WP_003412551.1.43557 WP_003412551.1.43578 WP_003412551.1.43588 WP_003412551.1.43643 WP_003412551.1.43664 WP_003412551.1.43684 WP_003412551.1.43686 WP_003412551.1.43706 WP_003412551.1.43716 WP_003412551.1.4377 WP_003412551.1.43781 WP_003412551.1.43794 WP_003412551.1.43815 WP_003412551.1.43846 WP_003412551.1.43861 WP_003412551.1.43863 WP_003412551.1.43866 WP_003412551.1.43872 WP_003412551.1.43885 WP_003412551.1.43897 WP_003412551.1.4390 WP_003412551.1.43902 WP_003412551.1.43921 WP_003412551.1.43936 WP_003412551.1.43937 WP_003412551.1.43960 WP_003412551.1.43965 WP_003412551.1.4399 WP_003412551.1.43993 WP_003412551.1.43996 WP_003412551.1.44 WP_003412551.1.44001 WP_003412551.1.44008 WP_003412551.1.44016 WP_003412551.1.44033 WP_003412551.1.44037 WP_003412551.1.44041 WP_003412551.1.44070 WP_003412551.1.44071 WP_003412551.1.44076 WP_003412551.1.44104 WP_003412551.1.44111 WP_003412551.1.44124 WP_003412551.1.44169 WP_003412551.1.44219 WP_003412551.1.44237 WP_003412551.1.44277 WP_003412551.1.44279 WP_003412551.1.44336 WP_003412551.1.44355 WP_003412551.1.44358 WP_003412551.1.4438 WP_003412551.1.44390 WP_003412551.1.44392 WP_003412551.1.4441 WP_003412551.1.44415 WP_003412551.1.44464 WP_003412551.1.44466 WP_003412551.1.44489 WP_003412551.1.44492 WP_003412551.1.44494 WP_003412551.1.44500 WP_003412551.1.44519 WP_003412551.1.44526 WP_003412551.1.44532 WP_003412551.1.44534 WP_003412551.1.44562 WP_003412551.1.44589 WP_003412551.1.44597 WP_003412551.1.44600 WP_003412551.1.44602 WP_003412551.1.44615 WP_003412551.1.4464 WP_003412551.1.44651 WP_003412551.1.44659 WP_003412551.1.44665 WP_003412551.1.44694 WP_003412551.1.44700 WP_003412551.1.44713 WP_003412551.1.44735 WP_003412551.1.44740 WP_003412551.1.44757 WP_003412551.1.4476 WP_003412551.1.44761 WP_003412551.1.44767 WP_003412551.1.44776 WP_003412551.1.44779 WP_003412551.1.44786 WP_003412551.1.44808 WP_003412551.1.44864 WP_003412551.1.44901 WP_003412551.1.44908 WP_003412551.1.44913 WP_003412551.1.4492 WP_003412551.1.44939 WP_003412551.1.44979 WP_003412551.1.44981 WP_003412551.1.45002 WP_003412551.1.45011 WP_003412551.1.4504 WP_003412551.1.45062 WP_003412551.1.45066 WP_003412551.1.45081 WP_003412551.1.45113 WP_003412551.1.45129 WP_003412551.1.45135 WP_003412551.1.45147 WP_003412551.1.45168 WP_003412551.1.4517 WP_003412551.1.45181 WP_003412551.1.45185 WP_003412551.1.45192 WP_003412551.1.45200 WP_003412551.1.45205 WP_003412551.1.45211 WP_003412551.1.45249 WP_003412551.1.4526 WP_003412551.1.45286 WP_003412551.1.45326 WP_003412551.1.45347 WP_003412551.1.45374 WP_003412551.1.45390 WP_003412551.1.454 WP_003412551.1.45407 WP_003412551.1.45451 WP_003412551.1.45453 WP_003412551.1.45460 WP_003412551.1.45463 WP_003412551.1.45470 WP_003412551.1.45474 WP_003412551.1.45491 WP_003412551.1.45510 WP_003412551.1.45563 WP_003412551.1.45584 WP_003412551.1.45590 WP_003412551.1.45619 WP_003412551.1.45626 WP_003412551.1.45631 WP_003412551.1.45666 WP_003412551.1.45697 WP_003412551.1.4571 WP_003412551.1.45731 WP_003412551.1.45743 WP_003412551.1.45765 WP_003412551.1.45776 WP_003412551.1.45783 WP_003412551.1.45805 WP_003412551.1.45815 WP_003412551.1.45849 WP_003412551.1.45867 WP_003412551.1.45884 WP_003412551.1.45923 WP_003412551.1.45926 WP_003412551.1.45963 WP_003412551.1.45989 WP_003412551.1.45992 WP_003412551.1.46025 WP_003412551.1.46083 WP_003412551.1.46090 WP_003412551.1.46092 WP_003412551.1.46100 WP_003412551.1.46101 WP_003412551.1.46103 WP_003412551.1.46107 WP_003412551.1.46127 WP_003412551.1.46128 WP_003412551.1.46129 WP_003412551.1.46141 WP_003412551.1.46150 WP_003412551.1.46201 WP_003412551.1.46226 WP_003412551.1.4624 WP_003412551.1.46253 WP_003412551.1.46268 WP_003412551.1.46285 WP_003412551.1.46300 WP_003412551.1.46313 WP_003412551.1.46336 WP_003412551.1.46365 WP_003412551.1.46370 WP_003412551.1.46381 WP_003412551.1.46402 WP_003412551.1.46411 WP_003412551.1.4644 WP_003412551.1.46442 WP_003412551.1.46453 WP_003412551.1.46463 WP_003412551.1.46478 WP_003412551.1.46492 WP_003412551.1.46521 WP_003412551.1.4653 WP_003412551.1.46532 WP_003412551.1.46539 WP_003412551.1.46568 WP_003412551.1.46585 WP_003412551.1.46609 WP_003412551.1.46613 WP_003412551.1.46625 WP_003412551.1.46642 WP_003412551.1.46647 WP_003412551.1.46674 WP_003412551.1.46724 WP_003412551.1.46758 WP_003412551.1.46773 WP_003412551.1.46777 WP_003412551.1.46786 WP_003412551.1.46792 WP_003412551.1.46847 WP_003412551.1.46851 WP_003412551.1.4687 WP_003412551.1.46897 WP_003412551.1.46936 WP_003412551.1.46980 WP_003412551.1.47011 WP_003412551.1.47012 WP_003412551.1.47077 WP_003412551.1.47083 WP_003412551.1.47106 WP_003412551.1.47142 WP_003412551.1.47147 WP_003412551.1.47166 WP_003412551.1.47178 WP_003412551.1.47179 WP_003412551.1.47194 WP_003412551.1.47207 WP_003412551.1.47210 WP_003412551.1.47261 WP_003412551.1.47262 WP_003412551.1.47402 WP_003412551.1.47423 WP_003412551.1.47467 WP_003412551.1.47502 WP_003412551.1.4751 WP_003412551.1.47511 WP_003412551.1.47537 WP_003412551.1.47540 WP_003412551.1.47568 WP_003412551.1.47572 WP_003412551.1.47588 WP_003412551.1.47636 WP_003412551.1.4764 WP_003412551.1.47653 WP_003412551.1.47679 WP_003412551.1.47681 WP_003412551.1.47690 WP_003412551.1.4771 WP_003412551.1.47717 WP_003412551.1.47743 WP_003412551.1.47754 WP_003412551.1.47773 WP_003412551.1.47776 WP_003412551.1.47780 WP_003412551.1.47805 WP_003412551.1.47832 WP_003412551.1.47847 WP_003412551.1.47858 WP_003412551.1.47868 WP_003412551.1.47893 WP_003412551.1.47899 WP_003412551.1.479 WP_003412551.1.47912 WP_003412551.1.47913 WP_003412551.1.47926 WP_003412551.1.4794 WP_003412551.1.47943 WP_003412551.1.47944 WP_003412551.1.47959 WP_003412551.1.47974 WP_003412551.1.47993 WP_003412551.1.48004 WP_003412551.1.48039 WP_003412551.1.48050 WP_003412551.1.48084 WP_003412551.1.48097 WP_003412551.1.48101 WP_003412551.1.48109 WP_003412551.1.4813 WP_003412551.1.48130 WP_003412551.1.48135 WP_003412551.1.48143 WP_003412551.1.48152 WP_003412551.1.48155 WP_003412551.1.48170 WP_003412551.1.48173 WP_003412551.1.48177 WP_003412551.1.48185 WP_003412551.1.48204 WP_003412551.1.48219 WP_003412551.1.4823 WP_003412551.1.48240 WP_003412551.1.48256 WP_003412551.1.48264 WP_003412551.1.48287 WP_003412551.1.48330 WP_003412551.1.48333 WP_003412551.1.48348 WP_003412551.1.48354 WP_003412551.1.48372 WP_003412551.1.48383 WP_003412551.1.48388 WP_003412551.1.48419 WP_003412551.1.48423 WP_003412551.1.48443 WP_003412551.1.48450 WP_003412551.1.48462 WP_003412551.1.48543 WP_003412551.1.48550 WP_003412551.1.48605 WP_003412551.1.48618 WP_003412551.1.4863 WP_003412551.1.48648 WP_003412551.1.48658 WP_003412551.1.48666 WP_003412551.1.48687 WP_003412551.1.48779 WP_003412551.1.4878 WP_003412551.1.48798 WP_003412551.1.48802 WP_003412551.1.48826 WP_003412551.1.48831 WP_003412551.1.48843 WP_003412551.1.48857 WP_003412551.1.4890 WP_003412551.1.48946 WP_003412551.1.48979 WP_003412551.1.49017 WP_003412551.1.49048 WP_003412551.1.49059 WP_003412551.1.4906 WP_003412551.1.4907 WP_003412551.1.49103 WP_003412551.1.49110 WP_003412551.1.49111 WP_003412551.1.49112 WP_003412551.1.4919 WP_003412551.1.49251 WP_003412551.1.49254 WP_003412551.1.49263 WP_003412551.1.49291 WP_003412551.1.49296 WP_003412551.1.49335 WP_003412551.1.49337 WP_003412551.1.49419 WP_003412551.1.49426 WP_003412551.1.49437 WP_003412551.1.49439 WP_003412551.1.49474 WP_003412551.1.49506 WP_003412551.1.49516 WP_003412551.1.49523 WP_003412551.1.49526 WP_003412551.1.49532 WP_003412551.1.49588 WP_003412551.1.4959 WP_003412551.1.49678 WP_003412551.1.49687 WP_003412551.1.49699 WP_003412551.1.49709 WP_003412551.1.4971 WP_003412551.1.4972 WP_003412551.1.49736 WP_003412551.1.49746 WP_003412551.1.49764 WP_003412551.1.49773 WP_003412551.1.49796 WP_003412551.1.49814 WP_003412551.1.49815 WP_003412551.1.49816 WP_003412551.1.49839 WP_003412551.1.49857 WP_003412551.1.49878 WP_003412551.1.49880 WP_003412551.1.49944 WP_003412551.1.4999 WP_003412551.1.49990 WP_003412551.1.50068 WP_003412551.1.50077 WP_003412551.1.5008 WP_003412551.1.50081 WP_003412551.1.50122 WP_003412551.1.50126 WP_003412551.1.50149 WP_003412551.1.50162 WP_003412551.1.5018 WP_003412551.1.50194 WP_003412551.1.50218 WP_003412551.1.50235 WP_003412551.1.50249 WP_003412551.1.50265 WP_003412551.1.50271 WP_003412551.1.50324 WP_003412551.1.50347 WP_003412551.1.50372 WP_003412551.1.50398 WP_003412551.1.50407 WP_003412551.1.50444 WP_003412551.1.50466 WP_003412551.1.50472 WP_003412551.1.5048 WP_003412551.1.50498 WP_003412551.1.5050 WP_003412551.1.50540 WP_003412551.1.50554 WP_003412551.1.50557 WP_003412551.1.50601 WP_003412551.1.50610 WP_003412551.1.50632 WP_003412551.1.50633 WP_003412551.1.50642 WP_003412551.1.50655 WP_003412551.1.50659 WP_003412551.1.50683 WP_003412551.1.50689 WP_003412551.1.50692 WP_003412551.1.50714 WP_003412551.1.50729 