SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I6X4W0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I6X4W0
Domain Number 1 Region: 39-138
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.28e-16
Family Anti-sigma factor antagonist SpoIIaa 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I6X4W0
Sequence length 148
Comment (tr|I6X4W0|I6X4W0_MYCTU) Anti-sigma factor antagonist {ECO:0000256|RuleBase:RU003749} KW=Complete proteome; Reference proteome OX=83332 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv). GN=Rv2638 OC=Mycobacterium; Mycobacterium tuberculosis complex.
Sequence
MGLITTEPRSSPHPLSPRLVHELGDPHSTLRATTDGSGAALLIHAGGEIDGRNEHLWRQL
VTEAAAGVTAPGPLIVDVTGLDFMGCCAFAALADEAQRCRCRGIDLRLVSHQPIVARIAE
AGGLSRVLPIYPTVDTALGKGTAGPARC
Download sequence
Identical sequences A0A045IH90 A0A083VZS3 A0A0H3LDH4 A0A0H3M6W6 A0A109S8X0 A0A109SQH2 A0A109SYZ8 A0A197IST0 A0A1R3Y1T2 A0A1S1BDK4 A5U5Z0 F8M2Z2 G0TQN9 I6X4W0 L0TAG6 M8CBV7 P71937
gi|471338646|ref|YP_007611359.1| gi|31793824|ref|NP_856317.1| gi|197738295|ref|YP_002159610.1| gi|479056603|ref|YP_007352409.1| gi|392387274|ref|YP_005308903.1| gi|15609775|ref|NP_217154.1| gi|148662479|ref|YP_001284002.1| gi|506927178|ref|YP_008007628.1| MyboA.17065.a gi|148823831|ref|YP_001288585.1| gi|224991021|ref|YP_002645708.1| gi|383308406|ref|YP_005361217.1| gi|15842179|ref|NP_337216.1| gi|392431753|ref|YP_006472797.1| gi|433627776|ref|YP_007261405.1| gi|449064719|ref|YP_007431802.1| gi|121638527|ref|YP_978751.1| gi|253798278|ref|YP_003031279.1| 233413.Mb2671 336982.TBFG_12656 410289.BCG_2665 419947.MRA_2667 478434.TBMG_01333 561275.JTY_2659 83331.MT2716 83332.Rv2638 gi|375295545|ref|YP_005099812.1| NP_217154.1.84033 WP_003413657.1.100000 WP_003413657.1.100021 WP_003413657.1.100069 WP_003413657.1.100087 WP_003413657.1.10015 WP_003413657.1.100208 WP_003413657.1.100216 WP_003413657.1.10022 WP_003413657.1.100255 WP_003413657.1.100260 WP_003413657.1.100270 WP_003413657.1.100279 WP_003413657.1.100286 WP_003413657.1.100308 WP_003413657.1.100309 WP_003413657.1.100318 WP_003413657.1.100337 WP_003413657.1.100338 WP_003413657.1.100383 WP_003413657.1.100395 WP_003413657.1.100396 WP_003413657.1.1004 WP_003413657.1.100401 WP_003413657.1.100459 WP_003413657.1.100460 WP_003413657.1.100552 WP_003413657.1.100581 WP_003413657.1.100625 WP_003413657.1.100666 WP_003413657.1.100671 WP_003413657.1.100677 WP_003413657.1.100682 WP_003413657.1.100697 WP_003413657.1.100703 WP_003413657.1.100716 WP_003413657.1.100722 WP_003413657.1.100757 WP_003413657.1.100772 WP_003413657.1.1008 WP_003413657.1.100812 WP_003413657.1.100845 WP_003413657.1.100866 WP_003413657.1.10088 WP_003413657.1.10090 WP_003413657.1.100910 WP_003413657.1.100918 WP_003413657.1.100935 WP_003413657.1.100984 WP_003413657.1.100992 WP_003413657.1.100998 WP_003413657.1.101 WP_003413657.1.101025 WP_003413657.1.101028 WP_003413657.1.10104 WP_003413657.1.101048 WP_003413657.1.101054 