WP_003412551.1.50756 WP_003412551.1.50784 WP_003412551.1.50794 WP_003412551.1.50841 WP_003412551.1.50860 WP_003412551.1.50868 WP_003412551.1.50877 WP_003412551.1.5096 WP_003412551.1.50981 WP_003412551.1.50987 WP_003412551.1.51003 WP_003412551.1.51009 WP_003412551.1.51037 WP_003412551.1.51074 WP_003412551.1.51082 WP_003412551.1.51101 WP_003412551.1.51116 WP_003412551.1.51149 WP_003412551.1.51156 WP_003412551.1.51157 WP_003412551.1.51213 WP_003412551.1.51232 WP_003412551.1.51239 WP_003412551.1.51247 WP_003412551.1.51266 WP_003412551.1.51279 WP_003412551.1.51291 WP_003412551.1.51294 WP_003412551.1.51301 WP_003412551.1.51329 WP_003412551.1.51391 WP_003412551.1.51422 WP_003412551.1.51445 WP_003412551.1.51455 WP_003412551.1.51466 WP_003412551.1.51468 WP_003412551.1.51478 WP_003412551.1.51497 WP_003412551.1.51520 WP_003412551.1.51593 WP_003412551.1.51628 WP_003412551.1.5164 WP_003412551.1.51647 WP_003412551.1.51660 WP_003412551.1.51696 WP_003412551.1.51721 WP_003412551.1.51788 WP_003412551.1.51795 WP_003412551.1.51801 WP_003412551.1.51817 WP_003412551.1.51819 WP_003412551.1.51854 WP_003412551.1.51923 WP_003412551.1.51942 WP_003412551.1.51948 WP_003412551.1.51963 WP_003412551.1.51969 WP_003412551.1.52000 WP_003412551.1.52001 WP_003412551.1.52003 WP_003412551.1.52006 WP_003412551.1.52036 WP_003412551.1.52038 WP_003412551.1.52046 WP_003412551.1.52059 WP_003412551.1.52069 WP_003412551.1.52082 WP_003412551.1.52102 WP_003412551.1.52106 WP_003412551.1.52166 WP_003412551.1.52168 WP_003412551.1.52173 WP_003412551.1.52178 WP_003412551.1.52206 WP_003412551.1.52216 WP_003412551.1.52238 WP_003412551.1.52241 WP_003412551.1.52280 WP_003412551.1.52314 WP_003412551.1.52385 WP_003412551.1.52390 WP_003412551.1.524 WP_003412551.1.52460 WP_003412551.1.52485 WP_003412551.1.52486 WP_003412551.1.52495 WP_003412551.1.52504 WP_003412551.1.52522 WP_003412551.1.52531 WP_003412551.1.52533 WP_003412551.1.52545 WP_003412551.1.52553 WP_003412551.1.52563 WP_003412551.1.52564 WP_003412551.1.52574 WP_003412551.1.52641 WP_003412551.1.52673 WP_003412551.1.52674 WP_003412551.1.52708 WP_003412551.1.52713 WP_003412551.1.52761 WP_003412551.1.52778 WP_003412551.1.52791 WP_003412551.1.52797 WP_003412551.1.52818 WP_003412551.1.52872 WP_003412551.1.52873 WP_003412551.1.52891 WP_003412551.1.52892 WP_003412551.1.52909 WP_003412551.1.52970 WP_003412551.1.52998 WP_003412551.1.53053 WP_003412551.1.53056 WP_003412551.1.5306 WP_003412551.1.53088 WP_003412551.1.5309 WP_003412551.1.531 WP_003412551.1.53117 WP_003412551.1.53118 WP_003412551.1.53142 WP_003412551.1.53143 WP_003412551.1.53157 WP_003412551.1.53167 WP_003412551.1.53200 WP_003412551.1.53204 WP_003412551.1.53213 WP_003412551.1.53217 WP_003412551.1.53226 WP_003412551.1.53229 WP_003412551.1.53230 WP_003412551.1.53237 WP_003412551.1.53254 WP_003412551.1.53257 WP_003412551.1.5327 WP_003412551.1.53276 WP_003412551.1.53278 WP_003412551.1.533 WP_003412551.1.53302 WP_003412551.1.53306 WP_003412551.1.5334 WP_003412551.1.5335 WP_003412551.1.53353 WP_003412551.1.53381 WP_003412551.1.53413 WP_003412551.1.53458 WP_003412551.1.53460 WP_003412551.1.53480 WP_003412551.1.53517 WP_003412551.1.53522 WP_003412551.1.53525 WP_003412551.1.53526 WP_003412551.1.53553 WP_003412551.1.53606 WP_003412551.1.53609 WP_003412551.1.53628 WP_003412551.1.53643 WP_003412551.1.53667 WP_003412551.1.53679 WP_003412551.1.53715 WP_003412551.1.53730 WP_003412551.1.53742 WP_003412551.1.53743 WP_003412551.1.53754 WP_003412551.1.53775 WP_003412551.1.53787 WP_003412551.1.53803 WP_003412551.1.53818 WP_003412551.1.53822 WP_003412551.1.53853 WP_003412551.1.53865 WP_003412551.1.53888 WP_003412551.1.53900 WP_003412551.1.53912 WP_003412551.1.53914 WP_003412551.1.53952 WP_003412551.1.53973 WP_003412551.1.5398 WP_003412551.1.5408 WP_003412551.1.54089 WP_003412551.1.54093 WP_003412551.1.54099 WP_003412551.1.54112 WP_003412551.1.54125 WP_003412551.1.54141 WP_003412551.1.54162 WP_003412551.1.54179 WP_003412551.1.54206 WP_003412551.1.54218 WP_003412551.1.54225 WP_003412551.1.54227 WP_003412551.1.54232 WP_003412551.1.54241 WP_003412551.1.54245 WP_003412551.1.54247 WP_003412551.1.54260 WP_003412551.1.54275 WP_003412551.1.54280 WP_003412551.1.5429 WP_003412551.1.54294 WP_003412551.1.54314 WP_003412551.1.54347 WP_003412551.1.54351 WP_003412551.1.54370 WP_003412551.1.54428 WP_003412551.1.54449 WP_003412551.1.54494 WP_003412551.1.54502 WP_003412551.1.54514 WP_003412551.1.54519 WP_003412551.1.5452 WP_003412551.1.54531 WP_003412551.1.54537 WP_003412551.1.54553 WP_003412551.1.54555 WP_003412551.1.54575 WP_003412551.1.54633 WP_003412551.1.54686 WP_003412551.1.54687 WP_003412551.1.54705 WP_003412551.1.54730 WP_003412551.1.54732 WP_003412551.1.5475 WP_003412551.1.54797 WP_003412551.1.54807 WP_003412551.1.54836 WP_003412551.1.54838 WP_003412551.1.54860 WP_003412551.1.54888 WP_003412551.1.54897 WP_003412551.1.54905 WP_003412551.1.54909 WP_003412551.1.54937 WP_003412551.1.54939 WP_003412551.1.54944 WP_003412551.1.54945 WP_003412551.1.54953 WP_003412551.1.54964 WP_003412551.1.55015 WP_003412551.1.55022 WP_003412551.1.55023 WP_003412551.1.55051 WP_003412551.1.55072 WP_003412551.1.55088 WP_003412551.1.55106 WP_003412551.1.55126 WP_003412551.1.55128 WP_003412551.1.55140 WP_003412551.1.55150 WP_003412551.1.55210 WP_003412551.1.55227 WP_003412551.1.55248 WP_003412551.1.55257 WP_003412551.1.55258 WP_003412551.1.55267 WP_003412551.1.55279 WP_003412551.1.55307 WP_003412551.1.55326 WP_003412551.1.55328 WP_003412551.1.5533 WP_003412551.1.55345 WP_003412551.1.55396 WP_003412551.1.55398 WP_003412551.1.55441 WP_003412551.1.55459 WP_003412551.1.55501 WP_003412551.1.55504 WP_003412551.1.55578 WP_003412551.1.55626 WP_003412551.1.55641 WP_003412551.1.5569 WP_003412551.1.55723 WP_003412551.1.55735 WP_003412551.1.5574 WP_003412551.1.55772 WP_003412551.1.55802 WP_003412551.1.55807 WP_003412551.1.55819 WP_003412551.1.55821 WP_003412551.1.5583 WP_003412551.1.55849 WP_003412551.1.55856 WP_003412551.1.55860 WP_003412551.1.55882 WP_003412551.1.55883 WP_003412551.1.55894 WP_003412551.1.55902 WP_003412551.1.55908 WP_003412551.1.55909 WP_003412551.1.5591 WP_003412551.1.55961 WP_003412551.1.55977 WP_003412551.1.56028 WP_003412551.1.56057 WP_003412551.1.56060 WP_003412551.1.56107 WP_003412551.1.56132 WP_003412551.1.56163 WP_003412551.1.56167 WP_003412551.1.56178 WP_003412551.1.56287 WP_003412551.1.56292 WP_003412551.1.56327 WP_003412551.1.56341 WP_003412551.1.56359 WP_003412551.1.56365 WP_003412551.1.56394 WP_003412551.1.56443 WP_003412551.1.56473 WP_003412551.1.56478 WP_003412551.1.56500 WP_003412551.1.56517 WP_003412551.1.56534 WP_003412551.1.5656 WP_003412551.1.56577 WP_003412551.1.56593 WP_003412551.1.56625 WP_003412551.1.56637 WP_003412551.1.56670 WP_003412551.1.56697 WP_003412551.1.567 WP_003412551.1.56701 WP_003412551.1.56709 WP_003412551.1.56729 WP_003412551.1.56743 WP_003412551.1.56755 WP_003412551.1.56764 WP_003412551.1.56769 WP_003412551.1.56770 WP_003412551.1.56795 WP_003412551.1.5681 WP_003412551.1.56827 WP_003412551.1.56839 WP_003412551.1.56863 WP_003412551.1.56868 WP_003412551.1.56869 WP_003412551.1.56915 WP_003412551.1.56926 WP_003412551.1.56961 WP_003412551.1.56971 WP_003412551.1.56972 WP_003412551.1.57023 WP_003412551.1.57035 WP_003412551.1.57077 WP_003412551.1.57087 WP_003412551.1.57094 WP_003412551.1.57134 WP_003412551.1.57151 WP_003412551.1.57169 WP_003412551.1.57208 WP_003412551.1.57212 WP_003412551.1.57230 WP_003412551.1.5724 WP_003412551.1.5725 WP_003412551.1.5727 WP_003412551.1.57273 WP_003412551.1.573 WP_003412551.1.57314 WP_003412551.1.57326 WP_003412551.1.57328 WP_003412551.1.57331 WP_003412551.1.57340 WP_003412551.1.57351 WP_003412551.1.57352 WP_003412551.1.57380 WP_003412551.1.57430 WP_003412551.1.5744 WP_003412551.1.57440 WP_003412551.1.5745 WP_003412551.1.57461 WP_003412551.1.57469 WP_003412551.1.57489 WP_003412551.1.575 WP_003412551.1.57509 WP_003412551.1.57519 WP_003412551.1.57525 WP_003412551.1.57551 WP_003412551.1.5758 WP_003412551.1.57596 WP_003412551.1.57604 WP_003412551.1.57616 WP_003412551.1.57617 WP_003412551.1.57619 WP_003412551.1.57627 WP_003412551.1.57642 WP_003412551.1.57658 WP_003412551.1.57667 WP_003412551.1.57675 WP_003412551.1.57689 WP_003412551.1.57708 WP_003412551.1.57794 WP_003412551.1.57821 WP_003412551.1.57825 WP_003412551.1.57843 WP_003412551.1.57906 WP_003412551.1.57924 WP_003412551.1.57926 WP_003412551.1.57930 WP_003412551.1.57957 WP_003412551.1.57960 WP_003412551.1.57964 WP_003412551.1.57991 WP_003412551.1.58000 WP_003412551.1.58086 WP_003412551.1.58101 WP_003412551.1.58103 WP_003412551.1.58108 WP_003412551.1.5811 WP_003412551.1.58121 WP_003412551.1.58145 WP_003412551.1.58164 WP_003412551.1.58174 WP_003412551.1.582 WP_003412551.1.58202 WP_003412551.1.58209 WP_003412551.1.58215 WP_003412551.1.5824 WP_003412551.1.58250 WP_003412551.1.58259 WP_003412551.1.58283 WP_003412551.1.5830 WP_003412551.1.58303 WP_003412551.1.58311 WP_003412551.1.58330 WP_003412551.1.58359 WP_003412551.1.58386 WP_003412551.1.58393 WP_003412551.1.58431 WP_003412551.1.5844 WP_003412551.1.58457 WP_003412551.1.58488 WP_003412551.1.58518 WP_003412551.1.58534 WP_003412551.1.58559 WP_003412551.1.58567 WP_003412551.1.58573 WP_003412551.1.58602 WP_003412551.1.58612 WP_003412551.1.58619 WP_003412551.1.58630 WP_003412551.1.5865 WP_003412551.1.58671 WP_003412551.1.58690 WP_003412551.1.58702 WP_003412551.1.58743 WP_003412551.1.58754 WP_003412551.1.5879 WP_003412551.1.5881 WP_003412551.1.58824 WP_003412551.1.58848 WP_003412551.1.58857 WP_003412551.1.58891 WP_003412551.1.58892 WP_003412551.1.5890 WP_003412551.1.58904 WP_003412551.1.58921 WP_003412551.1.58930 WP_003412551.1.58939 WP_003412551.1.58941 WP_003412551.1.58953 WP_003412551.1.58961 WP_003412551.1.5898 WP_003412551.1.59025 WP_003412551.1.59029 WP_003412551.1.59037 WP_003412551.1.59044 WP_003412551.1.59085 WP_003412551.1.59088 WP_003412551.1.59112 WP_003412551.1.59130 WP_003412551.1.5914 WP_003412551.1.59147 WP_003412551.1.59166 WP_003412551.1.59205 WP_003412551.1.59209 WP_003412551.1.59237 WP_003412551.1.59240 WP_003412551.1.59253 WP_003412551.1.59254 WP_003412551.1.59262 WP_003412551.1.59270 WP_003412551.1.5928 WP_003412551.1.59304 WP_003412551.1.59305 WP_003412551.1.59309 WP_003412551.1.59316 WP_003412551.1.59326 WP_003412551.1.59328 WP_003412551.1.59333 WP_003412551.1.59338 WP_003412551.1.59388 WP_003412551.1.59428 WP_003412551.1.59487 WP_003412551.1.59537 WP_003412551.1.59561 WP_003412551.1.59677 WP_003412551.1.59722 WP_003412551.1.59732 WP_003412551.1.59738 WP_003412551.1.59750 WP_003412551.1.59757 WP_003412551.1.59761 WP_003412551.1.59808 WP_003412551.1.59850 WP_003412551.1.59856 WP_003412551.1.59860 WP_003412551.1.59861 WP_003412551.1.5987 WP_003412551.1.59878 WP_003412551.1.59888 WP_003412551.1.59952 WP_003412551.1.5996 WP_003412551.1.59961 WP_003412551.1.59974 WP_003412551.1.6000 WP_003412551.1.60007 WP_003412551.1.60016 WP_003412551.1.6003 WP_003412551.1.60047 WP_003412551.1.6007 WP_003412551.1.60091 WP_003412551.1.60121 WP_003412551.1.60125 WP_003412551.1.60135 WP_003412551.1.60139 WP_003412551.1.60152 WP_003412551.1.60171 WP_003412551.1.60197 WP_003412551.1.6020 WP_003412551.1.60205 WP_003412551.1.60207 WP_003412551.1.60215 WP_003412551.1.60217 WP_003412551.1.60267 WP_003412551.1.60288 WP_003412551.1.60291 WP_003412551.1.60301 WP_003412551.1.60305 WP_003412551.1.60312 WP_003412551.1.60313 WP_003412551.1.60314 WP_003412551.1.60367 WP_003412551.1.60376 WP_003412551.1.60403 WP_003412551.1.60413 WP_003412551.1.60421 WP_003412551.1.60451 WP_003412551.1.60460 WP_003412551.1.60479 WP_003412551.1.60487 WP_003412551.1.60512 WP_003412551.1.60573 WP_003412551.1.60583 WP_003412551.1.60632 WP_003412551.1.60657 WP_003412551.1.60687 WP_003412551.1.60689 WP_003412551.1.60727 WP_003412551.1.60738 WP_003412551.1.60763 WP_003412551.1.6077 WP_003412551.1.60791 WP_003412551.1.60834 WP_003412551.1.60870 WP_003412551.1.60878 WP_003412551.1.60879 WP_003412551.1.60913 WP_003412551.1.60978 WP_003412551.1.61000 WP_003412551.1.61001 WP_003412551.1.61012 WP_003412551.1.61014 WP_003412551.1.61015 WP_003412551.1.61037 WP_003412551.1.61052 WP_003412551.1.61065 WP_003412551.1.61100 WP_003412551.1.61101 WP_003412551.1.61138 WP_003412551.1.61142 WP_003412551.1.61198 WP_003412551.1.612 WP_003412551.1.61256 WP_003412551.1.61281 WP_003412551.1.61314 WP_003412551.1.61321 WP_003412551.1.61326 WP_003412551.1.61328 WP_003412551.1.61368 WP_003412551.1.61391 WP_003412551.1.61406 WP_003412551.1.61409 WP_003412551.1.61420 WP_003412551.1.61422 WP_003412551.1.61425 WP_003412551.1.61428 WP_003412551.1.61469 WP_003412551.1.61494 WP_003412551.1.61522 WP_003412551.1.61552 WP_003412551.1.61557 WP_003412551.1.61567 WP_003412551.1.61571 WP_003412551.1.61573 WP_003412551.1.61584 WP_003412551.1.61586 WP_003412551.1.6159 WP_003412551.1.61592 WP_003412551.1.6160 WP_003412551.1.61614 WP_003412551.1.6163 WP_003412551.1.61655 WP_003412551.1.61665 WP_003412551.1.61669 WP_003412551.1.61682 WP_003412551.1.61692 WP_003412551.1.61719 WP_003412551.1.61728 WP_003412551.1.61750 WP_003412551.1.61754 WP_003412551.1.61755 WP_003412551.1.61757 WP_003412551.1.61778 WP_003412551.1.6179 WP_003412551.1.61793 WP_003412551.1.61816 WP_003412551.1.61842 WP_003412551.1.61850 WP_003412551.1.61862 WP_003412551.1.61865 WP_003412551.1.61868 WP_003412551.1.61911 WP_003412551.1.61925 WP_003412551.1.61941 WP_003412551.1.61953 WP_003412551.1.61979 WP_003412551.1.61986 WP_003412551.1.61987 WP_003412551.1.61998 WP_003412551.1.62021 WP_003412551.1.62087 WP_003412551.1.62089 WP_003412551.1.62101 WP_003412551.1.62104 WP_003412551.1.6211 WP_003412551.1.62132 WP_003412551.1.62162 WP_003412551.1.62225 WP_003412551.1.62230 WP_003412551.1.62238 WP_003412551.1.62249 WP_003412551.1.62270 WP_003412551.1.62281 WP_003412551.1.62307 WP_003412551.1.6231 WP_003412551.1.62359 WP_003412551.1.62360 WP_003412551.1.62371 WP_003412551.1.62379 WP_003412551.1.62395 WP_003412551.1.62408 WP_003412551.1.62449 WP_003412551.1.62468 WP_003412551.1.6248 WP_003412551.1.62508 WP_003412551.1.62565 WP_003412551.1.62594 WP_003412551.1.62606 WP_003412551.1.62616 WP_003412551.1.62666 WP_003412551.1.62687 WP_003412551.1.62715 WP_003412551.1.62730 WP_003412551.1.62738 WP_003412551.1.62761 WP_003412551.1.62766 WP_003412551.1.62786 WP_003412551.1.62813 WP_003412551.1.62839 WP_003412551.1.62841 WP_003412551.1.62909 WP_003412551.1.62936 WP_003412551.1.6294 WP_003412551.1.6295 WP_003412551.1.62962 WP_003412551.1.63007 WP_003412551.1.63019 WP_003412551.1.63032 WP_003412551.1.63037 WP_003412551.1.63064 WP_003412551.1.63066 WP_003412551.1.63072 WP_003412551.1.6308 WP_003412551.1.63081 WP_003412551.1.63096 WP_003412551.1.63106 WP_003412551.1.6314 WP_003412551.1.63144 WP_003412551.1.63154 WP_003412551.1.63160 WP_003412551.1.63161 WP_003412551.1.63166 WP_003412551.1.63175 WP_003412551.1.63194 WP_003412551.1.6322 WP_003412551.1.63222 WP_003412551.1.63247 WP_003412551.1.6328 WP_003412551.1.63291 WP_003412551.1.63317 WP_003412551.1.63331 WP_003412551.1.63373 WP_003412551.1.63384 WP_003412551.1.63403 WP_003412551.1.63424 WP_003412551.1.63428 WP_003412551.1.6345 WP_003412551.1.63464 WP_003412551.1.63483 WP_003412551.1.63502 WP_003412551.1.63504 WP_003412551.1.63522 WP_003412551.1.63530 WP_003412551.1.63538 WP_003412551.1.63564 WP_003412551.1.63567 WP_003412551.1.63596 WP_003412551.1.63600 WP_003412551.1.63623 WP_003412551.1.63624 WP_003412551.1.63625 WP_003412551.1.63627 WP_003412551.1.63654 WP_003412551.1.63662 WP_003412551.1.63711 WP_003412551.1.63734 WP_003412551.1.63807 WP_003412551.1.63844 WP_003412551.1.63888 WP_003412551.1.63913 WP_003412551.1.63915 WP_003412551.1.63918 WP_003412551.1.63961 WP_003412551.1.63970 WP_003412551.1.64000 WP_003412551.1.64027 WP_003412551.1.64058 WP_003412551.1.64065 WP_003412551.1.6407 WP_003412551.1.64082 WP_003412551.1.64091 WP_003412551.1.64102 WP_003412551.1.64104 WP_003412551.1.64119 WP_003412551.1.64169 WP_003412551.1.64219 WP_003412551.1.6422 WP_003412551.1.64222 WP_003412551.1.64223 WP_003412551.1.64228 WP_003412551.1.64235 WP_003412551.1.64249 WP_003412551.1.6427 WP_003412551.1.64278 WP_003412551.1.64287 WP_003412551.1.64414 WP_003412551.1.64419 WP_003412551.1.6443 WP_003412551.1.64463 WP_003412551.1.64480 WP_003412551.1.64497 WP_003412551.1.64506 WP_003412551.1.64511 WP_003412551.1.64513 WP_003412551.1.64514 WP_003412551.1.64515 WP_003412551.1.64522 WP_003412551.1.64526 WP_003412551.1.64543 WP_003412551.1.6456 WP_003412551.1.64567 WP_003412551.1.64588 WP_003412551.1.64589 WP_003412551.1.64594 WP_003412551.1.64595 WP_003412551.1.64608 WP_003412551.1.64619 WP_003412551.1.64629 WP_003412551.1.6464 WP_003412551.1.64664 WP_003412551.1.64669 WP_003412551.1.64672 WP_003412551.1.64680 WP_003412551.1.64682 WP_003412551.1.64727 WP_003412551.1.64729 WP_003412551.1.64774 WP_003412551.1.64776 WP_003412551.1.64802 WP_003412551.1.64832 WP_003412551.1.6486 WP_003412551.1.64870 WP_003412551.1.64898 WP_003412551.1.64922 WP_003412551.1.64924 WP_003412551.1.6493 WP_003412551.1.64937 WP_003412551.1.64941 WP_003412551.1.64966 WP_003412551.1.64973 WP_003412551.1.65001 WP_003412551.1.65026 WP_003412551.1.65053 WP_003412551.1.65070 WP_003412551.1.65079 WP_003412551.1.65102 WP_003412551.1.65157 WP_003412551.1.65181 WP_003412551.1.65212 WP_003412551.1.65229 WP_003412551.1.6523 WP_003412551.1.65253 WP_003412551.1.65289 WP_003412551.1.65291 WP_003412551.1.65315 WP_003412551.1.65329 WP_003412551.1.65359 WP_003412551.1.6536 WP_003412551.1.65374 WP_003412551.1.65386 WP_003412551.1.65414 WP_003412551.1.65416 