WP_003413657.1.101075 WP_003413657.1.101143 WP_003413657.1.101146 WP_003413657.1.10116 WP_003413657.1.10117 WP_003413657.1.101209 WP_003413657.1.10125 WP_003413657.1.101290 WP_003413657.1.101323 WP_003413657.1.101324 WP_003413657.1.101350 WP_003413657.1.101367 WP_003413657.1.101398 WP_003413657.1.101403 WP_003413657.1.101421 WP_003413657.1.10144 WP_003413657.1.101442 WP_003413657.1.10145 WP_003413657.1.101452 WP_003413657.1.101456 WP_003413657.1.101481 WP_003413657.1.101493 WP_003413657.1.101496 WP_003413657.1.101525 WP_003413657.1.101533 WP_003413657.1.101535 WP_003413657.1.101553 WP_003413657.1.101558 WP_003413657.1.10156 WP_003413657.1.101573 WP_003413657.1.10159 WP_003413657.1.101592 WP_003413657.1.101604 WP_003413657.1.101607 WP_003413657.1.101622 WP_003413657.1.101644 WP_003413657.1.101671 WP_003413657.1.101687 WP_003413657.1.101698 WP_003413657.1.10170 WP_003413657.1.101713 WP_003413657.1.101722 WP_003413657.1.101733 WP_003413657.1.101743 WP_003413657.1.101754 WP_003413657.1.101764 WP_003413657.1.101795 WP_003413657.1.101797 WP_003413657.1.101798 WP_003413657.1.101802 WP_003413657.1.101826 WP_003413657.1.101836 WP_003413657.1.101858 WP_003413657.1.101859 WP_003413657.1.101862 WP_003413657.1.101888 WP_003413657.1.101894 WP_003413657.1.101899 WP_003413657.1.101923 WP_003413657.1.101925 WP_003413657.1.10193 WP_003413657.1.101996 WP_003413657.1.102008 WP_003413657.1.102017 WP_003413657.1.102053 WP_003413657.1.102055 WP_003413657.1.102063 WP_003413657.1.102099 WP_003413657.1.1021 WP_003413657.1.10211 WP_003413657.1.102121 WP_003413657.1.102143 WP_003413657.1.10216 WP_003413657.1.10224 WP_003413657.1.10253 WP_003413657.1.10262 WP_003413657.1.10272 WP_003413657.1.10277 WP_003413657.1.1033 WP_003413657.1.10350 WP_003413657.1.10362 WP_003413657.1.10366 WP_003413657.1.10376 WP_003413657.1.10396 WP_003413657.1.10410 WP_003413657.1.10414 WP_003413657.1.10421 WP_003413657.1.10430 WP_003413657.1.1044 WP_003413657.1.10440 WP_003413657.1.10445 WP_003413657.1.10471 WP_003413657.1.10472 WP_003413657.1.10489 WP_003413657.1.10518 WP_003413657.1.1057 WP_003413657.1.10594 WP_003413657.1.10603 WP_003413657.1.10606 WP_003413657.1.10615 WP_003413657.1.10623 WP_003413657.1.10635 WP_003413657.1.10643 WP_003413657.1.10648 WP_003413657.1.10662 WP_003413657.1.10709 WP_003413657.1.10735 WP_003413657.1.10740 WP_003413657.1.10756 WP_003413657.1.1078 WP_003413657.1.10791 WP_003413657.1.10799 WP_003413657.1.10825 WP_003413657.1.10848 WP_003413657.1.10863 WP_003413657.1.10879 WP_003413657.1.10912 WP_003413657.1.10916 WP_003413657.1.10923 WP_003413657.1.10927 WP_003413657.1.1095 WP_003413657.1.10956 WP_003413657.1.10958 WP_003413657.1.10962 WP_003413657.1.10980 WP_003413657.1.10981 WP_003413657.1.10993 WP_003413657.1.1100 WP_003413657.1.11040 WP_003413657.1.11061 WP_003413657.1.11070 WP_003413657.1.11141 WP_003413657.1.11171 WP_003413657.1.11175 WP_003413657.1.11176 