WP_003412551.1.65433 WP_003412551.1.65455 WP_003412551.1.65467 WP_003412551.1.65488 WP_003412551.1.65529 WP_003412551.1.65539 WP_003412551.1.65583 WP_003412551.1.65612 WP_003412551.1.65623 WP_003412551.1.65635 WP_003412551.1.65637 WP_003412551.1.65648 WP_003412551.1.65683 WP_003412551.1.65686 WP_003412551.1.65688 WP_003412551.1.65707 WP_003412551.1.65733 WP_003412551.1.65746 WP_003412551.1.65747 WP_003412551.1.65759 WP_003412551.1.65816 WP_003412551.1.65830 WP_003412551.1.65858 WP_003412551.1.65862 WP_003412551.1.65869 WP_003412551.1.65893 WP_003412551.1.65929 WP_003412551.1.65932 WP_003412551.1.65958 WP_003412551.1.65974 WP_003412551.1.66004 WP_003412551.1.66013 WP_003412551.1.6606 WP_003412551.1.66089 WP_003412551.1.66149 WP_003412551.1.66151 WP_003412551.1.66229 WP_003412551.1.66276 WP_003412551.1.66293 WP_003412551.1.66297 WP_003412551.1.66323 WP_003412551.1.66325 WP_003412551.1.6633 WP_003412551.1.66334 WP_003412551.1.66355 WP_003412551.1.66367 WP_003412551.1.66394 WP_003412551.1.66396 WP_003412551.1.66451 WP_003412551.1.66455 WP_003412551.1.66457 WP_003412551.1.66460 WP_003412551.1.66464 WP_003412551.1.66466 WP_003412551.1.66487 WP_003412551.1.66504 WP_003412551.1.66544 WP_003412551.1.66558 WP_003412551.1.66580 WP_003412551.1.66582 WP_003412551.1.66612 WP_003412551.1.66615 WP_003412551.1.66617 WP_003412551.1.66635 WP_003412551.1.66656 WP_003412551.1.66663 WP_003412551.1.66675 WP_003412551.1.66715 WP_003412551.1.66718 WP_003412551.1.66762 WP_003412551.1.66776 WP_003412551.1.66808 WP_003412551.1.66817 WP_003412551.1.66819 WP_003412551.1.66826 WP_003412551.1.66830 WP_003412551.1.66842 WP_003412551.1.66868 WP_003412551.1.66878 WP_003412551.1.66880 WP_003412551.1.66893 WP_003412551.1.66961 WP_003412551.1.67005 WP_003412551.1.6704 WP_003412551.1.67044 WP_003412551.1.67061 WP_003412551.1.67089 WP_003412551.1.67098 WP_003412551.1.67146 WP_003412551.1.67170 WP_003412551.1.67197 WP_003412551.1.67198 WP_003412551.1.6720 WP_003412551.1.67207 WP_003412551.1.67218 WP_003412551.1.67220 WP_003412551.1.67225 WP_003412551.1.67231 WP_003412551.1.6724 WP_003412551.1.67257 WP_003412551.1.67298 WP_003412551.1.67307 WP_003412551.1.67324 WP_003412551.1.67332 WP_003412551.1.67346 WP_003412551.1.67354 WP_003412551.1.67360 WP_003412551.1.67381 WP_003412551.1.67396 WP_003412551.1.67417 WP_003412551.1.67422 WP_003412551.1.67453 WP_003412551.1.67459 WP_003412551.1.67473 WP_003412551.1.67481 WP_003412551.1.67482 WP_003412551.1.67496 WP_003412551.1.67499 WP_003412551.1.67516 WP_003412551.1.67523 WP_003412551.1.67536 WP_003412551.1.67575 WP_003412551.1.67587 WP_003412551.1.67598 WP_003412551.1.67600 WP_003412551.1.67602 WP_003412551.1.67630 WP_003412551.1.67679 WP_003412551.1.67692 WP_003412551.1.67744 WP_003412551.1.6775 WP_003412551.1.67750 WP_003412551.1.6777 WP_003412551.1.67809 WP_003412551.1.67816 WP_003412551.1.67844 WP_003412551.1.67848 WP_003412551.1.67870 WP_003412551.1.67888 WP_003412551.1.67915 WP_003412551.1.67945 WP_003412551.1.67949 WP_003412551.1.67980 WP_003412551.1.67982 WP_003412551.1.68022 WP_003412551.1.68029 WP_003412551.1.68037 WP_003412551.1.68038 WP_003412551.1.68045 WP_003412551.1.68057 WP_003412551.1.68083 WP_003412551.1.68088 WP_003412551.1.68106 WP_003412551.1.68110 WP_003412551.1.68153 WP_003412551.1.68164 WP_003412551.1.68169 WP_003412551.1.68193 WP_003412551.1.68212 WP_003412551.1.68227 WP_003412551.1.68243 WP_003412551.1.6825 WP_003412551.1.68297 WP_003412551.1.68309 WP_003412551.1.68325 WP_003412551.1.68329 WP_003412551.1.68340 WP_003412551.1.68384 WP_003412551.1.68388 WP_003412551.1.68429 WP_003412551.1.6843 WP_003412551.1.68433 WP_003412551.1.68444 WP_003412551.1.68465 WP_003412551.1.68484 WP_003412551.1.68518 WP_003412551.1.68569 WP_003412551.1.68576 WP_003412551.1.68580 WP_003412551.1.68586 WP_003412551.1.68623 WP_003412551.1.68624 WP_003412551.1.68637 WP_003412551.1.68646 WP_003412551.1.68667 WP_003412551.1.68669 WP_003412551.1.68672 WP_003412551.1.68684 WP_003412551.1.68704 WP_003412551.1.68708 WP_003412551.1.6872 WP_003412551.1.68730 WP_003412551.1.68734 WP_003412551.1.68748 WP_003412551.1.68754 WP_003412551.1.6876 WP_003412551.1.68761 WP_003412551.1.68763 WP_003412551.1.68766 WP_003412551.1.68774 WP_003412551.1.68796 WP_003412551.1.68824 WP_003412551.1.68832 WP_003412551.1.68833 WP_003412551.1.68841 WP_003412551.1.68859 WP_003412551.1.68876 WP_003412551.1.68906 WP_003412551.1.68916 WP_003412551.1.68923 WP_003412551.1.68945 WP_003412551.1.6896 WP_003412551.1.68981 WP_003412551.1.68984 WP_003412551.1.68997 WP_003412551.1.69008 WP_003412551.1.69076 WP_003412551.1.69079 WP_003412551.1.6908 WP_003412551.1.69082 WP_003412551.1.69178 WP_003412551.1.69181 WP_003412551.1.69208 WP_003412551.1.69231 WP_003412551.1.69256 WP_003412551.1.69311 WP_003412551.1.69315 WP_003412551.1.69322 WP_003412551.1.69342 WP_003412551.1.6935 WP_003412551.1.6936 WP_003412551.1.69369 WP_003412551.1.69374 WP_003412551.1.69398 WP_003412551.1.69401 WP_003412551.1.69426 WP_003412551.1.69427 WP_003412551.1.69429 WP_003412551.1.6949 WP_003412551.1.6951 WP_003412551.1.69511 WP_003412551.1.69526 WP_003412551.1.69528 WP_003412551.1.69547 WP_003412551.1.69573 WP_003412551.1.69581 WP_003412551.1.6960 WP_003412551.1.69617 WP_003412551.1.69634 WP_003412551.1.69647 WP_003412551.1.69659 WP_003412551.1.69673 WP_003412551.1.69682 WP_003412551.1.69684 WP_003412551.1.69686 WP_003412551.1.69707 WP_003412551.1.69709 WP_003412551.1.69723 WP_003412551.1.69736 WP_003412551.1.69778 WP_003412551.1.69800 WP_003412551.1.69802 WP_003412551.1.69845 WP_003412551.1.69870 WP_003412551.1.69873 WP_003412551.1.69898 WP_003412551.1.69913 WP_003412551.1.69925 WP_003412551.1.69931 WP_003412551.1.69938 WP_003412551.1.69955 WP_003412551.1.69957 WP_003412551.1.69981 WP_003412551.1.69990 WP_003412551.1.70 WP_003412551.1.70000 WP_003412551.1.70017 WP_003412551.1.70032 WP_003412551.1.70055 WP_003412551.1.70062 WP_003412551.1.70072 WP_003412551.1.70131 WP_003412551.1.70132 WP_003412551.1.7022 WP_003412551.1.70227 WP_003412551.1.70255 WP_003412551.1.70271 WP_003412551.1.70274 WP_003412551.1.7029 WP_003412551.1.70325 WP_003412551.1.70328 WP_003412551.1.70356 WP_003412551.1.70364 WP_003412551.1.70368 WP_003412551.1.70369 WP_003412551.1.70418 WP_003412551.1.70422 WP_003412551.1.70435 WP_003412551.1.70444 WP_003412551.1.70463 WP_003412551.1.70471 WP_003412551.1.70480 WP_003412551.1.70494 WP_003412551.1.70498 WP_003412551.1.70505 WP_003412551.1.70525 WP_003412551.1.70573 WP_003412551.1.70577 WP_003412551.1.70610 WP_003412551.1.70615 WP_003412551.1.70618 WP_003412551.1.70622 WP_003412551.1.70626 WP_003412551.1.70668 WP_003412551.1.70699 WP_003412551.1.70704 WP_003412551.1.70729 WP_003412551.1.70757 WP_003412551.1.70782 WP_003412551.1.70796 WP_003412551.1.70830 WP_003412551.1.70834 WP_003412551.1.7084 WP_003412551.1.70840 WP_003412551.1.70864 WP_003412551.1.70871 WP_003412551.1.70915 WP_003412551.1.70955 WP_003412551.1.70958 WP_003412551.1.70964 WP_003412551.1.70976 WP_003412551.1.71015 WP_003412551.1.71026 WP_003412551.1.71063 WP_003412551.1.71076 WP_003412551.1.71083 WP_003412551.1.7111 WP_003412551.1.71118 WP_003412551.1.71128 WP_003412551.1.7113 WP_003412551.1.71187 WP_003412551.1.71191 WP_003412551.1.71255 WP_003412551.1.71258 WP_003412551.1.71259 WP_003412551.1.71289 WP_003412551.1.71326 WP_003412551.1.71329 WP_003412551.1.71331 WP_003412551.1.71344 WP_003412551.1.71390 WP_003412551.1.71399 WP_003412551.1.71414 WP_003412551.1.71457 WP_003412551.1.7146 WP_003412551.1.71464 WP_003412551.1.71490 WP_003412551.1.71492 WP_003412551.1.71509 WP_003412551.1.71516 WP_003412551.1.71517 WP_003412551.1.71527 WP_003412551.1.71532 WP_003412551.1.71545 WP_003412551.1.71546 WP_003412551.1.71569 WP_003412551.1.71604 WP_003412551.1.71621 WP_003412551.1.71630 WP_003412551.1.71638 WP_003412551.1.71654 WP_003412551.1.71664 WP_003412551.1.71665 WP_003412551.1.71683 WP_003412551.1.71701 WP_003412551.1.71718 WP_003412551.1.71731 WP_003412551.1.71778 WP_003412551.1.71781 WP_003412551.1.71803 WP_003412551.1.71820 WP_003412551.1.71847 WP_003412551.1.7185 WP_003412551.1.71851 WP_003412551.1.71871 WP_003412551.1.71909 WP_003412551.1.71957 WP_003412551.1.71970 WP_003412551.1.72047 WP_003412551.1.72061 WP_003412551.1.72062 WP_003412551.1.72072 WP_003412551.1.72111 WP_003412551.1.72122 WP_003412551.1.72128 WP_003412551.1.72143 WP_003412551.1.7216 WP_003412551.1.72168 WP_003412551.1.72179 WP_003412551.1.72209 WP_003412551.1.72218 WP_003412551.1.72219 WP_003412551.1.72227 WP_003412551.1.7224 WP_003412551.1.72268 WP_003412551.1.72332 WP_003412551.1.72380 WP_003412551.1.72401 WP_003412551.1.72405 WP_003412551.1.72420 WP_003412551.1.72441 WP_003412551.1.72451 WP_003412551.1.72452 WP_003412551.1.72457 WP_003412551.1.72459 