WP_003413657.1.11222 WP_003413657.1.11236 WP_003413657.1.11329 WP_003413657.1.1133 WP_003413657.1.11342 WP_003413657.1.11373 WP_003413657.1.11376 WP_003413657.1.11390 WP_003413657.1.11402 WP_003413657.1.11481 WP_003413657.1.11487 WP_003413657.1.11489 WP_003413657.1.11491 WP_003413657.1.11514 WP_003413657.1.11587 WP_003413657.1.11589 WP_003413657.1.11596 WP_003413657.1.11604 WP_003413657.1.11610 WP_003413657.1.11697 WP_003413657.1.11707 WP_003413657.1.11752 WP_003413657.1.11758 WP_003413657.1.11775 WP_003413657.1.11804 WP_003413657.1.11822 WP_003413657.1.11826 WP_003413657.1.11898 WP_003413657.1.11906 WP_003413657.1.11939 WP_003413657.1.11960 WP_003413657.1.11961 WP_003413657.1.11972 WP_003413657.1.11984 WP_003413657.1.120 WP_003413657.1.12001 WP_003413657.1.12049 WP_003413657.1.12052 WP_003413657.1.12100 WP_003413657.1.12116 WP_003413657.1.12130 WP_003413657.1.12133 WP_003413657.1.12161 WP_003413657.1.12165 WP_003413657.1.12184 WP_003413657.1.12187 WP_003413657.1.12190 WP_003413657.1.12216 WP_003413657.1.12265 WP_003413657.1.12275 WP_003413657.1.12293 WP_003413657.1.12294 WP_003413657.1.123 WP_003413657.1.1231 WP_003413657.1.12314 WP_003413657.1.12327 WP_003413657.1.12338 WP_003413657.1.1236 WP_003413657.1.12371 WP_003413657.1.12372 WP_003413657.1.12389 WP_003413657.1.12406 WP_003413657.1.1241 WP_003413657.1.12421 WP_003413657.1.12424 WP_003413657.1.12446 WP_003413657.1.12464 WP_003413657.1.12479 WP_003413657.1.12519 WP_003413657.1.12523 WP_003413657.1.12526 WP_003413657.1.1255 WP_003413657.1.12550 WP_003413657.1.12551 WP_003413657.1.12611 WP_003413657.1.12669 WP_003413657.1.1267 WP_003413657.1.12672 WP_003413657.1.12692 WP_003413657.1.1271 WP_003413657.1.12710 WP_003413657.1.12768 WP_003413657.1.1279 WP_003413657.1.12794 WP_003413657.1.12801 WP_003413657.1.12821 WP_003413657.1.12841 WP_003413657.1.12854 WP_003413657.1.12871 WP_003413657.1.12901 WP_003413657.1.12941 WP_003413657.1.12957 WP_003413657.1.12972 WP_003413657.1.13028 WP_003413657.1.13043 WP_003413657.1.13086 WP_003413657.1.13087 WP_003413657.1.13090 WP_003413657.1.13163 WP_003413657.1.13183 WP_003413657.1.132 WP_003413657.1.13249 WP_003413657.1.13282 WP_003413657.1.13284 WP_003413657.1.13296 WP_003413657.1.13298 WP_003413657.1.13302 WP_003413657.1.13306 WP_003413657.1.13312 WP_003413657.1.13313 WP_003413657.1.13321 WP_003413657.1.13345 WP_003413657.1.13370 WP_003413657.1.1338 WP_003413657.1.13420 WP_003413657.1.13433 WP_003413657.1.13435 WP_003413657.1.13438 WP_003413657.1.13461 WP_003413657.1.13489 WP_003413657.1.13526 WP_003413657.1.13551 WP_003413657.1.13564 WP_003413657.1.13579 WP_003413657.1.13667 WP_003413657.1.13687 WP_003413657.1.13697 WP_003413657.1.13719 WP_003413657.1.13763 WP_003413657.1.1377 WP_003413657.1.13774 WP_003413657.1.13786 WP_003413657.1.13793 WP_003413657.1.13817 WP_003413657.1.13834 WP_003413657.1.13866 WP_003413657.1.13880 WP_003413657.1.13899 WP_003413657.1.13909 