WP_003412551.1.72460 WP_003412551.1.72466 WP_003412551.1.72487 WP_003412551.1.72488 WP_003412551.1.72492 WP_003412551.1.72506 WP_003412551.1.72543 WP_003412551.1.7256 WP_003412551.1.72576 WP_003412551.1.72578 WP_003412551.1.72585 WP_003412551.1.72591 WP_003412551.1.72592 WP_003412551.1.7266 WP_003412551.1.72661 WP_003412551.1.72684 WP_003412551.1.72739 WP_003412551.1.72744 WP_003412551.1.72755 WP_003412551.1.72784 WP_003412551.1.72792 WP_003412551.1.72826 WP_003412551.1.72831 WP_003412551.1.72852 WP_003412551.1.72853 WP_003412551.1.72879 WP_003412551.1.72880 WP_003412551.1.72938 WP_003412551.1.72954 WP_003412551.1.72957 WP_003412551.1.72959 WP_003412551.1.72973 WP_003412551.1.7298 WP_003412551.1.72982 WP_003412551.1.72988 WP_003412551.1.72993 WP_003412551.1.73006 WP_003412551.1.73013 WP_003412551.1.73025 WP_003412551.1.73028 WP_003412551.1.73042 WP_003412551.1.73045 WP_003412551.1.73092 WP_003412551.1.73118 WP_003412551.1.7312 WP_003412551.1.73127 WP_003412551.1.73134 WP_003412551.1.73150 WP_003412551.1.73154 WP_003412551.1.73163 WP_003412551.1.73182 WP_003412551.1.73205 WP_003412551.1.7321 WP_003412551.1.73310 WP_003412551.1.73315 WP_003412551.1.73365 WP_003412551.1.73391 WP_003412551.1.73404 WP_003412551.1.73424 WP_003412551.1.73436 WP_003412551.1.73445 WP_003412551.1.73453 WP_003412551.1.73465 WP_003412551.1.73466 WP_003412551.1.73470 WP_003412551.1.73471 WP_003412551.1.73478 WP_003412551.1.73482 WP_003412551.1.73507 WP_003412551.1.73532 WP_003412551.1.73550 WP_003412551.1.73564 WP_003412551.1.73623 WP_003412551.1.73629 WP_003412551.1.73644 WP_003412551.1.7366 WP_003412551.1.73661 WP_003412551.1.7368 WP_003412551.1.73688 WP_003412551.1.73723 WP_003412551.1.73744 WP_003412551.1.73750 WP_003412551.1.73760 WP_003412551.1.73774 WP_003412551.1.7379 WP_003412551.1.73813 WP_003412551.1.73840 WP_003412551.1.73876 WP_003412551.1.7389 WP_003412551.1.73986 WP_003412551.1.74016 WP_003412551.1.74039 WP_003412551.1.74083 WP_003412551.1.74101 WP_003412551.1.74107 WP_003412551.1.74120 WP_003412551.1.74129 WP_003412551.1.74144 WP_003412551.1.7417 WP_003412551.1.74190 WP_003412551.1.74210 WP_003412551.1.7423 WP_003412551.1.74259 WP_003412551.1.74262 WP_003412551.1.74269 WP_003412551.1.74282 WP_003412551.1.74291 WP_003412551.1.74296 WP_003412551.1.74304 WP_003412551.1.7432 WP_003412551.1.74347 WP_003412551.1.7436 WP_003412551.1.74378 WP_003412551.1.74382 WP_003412551.1.74395 WP_003412551.1.74400 WP_003412551.1.74401 WP_003412551.1.74432 WP_003412551.1.74442 WP_003412551.1.74477 WP_003412551.1.74487 WP_003412551.1.74499 WP_003412551.1.74504 WP_003412551.1.74511 WP_003412551.1.74523 WP_003412551.1.74525 WP_003412551.1.74551 WP_003412551.1.74555 WP_003412551.1.74628 WP_003412551.1.74641 WP_003412551.1.74653 WP_003412551.1.74660 WP_003412551.1.74683 WP_003412551.1.7469 WP_003412551.1.74725 WP_003412551.1.74760 WP_003412551.1.74786 WP_003412551.1.74809 WP_003412551.1.74820 WP_003412551.1.74870 WP_003412551.1.74881 WP_003412551.1.74888 WP_003412551.1.74952 WP_003412551.1.7496 WP_003412551.1.74988 WP_003412551.1.75043 WP_003412551.1.75045 WP_003412551.1.75055 WP_003412551.1.75078 WP_003412551.1.75081 WP_003412551.1.75120 WP_003412551.1.75163 WP_003412551.1.75188 WP_003412551.1.75200 WP_003412551.1.75202 WP_003412551.1.75234 WP_003412551.1.75239 WP_003412551.1.75250 WP_003412551.1.75263 WP_003412551.1.75281 WP_003412551.1.75342 WP_003412551.1.7535 WP_003412551.1.75376 WP_003412551.1.75391 WP_003412551.1.75395 WP_003412551.1.75441 WP_003412551.1.75510 WP_003412551.1.75581 WP_003412551.1.75598 WP_003412551.1.75635 WP_003412551.1.75645 WP_003412551.1.75665 WP_003412551.1.75671 WP_003412551.1.75741 WP_003412551.1.75749 WP_003412551.1.75772 WP_003412551.1.75774 WP_003412551.1.75811 WP_003412551.1.75833 WP_003412551.1.7585 WP_003412551.1.75864 WP_003412551.1.75868 WP_003412551.1.75878 WP_003412551.1.75927 WP_003412551.1.75946 WP_003412551.1.75968 WP_003412551.1.75974 WP_003412551.1.76007 WP_003412551.1.76016 WP_003412551.1.76032 WP_003412551.1.76037 WP_003412551.1.7604 WP_003412551.1.76045 WP_003412551.1.76052 WP_003412551.1.76058 WP_003412551.1.76064 WP_003412551.1.76110 WP_003412551.1.76126 WP_003412551.1.76133 WP_003412551.1.76138 WP_003412551.1.76157 WP_003412551.1.76172 WP_003412551.1.76177 WP_003412551.1.76183 WP_003412551.1.76239 WP_003412551.1.76272 WP_003412551.1.76277 WP_003412551.1.76280 WP_003412551.1.76281 WP_003412551.1.76291 WP_003412551.1.76297 WP_003412551.1.76360 WP_003412551.1.76403 WP_003412551.1.76413 WP_003412551.1.76414 WP_003412551.1.76427 WP_003412551.1.76436 WP_003412551.1.76442 WP_003412551.1.76443 WP_003412551.1.76456 WP_003412551.1.76521 WP_003412551.1.76533 WP_003412551.1.76616 WP_003412551.1.76625 WP_003412551.1.76629 WP_003412551.1.76635 WP_003412551.1.76638 WP_003412551.1.76639 WP_003412551.1.76640 WP_003412551.1.76644 WP_003412551.1.76677 WP_003412551.1.76678 WP_003412551.1.76679 WP_003412551.1.76734 WP_003412551.1.76744 WP_003412551.1.76750 WP_003412551.1.76754 WP_003412551.1.76757 WP_003412551.1.76781 WP_003412551.1.76818 WP_003412551.1.76824 WP_003412551.1.76835 WP_003412551.1.76873 WP_003412551.1.76881 WP_003412551.1.76888 WP_003412551.1.76900 WP_003412551.1.7691 WP_003412551.1.76947 WP_003412551.1.76954 WP_003412551.1.76955 WP_003412551.1.76963 WP_003412551.1.76976 WP_003412551.1.770 WP_003412551.1.77000 WP_003412551.1.77008 WP_003412551.1.77021 WP_003412551.1.77056 WP_003412551.1.77065 WP_003412551.1.77075 WP_003412551.1.77093 WP_003412551.1.77107 WP_003412551.1.77115 WP_003412551.1.77118 WP_003412551.1.77125 WP_003412551.1.77141 WP_003412551.1.77142 WP_003412551.1.77166 WP_003412551.1.77250 WP_003412551.1.77252 WP_003412551.1.77260 WP_003412551.1.77266 WP_003412551.1.77280 WP_003412551.1.77285 WP_003412551.1.77312 WP_003412551.1.77348 WP_003412551.1.77351 WP_003412551.1.77352 WP_003412551.1.77361 WP_003412551.1.774 WP_003412551.1.7740 WP_003412551.1.77404 WP_003412551.1.77425 WP_003412551.1.77463 WP_003412551.1.77474 WP_003412551.1.7748 WP_003412551.1.77484 WP_003412551.1.77491 WP_003412551.1.77499 WP_003412551.1.77510 WP_003412551.1.77530 WP_003412551.1.77554 WP_003412551.1.77559 WP_003412551.1.77599 WP_003412551.1.77605 WP_003412551.1.7762 WP_003412551.1.77627 WP_003412551.1.77649 WP_003412551.1.77654 WP_003412551.1.7766 WP_003412551.1.77667 WP_003412551.1.77704 WP_003412551.1.77706 WP_003412551.1.77726 WP_003412551.1.77774 WP_003412551.1.7778 WP_003412551.1.77790 WP_003412551.1.77809 WP_003412551.1.77820 WP_003412551.1.77843 WP_003412551.1.77855 WP_003412551.1.77865 WP_003412551.1.77868 WP_003412551.1.77879 WP_003412551.1.77890 WP_003412551.1.77909 WP_003412551.1.77911 WP_003412551.1.77931 WP_003412551.1.77984 WP_003412551.1.78020 WP_003412551.1.78024 WP_003412551.1.78075 WP_003412551.1.78084 WP_003412551.1.78086 WP_003412551.1.7809 WP_003412551.1.78098 WP_003412551.1.78105 WP_003412551.1.78113 WP_003412551.1.78136 WP_003412551.1.78162 WP_003412551.1.7817 WP_003412551.1.78200 WP_003412551.1.78216 WP_003412551.1.78236 WP_003412551.1.78238 WP_003412551.1.78322 WP_003412551.1.78338 WP_003412551.1.7836 WP_003412551.1.78360 WP_003412551.1.78386 WP_003412551.1.78429 WP_003412551.1.78435 WP_003412551.1.7844 WP_003412551.1.78459 WP_003412551.1.78488 WP_003412551.1.7849 WP_003412551.1.78499 WP_003412551.1.785 WP_003412551.1.78516 WP_003412551.1.78524 WP_003412551.1.78526 WP_003412551.1.78538 WP_003412551.1.78544 WP_003412551.1.78545 WP_003412551.1.78547 WP_003412551.1.78574 WP_003412551.1.78580 WP_003412551.1.7860 WP_003412551.1.78620 WP_003412551.1.78646 WP_003412551.1.78648 WP_003412551.1.78649 WP_003412551.1.78655 WP_003412551.1.78657 WP_003412551.1.78659 WP_003412551.1.7869 WP_003412551.1.78692 WP_003412551.1.78760 WP_003412551.1.78766 WP_003412551.1.78776 WP_003412551.1.78778 WP_003412551.1.78784 WP_003412551.1.78788 WP_003412551.1.78790 WP_003412551.1.78793 WP_003412551.1.78848 WP_003412551.1.78860 WP_003412551.1.7887 WP_003412551.1.78884 WP_003412551.1.78932 WP_003412551.1.78969 WP_003412551.1.78977 WP_003412551.1.78980 WP_003412551.1.79005 WP_003412551.1.79016 WP_003412551.1.79033 WP_003412551.1.79064 WP_003412551.1.79066 WP_003412551.1.79068 WP_003412551.1.79077 WP_003412551.1.79095 WP_003412551.1.79112 WP_003412551.1.79122 WP_003412551.1.79145 WP_003412551.1.79152 WP_003412551.1.79163 WP_003412551.1.79182 WP_003412551.1.79198 WP_003412551.1.79213 WP_003412551.1.79218 WP_003412551.1.79268 WP_003412551.1.79273 WP_003412551.1.79278 WP_003412551.1.79290 WP_003412551.1.79319 WP_003412551.1.79325 WP_003412551.1.79326 WP_003412551.1.79330 WP_003412551.1.79339 WP_003412551.1.79394 WP_003412551.1.79399 WP_003412551.1.79413 WP_003412551.1.79422 WP_003412551.1.79445 WP_003412551.1.79447 WP_003412551.1.79455 