WP_003413657.1.13919 WP_003413657.1.13920 WP_003413657.1.13952 WP_003413657.1.13953 WP_003413657.1.13962 WP_003413657.1.1398 WP_003413657.1.14027 WP_003413657.1.14115 WP_003413657.1.1415 WP_003413657.1.14152 WP_003413657.1.14162 WP_003413657.1.14175 WP_003413657.1.14194 WP_003413657.1.14195 WP_003413657.1.14238 WP_003413657.1.14266 WP_003413657.1.14273 WP_003413657.1.14303 WP_003413657.1.14306 WP_003413657.1.14310 WP_003413657.1.14341 WP_003413657.1.14382 WP_003413657.1.14416 WP_003413657.1.14428 WP_003413657.1.14441 WP_003413657.1.14469 WP_003413657.1.14477 WP_003413657.1.14504 WP_003413657.1.1452 WP_003413657.1.14527 WP_003413657.1.1454 WP_003413657.1.14544 WP_003413657.1.14548 WP_003413657.1.14551 WP_003413657.1.14561 WP_003413657.1.14573 WP_003413657.1.1462 WP_003413657.1.14658 WP_003413657.1.14667 WP_003413657.1.14668 WP_003413657.1.14675 WP_003413657.1.14694 WP_003413657.1.14695 WP_003413657.1.14709 WP_003413657.1.14766 WP_003413657.1.14783 WP_003413657.1.14865 WP_003413657.1.14872 WP_003413657.1.14905 WP_003413657.1.14926 WP_003413657.1.14951 WP_003413657.1.14955 WP_003413657.1.15003 WP_003413657.1.15009 WP_003413657.1.15028 WP_003413657.1.15040 WP_003413657.1.15065 WP_003413657.1.15089 WP_003413657.1.1509 WP_003413657.1.15126 WP_003413657.1.15168 WP_003413657.1.15172 WP_003413657.1.15174 WP_003413657.1.15187 WP_003413657.1.15196 WP_003413657.1.15216 WP_003413657.1.15217 WP_003413657.1.1523 WP_003413657.1.15232 WP_003413657.1.15238 WP_003413657.1.15240 WP_003413657.1.15253 WP_003413657.1.15267 WP_003413657.1.1527 WP_003413657.1.15292 WP_003413657.1.15302 WP_003413657.1.15322 WP_003413657.1.1534 WP_003413657.1.15345 WP_003413657.1.15365 WP_003413657.1.15372 WP_003413657.1.15386 WP_003413657.1.15387 WP_003413657.1.15442 WP_003413657.1.15447 WP_003413657.1.15449 WP_003413657.1.15477 WP_003413657.1.15492 WP_003413657.1.15511 WP_003413657.1.15512 WP_003413657.1.15558 WP_003413657.1.15559 WP_003413657.1.15566 WP_003413657.1.15599 WP_003413657.1.1560 WP_003413657.1.15611 WP_003413657.1.1563 WP_003413657.1.15633 WP_003413657.1.15643 WP_003413657.1.15688 WP_003413657.1.15755 WP_003413657.1.15763 WP_003413657.1.15774 WP_003413657.1.1578 WP_003413657.1.15780 WP_003413657.1.15827 WP_003413657.1.15834 WP_003413657.1.15842 WP_003413657.1.15848 WP_003413657.1.15853 WP_003413657.1.15870 WP_003413657.1.15877 WP_003413657.1.15896 WP_003413657.1.15926 WP_003413657.1.15933 WP_003413657.1.15958 WP_003413657.1.15973 WP_003413657.1.15987 WP_003413657.1.15993 WP_003413657.1.16009 WP_003413657.1.16025 WP_003413657.1.16055 WP_003413657.1.16066 WP_003413657.1.16069 WP_003413657.1.16077 WP_003413657.1.16106 WP_003413657.1.16108 WP_003413657.1.16110 WP_003413657.1.16130 WP_003413657.1.16136 WP_003413657.1.16139 WP_003413657.1.16141 WP_003413657.1.16143 WP_003413657.1.1630 WP_003413657.1.1632 WP_003413657.1.16327 WP_003413657.1.16334 WP_003413657.1.16345 WP_003413657.1.16374 WP_003413657.1.16384 WP_003413657.1.16386 WP_003413657.1.164 WP_003413657.1.1642 WP_003413657.1.16421 WP_003413657.1.16424 WP_003413657.1.16426 WP_003413657.1.16431 WP_003413657.1.16438 WP_003413657.1.1644 WP_003413657.1.16442 WP_003413657.1.16448 WP_003413657.1.16451 WP_003413657.1.16476 WP_003413657.1.16480 WP_003413657.1.16494 WP_003413657.1.1652 WP_003413657.1.16549 WP_003413657.1.16560 WP_003413657.1.16598 WP_003413657.1.16609 WP_003413657.1.16619 WP_003413657.1.16620 WP_003413657.1.16622 WP_003413657.1.16637 WP_003413657.1.16707 WP_003413657.1.16724 WP_003413657.1.16731 WP_003413657.1.16743 WP_003413657.1.1683 WP_003413657.1.16837 WP_003413657.1.16852 WP_003413657.1.16937 WP_003413657.1.16940 WP_003413657.1.16950 WP_003413657.1.16959 WP_003413657.1.16968 WP_003413657.1.1697 WP_003413657.1.16973 WP_003413657.1.16977 WP_003413657.1.17005 WP_003413657.1.17006 WP_003413657.1.17015 WP_003413657.1.17019 WP_003413657.1.17039 WP_003413657.1.17041 WP_003413657.1.17052 WP_003413657.1.17057 WP_003413657.1.17062 WP_003413657.1.1707 WP_003413657.1.17094 WP_003413657.1.17130 WP_003413657.1.17138 WP_003413657.1.17167 WP_003413657.1.17224 WP_003413657.1.17251 WP_003413657.1.17288 WP_003413657.1.17314 WP_003413657.1.17345 WP_003413657.1.17381 WP_003413657.1.17391 WP_003413657.1.17412 WP_003413657.1.1743 WP_003413657.1.17440 WP_003413657.1.17466 WP_003413657.1.17477 WP_003413657.1.17483 WP_003413657.1.17505 WP_003413657.1.17527 WP_003413657.1.17535 WP_003413657.1.17540 WP_003413657.1.17553 WP_003413657.1.17558 WP_003413657.1.17599 WP_003413657.1.17635 WP_003413657.1.17655 WP_003413657.1.17679 WP_003413657.1.17687 WP_003413657.1.17700 WP_003413657.1.17710 WP_003413657.1.17713 WP_003413657.1.17722 WP_003413657.1.17746 WP_003413657.1.17788 WP_003413657.1.17798 WP_003413657.1.17803 WP_003413657.1.17816 WP_003413657.1.17821 WP_003413657.1.17878 WP_003413657.1.1792 WP_003413657.1.17923 WP_003413657.1.1795 WP_003413657.1.17955 WP_003413657.1.17973 WP_003413657.1.18013 WP_003413657.1.18033 WP_003413657.1.18057 WP_003413657.1.18065 WP_003413657.1.18070 WP_003413657.1.18120 WP_003413657.1.18126 WP_003413657.1.1817 WP_003413657.1.18206 WP_003413657.1.18216 WP_003413657.1.18240 WP_003413657.1.18257 WP_003413657.1.18297 WP_003413657.1.18306 WP_003413657.1.18364 WP_003413657.1.18399 WP_003413657.1.18411 WP_003413657.1.18444 WP_003413657.1.18448 WP_003413657.1.18467 WP_003413657.1.18476 WP_003413657.1.18580 WP_003413657.1.18582 WP_003413657.1.18587 WP_003413657.1.18639 WP_003413657.1.18647 WP_003413657.1.1868 WP_003413657.1.18694 WP_003413657.1.18710 WP_003413657.1.18781 WP_003413657.1.18793 WP_003413657.1.18804 WP_003413657.1.18816 WP_003413657.1.18823 WP_003413657.1.18827 WP_003413657.1.18838 WP_003413657.1.18849 WP_003413657.1.18856 WP_003413657.1.18945 WP_003413657.1.19005 WP_003413657.1.19056 WP_003413657.1.19063 WP_003413657.1.19066 WP_003413657.1.19085 WP_003413657.1.19094 