WP_003412551.1.79471 WP_003412551.1.79480 WP_003412551.1.79482 WP_003412551.1.79488 WP_003412551.1.79500 WP_003412551.1.79502 WP_003412551.1.79508 WP_003412551.1.79514 WP_003412551.1.79561 WP_003412551.1.79565 WP_003412551.1.79578 WP_003412551.1.79588 WP_003412551.1.79598 WP_003412551.1.79615 WP_003412551.1.79684 WP_003412551.1.79698 WP_003412551.1.797 WP_003412551.1.79744 WP_003412551.1.79784 WP_003412551.1.79802 WP_003412551.1.79806 WP_003412551.1.79819 WP_003412551.1.79826 WP_003412551.1.79828 WP_003412551.1.79851 WP_003412551.1.79853 WP_003412551.1.79863 WP_003412551.1.79881 WP_003412551.1.79885 WP_003412551.1.79898 WP_003412551.1.7990 WP_003412551.1.79900 WP_003412551.1.79913 WP_003412551.1.79918 WP_003412551.1.79947 WP_003412551.1.79948 WP_003412551.1.7995 WP_003412551.1.7997 WP_003412551.1.80004 WP_003412551.1.80015 WP_003412551.1.80022 WP_003412551.1.80030 WP_003412551.1.80054 WP_003412551.1.80084 WP_003412551.1.80099 WP_003412551.1.80129 WP_003412551.1.80177 WP_003412551.1.80234 WP_003412551.1.8026 WP_003412551.1.80275 WP_003412551.1.8029 WP_003412551.1.80299 WP_003412551.1.80300 WP_003412551.1.80304 WP_003412551.1.80326 WP_003412551.1.80351 WP_003412551.1.8037 WP_003412551.1.80370 WP_003412551.1.80387 WP_003412551.1.80399 WP_003412551.1.8044 WP_003412551.1.80451 WP_003412551.1.80458 WP_003412551.1.80461 WP_003412551.1.80490 WP_003412551.1.80503 WP_003412551.1.80507 WP_003412551.1.80552 WP_003412551.1.80576 WP_003412551.1.80588 WP_003412551.1.80599 WP_003412551.1.8060 WP_003412551.1.80624 WP_003412551.1.80636 WP_003412551.1.80669 WP_003412551.1.80673 WP_003412551.1.80711 WP_003412551.1.80714 WP_003412551.1.80743 WP_003412551.1.80784 WP_003412551.1.80815 WP_003412551.1.80853 WP_003412551.1.80918 WP_003412551.1.8093 WP_003412551.1.80967 WP_003412551.1.8097 WP_003412551.1.80988 WP_003412551.1.81007 WP_003412551.1.81013 WP_003412551.1.8105 WP_003412551.1.81059 WP_003412551.1.81063 WP_003412551.1.81066 WP_003412551.1.81075 WP_003412551.1.81091 WP_003412551.1.81119 WP_003412551.1.81136 WP_003412551.1.8114 WP_003412551.1.81189 WP_003412551.1.81192 WP_003412551.1.812 WP_003412551.1.81230 WP_003412551.1.81249 WP_003412551.1.81250 WP_003412551.1.81264 WP_003412551.1.8128 WP_003412551.1.81297 WP_003412551.1.8138 WP_003412551.1.81407 WP_003412551.1.8143 WP_003412551.1.81439 WP_003412551.1.81465 WP_003412551.1.81505 WP_003412551.1.81529 WP_003412551.1.81538 WP_003412551.1.81541 WP_003412551.1.81560 WP_003412551.1.81561 WP_003412551.1.81567 WP_003412551.1.81583 WP_003412551.1.81686 WP_003412551.1.81712 WP_003412551.1.81720 WP_003412551.1.81731 WP_003412551.1.81774 WP_003412551.1.81788 WP_003412551.1.81809 WP_003412551.1.81820 WP_003412551.1.81850 WP_003412551.1.81883 WP_003412551.1.81891 WP_003412551.1.81911 WP_003412551.1.81918 WP_003412551.1.82011 WP_003412551.1.82048 WP_003412551.1.82069 WP_003412551.1.82071 WP_003412551.1.82108 WP_003412551.1.82136 WP_003412551.1.82142 WP_003412551.1.8215 WP_003412551.1.82158 WP_003412551.1.8217 WP_003412551.1.82209 WP_003412551.1.82210 WP_003412551.1.82228 WP_003412551.1.82236 WP_003412551.1.82251 WP_003412551.1.82271 WP_003412551.1.82305 WP_003412551.1.82307 WP_003412551.1.82309 WP_003412551.1.82317 WP_003412551.1.8232 WP_003412551.1.82346 WP_003412551.1.82374 WP_003412551.1.82385 WP_003412551.1.82429 WP_003412551.1.82460 WP_003412551.1.82462 WP_003412551.1.82483 WP_003412551.1.82494 WP_003412551.1.82531 WP_003412551.1.82546 WP_003412551.1.82549 WP_003412551.1.82577 WP_003412551.1.82592 WP_003412551.1.82597 WP_003412551.1.82598 WP_003412551.1.82625 WP_003412551.1.82642 WP_003412551.1.82651 WP_003412551.1.82653 WP_003412551.1.82681 WP_003412551.1.82685 WP_003412551.1.8271 WP_003412551.1.82712 WP_003412551.1.8273 WP_003412551.1.82743 WP_003412551.1.82757 WP_003412551.1.82774 WP_003412551.1.82803 WP_003412551.1.82836 WP_003412551.1.82860 WP_003412551.1.82871 WP_003412551.1.82892 WP_003412551.1.82935 WP_003412551.1.82957 WP_003412551.1.82973 WP_003412551.1.82981 WP_003412551.1.82983 WP_003412551.1.83004 WP_003412551.1.83009 WP_003412551.1.83044 WP_003412551.1.83065 WP_003412551.1.83074 WP_003412551.1.83110 WP_003412551.1.83146 WP_003412551.1.83149 WP_003412551.1.83159 WP_003412551.1.8317 WP_003412551.1.83173 WP_003412551.1.83181 WP_003412551.1.83182 WP_003412551.1.83191 WP_003412551.1.83197 WP_003412551.1.83212 WP_003412551.1.8326 WP_003412551.1.83262 WP_003412551.1.83268 WP_003412551.1.83273 WP_003412551.1.83309 WP_003412551.1.83332 WP_003412551.1.83334 WP_003412551.1.83341 WP_003412551.1.83349 WP_003412551.1.8335 WP_003412551.1.83353 WP_003412551.1.83367 WP_003412551.1.83380 WP_003412551.1.83381 WP_003412551.1.83389 WP_003412551.1.83408 WP_003412551.1.83409 WP_003412551.1.83435 WP_003412551.1.83470 WP_003412551.1.83524 WP_003412551.1.83526 WP_003412551.1.8358 WP_003412551.1.83589 WP_003412551.1.83601 WP_003412551.1.83611 WP_003412551.1.83638 WP_003412551.1.83648 WP_003412551.1.83656 WP_003412551.1.83667 WP_003412551.1.83689 WP_003412551.1.83692 WP_003412551.1.83704 WP_003412551.1.83705 WP_003412551.1.83766 WP_003412551.1.83793 WP_003412551.1.83794 WP_003412551.1.83802 WP_003412551.1.83805 WP_003412551.1.83839 WP_003412551.1.83842 WP_003412551.1.83850 WP_003412551.1.83861 WP_003412551.1.83884 WP_003412551.1.83920 WP_003412551.1.83929 WP_003412551.1.83930 WP_003412551.1.83975 WP_003412551.1.83991 WP_003412551.1.8400 WP_003412551.1.84027 WP_003412551.1.8404 WP_003412551.1.84057 WP_003412551.1.84070 WP_003412551.1.8409 WP_003412551.1.84112 WP_003412551.1.84146 WP_003412551.1.8415 WP_003412551.1.84176 WP_003412551.1.84186 WP_003412551.1.84192 WP_003412551.1.84228 WP_003412551.1.8424 WP_003412551.1.84244 WP_003412551.1.84259 WP_003412551.1.8426 WP_003412551.1.84277 WP_003412551.1.84287 WP_003412551.1.8434 WP_003412551.1.84388 WP_003412551.1.84408 WP_003412551.1.84409 WP_003412551.1.84438 WP_003412551.1.84460 WP_003412551.1.84488 WP_003412551.1.84504 WP_003412551.1.84525 WP_003412551.1.84620 WP_003412551.1.84623 WP_003412551.1.84641 WP_003412551.1.84655 WP_003412551.1.84666 WP_003412551.1.84670 WP_003412551.1.84739 WP_003412551.1.84748 WP_003412551.1.84766 WP_003412551.1.84772 WP_003412551.1.84774 WP_003412551.1.848 WP_003412551.1.84812 WP_003412551.1.84836 WP_003412551.1.84839 WP_003412551.1.84846 WP_003412551.1.84873 WP_003412551.1.84911 WP_003412551.1.84938 WP_003412551.1.84968 WP_003412551.1.84973 WP_003412551.1.84981 WP_003412551.1.84985 WP_003412551.1.8503 WP_003412551.1.85038 WP_003412551.1.85041 WP_003412551.1.85043 WP_003412551.1.8505 WP_003412551.1.85074 WP_003412551.1.8509 WP_003412551.1.8512 WP_003412551.1.85148 WP_003412551.1.8518 WP_003412551.1.8522 WP_003412551.1.85242 WP_003412551.1.85276 WP_003412551.1.85281 WP_003412551.1.85284 WP_003412551.1.85314 WP_003412551.1.85319 WP_003412551.1.85330 WP_003412551.1.85341 WP_003412551.1.85346 WP_003412551.1.8535 WP_003412551.1.85363 WP_003412551.1.85371 WP_003412551.1.85377 WP_003412551.1.85387 WP_003412551.1.85399 WP_003412551.1.85458 WP_003412551.1.8546 WP_003412551.1.85464 WP_003412551.1.85478 WP_003412551.1.85480 WP_003412551.1.85488 WP_003412551.1.85495 WP_003412551.1.85551 WP_003412551.1.85557 WP_003412551.1.85577 WP_003412551.1.85597 WP_003412551.1.85599 WP_003412551.1.85610 WP_003412551.1.8563 WP_003412551.1.85648 WP_003412551.1.85679 WP_003412551.1.85704 WP_003412551.1.85717 WP_003412551.1.85727 WP_003412551.1.85737 WP_003412551.1.85763 WP_003412551.1.85808 WP_003412551.1.85819 WP_003412551.1.85820 WP_003412551.1.85823 WP_003412551.1.85832 WP_003412551.1.8586 WP_003412551.1.85872 WP_003412551.1.85894 WP_003412551.1.85909 WP_003412551.1.85913 WP_003412551.1.85953 WP_003412551.1.85986 WP_003412551.1.86000 WP_003412551.1.86024 WP_003412551.1.86025 WP_003412551.1.86032 WP_003412551.1.86048 WP_003412551.1.86052 WP_003412551.1.86067 WP_003412551.1.86103 WP_003412551.1.86122 WP_003412551.1.86124 WP_003412551.1.86160 WP_003412551.1.86164 WP_003412551.1.86168 WP_003412551.1.86190 WP_003412551.1.86235 WP_003412551.1.86249 WP_003412551.1.86260 WP_003412551.1.86290 WP_003412551.1.863 WP_003412551.1.86327 WP_003412551.1.86334 WP_003412551.1.86337 WP_003412551.1.86368 WP_003412551.1.86377 WP_003412551.1.86425 WP_003412551.1.86459 WP_003412551.1.8649 WP_003412551.1.86499 WP_003412551.1.86520 WP_003412551.1.86561 WP_003412551.1.86568 WP_003412551.1.86575 WP_003412551.1.86584 WP_003412551.1.86605 WP_003412551.1.86626 WP_003412551.1.86648 WP_003412551.1.8666 WP_003412551.1.86684 WP_003412551.1.86696 WP_003412551.1.86705 WP_003412551.1.86718 WP_003412551.1.86725 WP_003412551.1.86757 WP_003412551.1.86766 WP_003412551.1.86801 WP_003412551.1.86814 WP_003412551.1.86820 WP_003412551.1.86825 WP_003412551.1.86834 WP_003412551.1.8685 WP_003412551.1.86851 WP_003412551.1.86855 