WP_003413657.1.19144 WP_003413657.1.19159 WP_003413657.1.19193 WP_003413657.1.19231 WP_003413657.1.19243 WP_003413657.1.19264 WP_003413657.1.19295 WP_003413657.1.19307 WP_003413657.1.19326 WP_003413657.1.1933 WP_003413657.1.19364 WP_003413657.1.19382 WP_003413657.1.19400 WP_003413657.1.19426 WP_003413657.1.19429 WP_003413657.1.19464 WP_003413657.1.19480 WP_003413657.1.19512 WP_003413657.1.19553 WP_003413657.1.19562 WP_003413657.1.19564 WP_003413657.1.19568 WP_003413657.1.19572 WP_003413657.1.19595 WP_003413657.1.19596 WP_003413657.1.19600 WP_003413657.1.19630 WP_003413657.1.19694 WP_003413657.1.19742 WP_003413657.1.19785 WP_003413657.1.19820 WP_003413657.1.19868 WP_003413657.1.19874 WP_003413657.1.19890 WP_003413657.1.19900 WP_003413657.1.19922 WP_003413657.1.19936 WP_003413657.1.19946 WP_003413657.1.19949 WP_003413657.1.19960 WP_003413657.1.19964 WP_003413657.1.20007 WP_003413657.1.20016 WP_003413657.1.20028 WP_003413657.1.2003 WP_003413657.1.20037 WP_003413657.1.20039 WP_003413657.1.20082 WP_003413657.1.20085 WP_003413657.1.20097 WP_003413657.1.20116 WP_003413657.1.20130 WP_003413657.1.20140 WP_003413657.1.20141 WP_003413657.1.20142 WP_003413657.1.20158 WP_003413657.1.20239 WP_003413657.1.20243 WP_003413657.1.20259 WP_003413657.1.20262 WP_003413657.1.20268 WP_003413657.1.20272 WP_003413657.1.20273 WP_003413657.1.20280 WP_003413657.1.20294 WP_003413657.1.20300 WP_003413657.1.20309 WP_003413657.1.20322 WP_003413657.1.2037 WP_003413657.1.20372 WP_003413657.1.20381 WP_003413657.1.204 WP_003413657.1.20427 WP_003413657.1.20432 WP_003413657.1.20457 WP_003413657.1.20459 WP_003413657.1.20460 WP_003413657.1.20542 WP_003413657.1.20578 WP_003413657.1.20608 WP_003413657.1.20624 WP_003413657.1.20628 WP_003413657.1.2066 WP_003413657.1.20707 WP_003413657.1.20722 WP_003413657.1.20729 WP_003413657.1.20742 WP_003413657.1.20751 WP_003413657.1.20776 WP_003413657.1.20850 WP_003413657.1.2086 WP_003413657.1.20868 WP_003413657.1.20876 WP_003413657.1.20897 WP_003413657.1.20898 WP_003413657.1.2090 WP_003413657.1.20911 WP_003413657.1.20916 WP_003413657.1.20921 WP_003413657.1.20926 WP_003413657.1.20927 WP_003413657.1.20951 WP_003413657.1.20970 WP_003413657.1.2104 WP_003413657.1.21070 WP_003413657.1.21127 WP_003413657.1.21135 WP_003413657.1.21187 WP_003413657.1.212 WP_003413657.1.2120 WP_003413657.1.21219 WP_003413657.1.2123 WP_003413657.1.21231 WP_003413657.1.21234 WP_003413657.1.2126 WP_003413657.1.21292 WP_003413657.1.21307 WP_003413657.1.2131 WP_003413657.1.21311 WP_003413657.1.21321 WP_003413657.1.21365 WP_003413657.1.2137 WP_003413657.1.21392 WP_003413657.1.21397 WP_003413657.1.21403 WP_003413657.1.21415 WP_003413657.1.21418 WP_003413657.1.21430 WP_003413657.1.21434 WP_003413657.1.21444 WP_003413657.1.21468 WP_003413657.1.21498 WP_003413657.1.21509 WP_003413657.1.21513 WP_003413657.1.21560 WP_003413657.1.21565 WP_003413657.1.21586 WP_003413657.1.21591 WP_003413657.1.21594 WP_003413657.1.21602 WP_003413657.1.21615 WP_003413657.1.21639 WP_003413657.1.21655 WP_003413657.1.21658 WP_003413657.1.2168 WP_003413657.1.2174 WP_003413657.1.21741 WP_003413657.1.21742 WP_003413657.1.21777 WP_003413657.1.21786 WP_003413657.1.21795 WP_003413657.1.218 WP_003413657.1.21826 WP_003413657.1.21829 WP_003413657.1.21840 WP_003413657.1.21843 WP_003413657.1.21872 WP_003413657.1.2188 WP_003413657.1.21882 WP_003413657.1.21906 WP_003413657.1.21912 WP_003413657.1.2194 WP_003413657.1.21941 WP_003413657.1.21956 WP_003413657.1.21960 WP_003413657.1.21971 WP_003413657.1.21973 WP_003413657.1.21983 WP_003413657.1.22013 WP_003413657.1.22025 WP_003413657.1.22036 WP_003413657.1.22092 WP_003413657.1.22127 WP_003413657.1.22140 WP_003413657.1.22233 WP_003413657.1.22277 WP_003413657.1.22305 WP_003413657.1.22348 WP_003413657.1.22356 WP_003413657.1.22366 WP_003413657.1.2238 WP_003413657.1.22380 WP_003413657.1.22437 WP_003413657.1.22438 WP_003413657.1.22445 WP_003413657.1.22490 WP_003413657.1.22511 WP_003413657.1.22524 WP_003413657.1.2253 WP_003413657.1.22585 WP_003413657.1.22589 WP_003413657.1.22606 WP_003413657.1.22608 WP_003413657.1.22609 WP_003413657.1.22618 WP_003413657.1.2262 WP_003413657.1.22624 WP_003413657.1.22629 WP_003413657.1.22647 WP_003413657.1.22664 WP_003413657.1.22665 WP_003413657.1.22674 WP_003413657.1.22680 WP_003413657.1.22725 WP_003413657.1.22728 WP_003413657.1.22733 WP_003413657.1.22737 WP_003413657.1.2275 WP_003413657.1.22754 WP_003413657.1.22797 WP_003413657.1.22800 WP_003413657.1.22804 WP_003413657.1.22829 WP_003413657.1.22844 WP_003413657.1.22963 WP_003413657.1.22970 WP_003413657.1.22996 WP_003413657.1.22997 WP_003413657.1.22999 WP_003413657.1.23015 WP_003413657.1.23032 WP_003413657.1.231 WP_003413657.1.23101 WP_003413657.1.2312 WP_003413657.1.23140 WP_003413657.1.23153 WP_003413657.1.23171 WP_003413657.1.23199 WP_003413657.1.2320 WP_003413657.1.23204 WP_003413657.1.23216 WP_003413657.1.23229 WP_003413657.1.23233 WP_003413657.1.2326 WP_003413657.1.23261 WP_003413657.1.23272 WP_003413657.1.23289 WP_003413657.1.2329 WP_003413657.1.23308 WP_003413657.1.23316 WP_003413657.1.23321 WP_003413657.1.23325 WP_003413657.1.2339 WP_003413657.1.23406 WP_003413657.1.23438 WP_003413657.1.23447 WP_003413657.1.23452 WP_003413657.1.23461 WP_003413657.1.2349 WP_003413657.1.23496 WP_003413657.1.23497 WP_003413657.1.23506 WP_003413657.1.23530 WP_003413657.1.23539 WP_003413657.1.23546 WP_003413657.1.23573 WP_003413657.1.23628 WP_003413657.1.23683 WP_003413657.1.23692 WP_003413657.1.23694 WP_003413657.1.23699 WP_003413657.1.2371 WP_003413657.1.23803 WP_003413657.1.23825 WP_003413657.1.23832 WP_003413657.1.2384 WP_003413657.1.23843 WP_003413657.1.23863 WP_003413657.1.2387 WP_003413657.1.23894 WP_003413657.1.23993 WP_003413657.1.2400 WP_003413657.1.24007 WP_003413657.1.24008 WP_003413657.1.24046 WP_003413657.1.24057 WP_003413657.1.24062 WP_003413657.1.24113 WP_003413657.1.24119 