WP_003412551.1.86867 WP_003412551.1.86877 WP_003412551.1.86883 WP_003412551.1.8689 WP_003412551.1.86892 WP_003412551.1.86933 WP_003412551.1.86941 WP_003412551.1.86950 WP_003412551.1.86962 WP_003412551.1.86963 WP_003412551.1.86979 WP_003412551.1.8700 WP_003412551.1.87001 WP_003412551.1.87002 WP_003412551.1.87031 WP_003412551.1.87116 WP_003412551.1.87117 WP_003412551.1.8714 WP_003412551.1.87162 WP_003412551.1.87178 WP_003412551.1.87191 WP_003412551.1.87201 WP_003412551.1.87209 WP_003412551.1.87240 WP_003412551.1.87266 WP_003412551.1.87273 WP_003412551.1.87275 WP_003412551.1.8733 WP_003412551.1.87345 WP_003412551.1.87369 WP_003412551.1.8737 WP_003412551.1.87401 WP_003412551.1.87404 WP_003412551.1.87406 WP_003412551.1.87409 WP_003412551.1.87444 WP_003412551.1.87446 WP_003412551.1.87459 WP_003412551.1.87472 WP_003412551.1.87489 WP_003412551.1.87494 WP_003412551.1.87496 WP_003412551.1.87582 WP_003412551.1.87588 WP_003412551.1.87617 WP_003412551.1.87619 WP_003412551.1.87620 WP_003412551.1.87634 WP_003412551.1.87643 WP_003412551.1.8765 WP_003412551.1.87650 WP_003412551.1.87654 WP_003412551.1.87658 WP_003412551.1.87665 WP_003412551.1.87676 WP_003412551.1.87677 WP_003412551.1.87684 WP_003412551.1.87692 WP_003412551.1.87707 WP_003412551.1.87732 WP_003412551.1.87784 WP_003412551.1.87796 WP_003412551.1.87809 WP_003412551.1.87817 WP_003412551.1.87827 WP_003412551.1.87831 WP_003412551.1.87835 WP_003412551.1.87837 WP_003412551.1.87866 WP_003412551.1.8789 WP_003412551.1.87911 WP_003412551.1.87924 WP_003412551.1.87951 WP_003412551.1.87956 WP_003412551.1.87991 WP_003412551.1.88 WP_003412551.1.88037 WP_003412551.1.88039 WP_003412551.1.88072 WP_003412551.1.88077 WP_003412551.1.88121 WP_003412551.1.88180 WP_003412551.1.88191 WP_003412551.1.88205 WP_003412551.1.88217 WP_003412551.1.88219 WP_003412551.1.88245 WP_003412551.1.88253 WP_003412551.1.88294 WP_003412551.1.88315 WP_003412551.1.88316 WP_003412551.1.88320 WP_003412551.1.88338 WP_003412551.1.8840 WP_003412551.1.88437 WP_003412551.1.88453 WP_003412551.1.88469 WP_003412551.1.88489 WP_003412551.1.88507 WP_003412551.1.88521 WP_003412551.1.88530 WP_003412551.1.88537 WP_003412551.1.88541 WP_003412551.1.88592 WP_003412551.1.88616 WP_003412551.1.88618 WP_003412551.1.8862 WP_003412551.1.88625 WP_003412551.1.88632 WP_003412551.1.88634 WP_003412551.1.88649 WP_003412551.1.8870 WP_003412551.1.88737 WP_003412551.1.88756 WP_003412551.1.888 WP_003412551.1.88824 WP_003412551.1.88886 WP_003412551.1.88965 WP_003412551.1.88985 WP_003412551.1.8902 WP_003412551.1.89025 WP_003412551.1.89041 WP_003412551.1.89046 WP_003412551.1.89082 WP_003412551.1.89162 WP_003412551.1.89168 WP_003412551.1.8917 WP_003412551.1.89193 WP_003412551.1.89205 WP_003412551.1.89207 WP_003412551.1.89225 WP_003412551.1.89277 WP_003412551.1.89286 WP_003412551.1.89293 WP_003412551.1.89320 WP_003412551.1.8935 WP_003412551.1.89371 WP_003412551.1.89378 WP_003412551.1.89392 WP_003412551.1.89406 WP_003412551.1.8943 WP_003412551.1.89451 WP_003412551.1.89453 WP_003412551.1.89473 WP_003412551.1.89475 WP_003412551.1.89483 WP_003412551.1.895 WP_003412551.1.89513 WP_003412551.1.89517 WP_003412551.1.89522 WP_003412551.1.8954 WP_003412551.1.89543 WP_003412551.1.89567 WP_003412551.1.8957 WP_003412551.1.89572 WP_003412551.1.89589 WP_003412551.1.89607 WP_003412551.1.89613 WP_003412551.1.89625 WP_003412551.1.89648 WP_003412551.1.8967 WP_003412551.1.89670 WP_003412551.1.89676 WP_003412551.1.89729 WP_003412551.1.89739 WP_003412551.1.89762 WP_003412551.1.8977 WP_003412551.1.89808 WP_003412551.1.8982 WP_003412551.1.89829 WP_003412551.1.89831 WP_003412551.1.89844 WP_003412551.1.89849 WP_003412551.1.8989 WP_003412551.1.89901 WP_003412551.1.89903 WP_003412551.1.89909 WP_003412551.1.8992 WP_003412551.1.89922 WP_003412551.1.89926 WP_003412551.1.89963 WP_003412551.1.89971 WP_003412551.1.89987 WP_003412551.1.900 WP_003412551.1.90048 WP_003412551.1.9007 WP_003412551.1.90080 WP_003412551.1.90130 WP_003412551.1.90134 WP_003412551.1.90137 WP_003412551.1.90157 WP_003412551.1.90184 WP_003412551.1.90199 WP_003412551.1.90231 WP_003412551.1.90245 WP_003412551.1.90308 WP_003412551.1.90322 WP_003412551.1.90328 WP_003412551.1.90372 WP_003412551.1.90439 WP_003412551.1.90481 WP_003412551.1.90499 WP_003412551.1.9050 WP_003412551.1.90527 WP_003412551.1.90550 WP_003412551.1.90560 WP_003412551.1.90612 WP_003412551.1.90672 WP_003412551.1.90687 WP_003412551.1.90691 WP_003412551.1.90711 WP_003412551.1.90722 WP_003412551.1.90744 WP_003412551.1.9075 WP_003412551.1.90756 WP_003412551.1.90767 WP_003412551.1.90771 WP_003412551.1.90785 WP_003412551.1.90788 WP_003412551.1.90800 WP_003412551.1.90810 WP_003412551.1.90816 WP_003412551.1.90819 WP_003412551.1.9082 WP_003412551.1.90831 WP_003412551.1.90884 WP_003412551.1.90899 WP_003412551.1.90906 WP_003412551.1.90958 WP_003412551.1.90976 WP_003412551.1.90977 WP_003412551.1.90987 WP_003412551.1.9102 WP_003412551.1.91026 WP_003412551.1.91032 WP_003412551.1.91043 WP_003412551.1.91053 WP_003412551.1.91082 WP_003412551.1.91106 WP_003412551.1.91112 WP_003412551.1.91144 WP_003412551.1.91151 WP_003412551.1.91157 WP_003412551.1.91167 WP_003412551.1.91169 WP_003412551.1.91192 WP_003412551.1.91201 WP_003412551.1.91207 WP_003412551.1.91208 WP_003412551.1.91211 WP_003412551.1.91214 WP_003412551.1.91230 WP_003412551.1.91244 WP_003412551.1.91251 WP_003412551.1.91260 WP_003412551.1.91265 WP_003412551.1.9128 WP_003412551.1.91284 WP_003412551.1.91294 WP_003412551.1.91303 WP_003412551.1.91322 WP_003412551.1.91352 WP_003412551.1.91386 WP_003412551.1.9139 WP_003412551.1.91398 WP_003412551.1.91411 WP_003412551.1.91430 WP_003412551.1.91436 WP_003412551.1.91483 WP_003412551.1.91496 WP_003412551.1.91507 WP_003412551.1.91508 WP_003412551.1.91576 WP_003412551.1.91694 WP_003412551.1.91695 WP_003412551.1.91713 WP_003412551.1.91716 WP_003412551.1.91717 WP_003412551.1.91728 WP_003412551.1.91743 WP_003412551.1.91759 WP_003412551.1.91784 WP_003412551.1.91785 WP_003412551.1.91786 WP_003412551.1.91802 WP_003412551.1.91822 WP_003412551.1.91828 WP_003412551.1.9189 WP_003412551.1.91896 WP_003412551.1.9190 WP_003412551.1.91915 WP_003412551.1.91931 WP_003412551.1.91937 WP_003412551.1.91944 WP_003412551.1.91953 WP_003412551.1.91957 WP_003412551.1.91976 WP_003412551.1.91978 WP_003412551.1.92021 WP_003412551.1.92083 WP_003412551.1.92127 WP_003412551.1.92144 WP_003412551.1.92150 WP_003412551.1.92153 WP_003412551.1.92190 WP_003412551.1.92192 WP_003412551.1.92200 WP_003412551.1.92220 WP_003412551.1.92221 WP_003412551.1.92222 WP_003412551.1.92273 WP_003412551.1.92289 WP_003412551.1.9229 WP_003412551.1.92294 WP_003412551.1.92300 WP_003412551.1.92317 WP_003412551.1.92334 WP_003412551.1.92338 WP_003412551.1.92345 WP_003412551.1.92356 WP_003412551.1.92364 WP_003412551.1.92380 WP_003412551.1.92416 WP_003412551.1.92428 WP_003412551.1.92447 WP_003412551.1.92456 WP_003412551.1.92467 WP_003412551.1.92471 WP_003412551.1.92490 WP_003412551.1.92508 WP_003412551.1.9251 WP_003412551.1.92511 WP_003412551.1.92523 WP_003412551.1.92527 WP_003412551.1.92536 WP_003412551.1.92592 WP_003412551.1.92597 WP_003412551.1.92603 WP_003412551.1.92606 WP_003412551.1.92610 WP_003412551.1.92613 WP_003412551.1.9263 WP_003412551.1.9265 WP_003412551.1.92650 WP_003412551.1.92660 WP_003412551.1.92677 WP_003412551.1.92685 WP_003412551.1.92689 WP_003412551.1.92690 WP_003412551.1.92706 WP_003412551.1.92714 WP_003412551.1.92736 WP_003412551.1.9274 WP_003412551.1.92752 WP_003412551.1.92760 WP_003412551.1.92777 WP_003412551.1.92803 WP_003412551.1.92833 WP_003412551.1.92856 WP_003412551.1.92881 WP_003412551.1.92892 WP_003412551.1.92907 WP_003412551.1.92908 WP_003412551.1.9291 WP_003412551.1.92917 WP_003412551.1.92996 WP_003412551.1.93006 WP_003412551.1.93008 WP_003412551.1.93009 WP_003412551.1.93015 WP_003412551.1.93043 WP_003412551.1.9307 WP_003412551.1.93083 WP_003412551.1.93097 WP_003412551.1.93137 WP_003412551.1.93192 WP_003412551.1.93199 WP_003412551.1.93203 WP_003412551.1.93212 WP_003412551.1.93234 WP_003412551.1.93245 WP_003412551.1.93257 WP_003412551.1.93265 WP_003412551.1.93297 WP_003412551.1.93320 WP_003412551.1.93328 WP_003412551.1.93337 WP_003412551.1.93343 WP_003412551.1.93349 WP_003412551.1.93363 WP_003412551.1.93377 WP_003412551.1.9338 WP_003412551.1.93407 WP_003412551.1.93417 WP_003412551.1.93419 WP_003412551.1.93426 WP_003412551.1.9344 WP_003412551.1.93443 WP_003412551.1.93447 WP_003412551.1.93470 WP_003412551.1.93483 WP_003412551.1.93487 WP_003412551.1.93495 WP_003412551.1.93499 WP_003412551.1.93516 WP_003412551.1.93536 WP_003412551.1.93544 WP_003412551.1.93555 WP_003412551.1.93560 WP_003412551.1.93564 WP_003412551.1.9357 WP_003412551.1.93573 WP_003412551.1.93576 WP_003412551.1.93588 WP_003412551.1.9363 WP_003412551.1.93645 WP_003412551.1.93649 WP_003412551.1.93659 WP_003412551.1.93677 WP_003412551.1.9368 WP_003412551.1.93689 WP_003412551.1.93693 WP_003412551.1.93698 WP_003412551.1.93706 WP_003412551.1.9371 WP_003412551.1.93792 WP_003412551.1.93823 WP_003412551.1.93871 WP_003412551.1.9388 WP_003412551.1.93894 WP_003412551.1.93903 WP_003412551.1.93907 WP_003412551.1.93913 WP_003412551.1.93946 WP_003412551.1.93950 WP_003412551.1.93953 WP_003412551.1.93954 WP_003412551.1.93988 WP_003412551.1.9407 WP_003412551.1.94143 WP_003412551.1.94154 WP_003412551.1.94184 WP_003412551.1.94204 WP_003412551.1.94205 WP_003412551.1.94226 WP_003412551.1.94231 WP_003412551.1.94256 WP_003412551.1.94261 WP_003412551.1.94281 WP_003412551.1.94292 WP_003412551.1.94297 WP_003412551.1.9431 WP_003412551.1.94326 WP_003412551.1.94339 WP_003412551.1.94392 WP_003412551.1.94416 WP_003412551.1.94421 WP_003412551.1.94456 WP_003412551.1.94470 WP_003412551.1.94480 WP_003412551.1.94495 WP_003412551.1.94511 WP_003412551.1.94512 WP_003412551.1.94525 WP_003412551.1.94528 WP_003412551.1.94564 WP_003412551.1.946 WP_003412551.1.94602 WP_003412551.1.94623 WP_003412551.1.94629 WP_003412551.1.9465 WP_003412551.1.94673 WP_003412551.1.94714 WP_003412551.1.94730 WP_003412551.1.94736 WP_003412551.1.94776 WP_003412551.1.9478 WP_003412551.1.94834 WP_003412551.1.94852 WP_003412551.1.94872 WP_003412551.1.9488 WP_003412551.1.94902 WP_003412551.1.94916 WP_003412551.1.94979 WP_003412551.1.94994 WP_003412551.1.94996 WP_003412551.1.94998 WP_003412551.1.95007 WP_003412551.1.95010 WP_003412551.1.95015 WP_003412551.1.95034 WP_003412551.1.95068 WP_003412551.1.95081 WP_003412551.1.95082 WP_003412551.1.9509 WP_003412551.1.95096 WP_003412551.1.95112 WP_003412551.1.95138 WP_003412551.1.9514 WP_003412551.1.95179 WP_003412551.1.95188 WP_003412551.1.95190 WP_003412551.1.95234 WP_003412551.1.95241 WP_003412551.1.95245 WP_003412551.1.95257 WP_003412551.1.95279 WP_003412551.1.9531 WP_003412551.1.95335 WP_003412551.1.95344 WP_003412551.1.9535 WP_003412551.1.95370 WP_003412551.1.95392 WP_003412551.1.95416 WP_003412551.1.95417 WP_003412551.1.95454 WP_003412551.1.95455 WP_003412551.1.95491 WP_003412551.1.95497 WP_003412551.1.95508 WP_003412551.1.95509 WP_003412551.1.95529 WP_003412551.1.95556 WP_003412551.1.95557 WP_003412551.1.95565 WP_003412551.1.95578 WP_003412551.1.95580 WP_003412551.1.95585 WP_003412551.1.95643 WP_003412551.1.95679 WP_003412551.1.95685 WP_003412551.1.957 WP_003412551.1.95724 WP_003412551.1.95727 WP_003412551.1.95730 WP_003412551.1.95735 WP_003412551.1.95758 WP_003412551.1.95772 WP_003412551.1.95797 WP_003412551.1.95839 WP_003412551.1.9585 WP_003412551.1.9590 WP_003412551.1.95902 WP_003412551.1.95908 WP_003412551.1.95924 WP_003412551.1.95926 WP_003412551.1.95953 WP_003412551.1.95958 WP_003412551.1.95964 WP_003412551.1.95973 WP_003412551.1.96006 WP_003412551.1.9602 WP_003412551.1.96036 WP_003412551.1.96062 WP_003412551.1.96065 WP_003412551.1.96098 WP_003412551.1.96146 WP_003412551.1.96166 WP_003412551.1.96171 WP_003412551.1.96204 WP_003412551.1.96230 WP_003412551.1.96235 WP_003412551.1.96242 WP_003412551.1.96245 WP_003412551.1.96254 WP_003412551.1.96259 WP_003412551.1.96286 WP_003412551.1.96313 WP_003412551.1.96318 WP_003412551.1.96345 WP_003412551.1.96360 WP_003412551.1.96373 WP_003412551.1.96456 WP_003412551.1.96486 WP_003412551.1.96569 WP_003412551.1.96573 WP_003412551.1.96575 WP_003412551.1.96576 WP_003412551.1.96611 WP_003412551.1.96621 WP_003412551.1.9667 WP_003412551.1.96681 WP_003412551.1.96726 WP_003412551.1.96733 WP_003412551.1.96742 WP_003412551.1.96754 WP_003412551.1.9678 WP_003412551.1.96832 WP_003412551.1.9685 WP_003412551.1.97008 WP_003412551.1.97009 WP_003412551.1.97056 WP_003412551.1.97084 WP_003412551.1.97087 WP_003412551.1.97094 WP_003412551.1.97096 WP_003412551.1.97099 WP_003412551.1.97108 WP_003412551.1.97113 WP_003412551.1.97122 WP_003412551.1.97127 WP_003412551.1.97129 WP_003412551.1.97136 WP_003412551.1.9716 WP_003412551.1.97176 WP_003412551.1.97222 WP_003412551.1.97223 WP_003412551.1.97237 WP_003412551.1.97242 WP_003412551.1.97270 WP_003412551.1.97283 WP_003412551.1.97296 WP_003412551.1.97321 WP_003412551.1.97325 WP_003412551.1.97330 WP_003412551.1.97366 WP_003412551.1.97376 WP_003412551.1.97380 WP_003412551.1.9739 WP_003412551.1.97462 WP_003412551.1.97517 WP_003412551.1.97519 WP_003412551.1.97535 WP_003412551.1.97540 WP_003412551.1.97545 WP_003412551.1.97546 WP_003412551.1.97550 WP_003412551.1.97568 WP_003412551.1.97577 WP_003412551.1.97584 WP_003412551.1.9759 WP_003412551.1.97591 WP_003412551.1.97596 WP_003412551.1.97609 WP_003412551.1.97618 WP_003412551.1.9763 WP_003412551.1.97669 WP_003412551.1.97673 WP_003412551.1.97700 WP_003412551.1.97701 WP_003412551.1.9773 WP_003412551.1.97730 WP_003412551.1.97740 WP_003412551.1.97751 WP_003412551.1.97754 WP_003412551.1.97797 WP_003412551.1.9784 WP_003412551.1.97888 WP_003412551.1.9790 WP_003412551.1.9795 WP_003412551.1.97951 WP_003412551.1.97958 WP_003412551.1.97966 WP_003412551.1.97977 WP_003412551.1.97979 WP_003412551.1.97995 WP_003412551.1.98018 WP_003412551.1.98034 WP_003412551.1.98052 WP_003412551.1.98071 WP_003412551.1.98072 WP_003412551.1.98113 WP_003412551.1.98114 WP_003412551.1.98128 WP_003412551.1.98181 WP_003412551.1.98188 WP_003412551.1.98189 WP_003412551.1.98213 WP_003412551.1.98225 WP_003412551.1.98291 WP_003412551.1.98335 WP_003412551.1.98350 WP_003412551.1.98395 WP_003412551.1.98412 WP_003412551.1.98441 WP_003412551.1.98443 WP_003412551.1.98462 WP_003412551.1.9848 WP_003412551.1.98482 WP_003412551.1.98486 WP_003412551.1.98488 WP_003412551.1.98503 WP_003412551.1.98516 WP_003412551.1.98524 WP_003412551.1.98536 WP_003412551.1.98541 WP_003412551.1.98566 WP_003412551.1.98576 WP_003412551.1.98590 WP_003412551.1.98594 WP_003412551.1.98599 WP_003412551.1.98629 WP_003412551.1.98645 WP_003412551.1.98646 WP_003412551.1.98649 WP_003412551.1.98656 WP_003412551.1.9867 WP_003412551.1.98674 WP_003412551.1.98697 WP_003412551.1.98701 WP_003412551.1.98739 WP_003412551.1.98749 WP_003412551.1.98765 WP_003412551.1.98770 WP_003412551.1.98777 WP_003412551.1.98778 WP_003412551.1.98802 WP_003412551.1.98838 WP_003412551.1.98850 WP_003412551.1.98906 WP_003412551.1.98935 WP_003412551.1.98948 WP_003412551.1.98953 WP_003412551.1.98984 WP_003412551.1.99000 WP_003412551.1.99023 WP_003412551.1.99030 WP_003412551.1.99037 WP_003412551.1.99055 WP_003412551.1.99062 WP_003412551.1.99086 WP_003412551.1.99115 WP_003412551.1.99117 WP_003412551.1.99161 WP_003412551.1.99176 WP_003412551.1.99205 WP_003412551.1.99211 WP_003412551.1.99216 WP_003412551.1.99222 WP_003412551.1.99251 WP_003412551.1.99269 WP_003412551.1.99294 WP_003412551.1.99312 WP_003412551.1.99315 WP_003412551.1.99316 WP_003412551.1.99322 WP_003412551.1.99328 WP_003412551.1.99365 WP_003412551.1.99368 WP_003412551.1.99379 WP_003412551.1.99396 WP_003412551.1.99402 WP_003412551.1.99404 WP_003412551.1.99419 WP_003412551.1.99438 WP_003412551.1.99460 WP_003412551.1.99468 WP_003412551.1.99473 WP_003412551.1.99513 WP_003412551.1.99529 WP_003412551.1.99548 WP_003412551.1.99572 WP_003412551.1.99575 WP_003412551.1.99578 WP_003412551.1.99605 WP_003412551.1.99609 WP_003412551.1.99617 WP_003412551.1.99635 WP_003412551.1.99650 WP_003412551.1.99672 WP_003412551.1.99701 WP_003412551.1.99711 WP_003412551.1.99716 WP_003412551.1.99740 WP_003412551.1.99745 WP_003412551.1.99749 WP_003412551.1.9976 WP_003412551.1.99798 WP_003412551.1.99817 WP_003412551.1.99832 WP_003412551.1.99847 WP_003412551.1.99852 WP_003412551.1.99886 WP_003412551.1.99897 WP_003412551.1.99899 WP_003412551.1.99915 WP_003412551.1.9993 WP_003412551.1.99982 WP_003412551.1.99991 YP_177882.1.84033 gi|31793611|ref|NP_856104.1| gi|197741025|ref|YP_002162339.1| gi|433631549|ref|YP_007265177.1| gi|392431959|ref|YP_006473003.1| gi|506926961|ref|YP_008007411.1| gi|340627444|ref|YP_004745896.1| gi|479315380|ref|YP_007855432.1| gi|148662266|ref|YP_001283789.1| gi|378772165|ref|YP_005171898.1| gi|15841952|ref|NP_336989.1| gi|392387071|ref|YP_005308700.1| gi|506926961|ref|YP_008007411.1| gi|433635514|ref|YP_007269141.1| gi|121638313|ref|YP_978537.1| gi|339632458|ref|YP_004724100.1| gi|148823634|ref|YP_001288388.1| gi|494700870|ref|YP_007966352.1| 2g38_A 2g38_C gi|57116989|ref|YP_177882.1| gi|471338428|ref|YP_007611141.1| gi|494696807|ref|YP_007962310.1| gi|383308216|ref|YP_005361027.1| gi|433627566|ref|YP_007261195.1| ISFI142 Rv2431c gi|385999212|ref|YP_005917511.1| gi|449064500|ref|YP_007431583.1| gi|433642630|ref|YP_007288389.1| 233413.Mb2457c 336982.TBFG_12459 410289.BCG_2450c 419947.MRA_2458 478434.TBMG_01541 561275.JTY_2444 83331.MT2506 83332.Rv2431c gi|224990807|ref|YP_002645494.1| gi|479056394|ref|YP_007352200.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]