WP_003413657.1.24128 WP_003413657.1.24140 WP_003413657.1.24176 WP_003413657.1.24190 WP_003413657.1.24202 WP_003413657.1.24244 WP_003413657.1.24261 WP_003413657.1.24284 WP_003413657.1.24294 WP_003413657.1.24357 WP_003413657.1.24396 WP_003413657.1.24414 WP_003413657.1.24423 WP_003413657.1.2443 WP_003413657.1.24446 WP_003413657.1.24461 WP_003413657.1.24500 WP_003413657.1.24507 WP_003413657.1.24509 WP_003413657.1.24529 WP_003413657.1.24553 WP_003413657.1.24599 WP_003413657.1.24629 WP_003413657.1.24638 WP_003413657.1.2466 WP_003413657.1.24767 WP_003413657.1.24824 WP_003413657.1.24831 WP_003413657.1.24840 WP_003413657.1.24848 WP_003413657.1.24857 WP_003413657.1.2487 WP_003413657.1.24893 WP_003413657.1.24907 WP_003413657.1.24933 WP_003413657.1.24956 WP_003413657.1.24958 WP_003413657.1.24985 WP_003413657.1.2499 WP_003413657.1.2505 WP_003413657.1.2507 WP_003413657.1.25103 WP_003413657.1.25129 WP_003413657.1.25171 WP_003413657.1.25184 WP_003413657.1.25247 WP_003413657.1.25252 WP_003413657.1.25278 WP_003413657.1.25283 WP_003413657.1.25313 WP_003413657.1.25338 WP_003413657.1.25342 WP_003413657.1.25343 WP_003413657.1.25367 WP_003413657.1.25393 WP_003413657.1.25406 WP_003413657.1.25435 WP_003413657.1.25437 WP_003413657.1.25445 WP_003413657.1.25455 WP_003413657.1.25473 WP_003413657.1.25504 WP_003413657.1.25513 WP_003413657.1.25542 WP_003413657.1.25579 WP_003413657.1.25594 WP_003413657.1.25606 WP_003413657.1.25645 WP_003413657.1.2566 WP_003413657.1.25673 WP_003413657.1.25674 WP_003413657.1.25699 WP_003413657.1.25736 WP_003413657.1.25738 WP_003413657.1.25756 WP_003413657.1.25759 WP_003413657.1.25813 WP_003413657.1.25853 WP_003413657.1.25854 WP_003413657.1.25874 WP_003413657.1.25885 WP_003413657.1.25892 WP_003413657.1.25906 WP_003413657.1.25914 WP_003413657.1.25916 WP_003413657.1.2594 WP_003413657.1.25965 WP_003413657.1.25972 WP_003413657.1.26017 WP_003413657.1.26032 WP_003413657.1.26038 WP_003413657.1.26072 WP_003413657.1.26089 WP_003413657.1.26098 WP_003413657.1.26109 WP_003413657.1.26118 WP_003413657.1.26126 WP_003413657.1.26168 WP_003413657.1.26182 WP_003413657.1.26190 WP_003413657.1.2620 WP_003413657.1.26234 WP_003413657.1.26243 WP_003413657.1.26265 WP_003413657.1.26267 WP_003413657.1.26292 WP_003413657.1.26310 WP_003413657.1.26328 WP_003413657.1.26349 WP_003413657.1.26366 WP_003413657.1.26374 WP_003413657.1.26407 WP_003413657.1.26412 WP_003413657.1.26454 WP_003413657.1.26464 WP_003413657.1.2653 WP_003413657.1.26571 WP_003413657.1.2659 WP_003413657.1.26597 WP_003413657.1.26603 WP_003413657.1.26651 WP_003413657.1.26702 WP_003413657.1.26707 WP_003413657.1.26710 WP_003413657.1.26719 WP_003413657.1.26737 WP_003413657.1.26738 WP_003413657.1.26745 WP_003413657.1.26756 WP_003413657.1.2676 WP_003413657.1.2677 WP_003413657.1.26779 WP_003413657.1.26780 WP_003413657.1.26798 WP_003413657.1.26854 WP_003413657.1.26868 WP_003413657.1.26876 WP_003413657.1.26888 WP_003413657.1.26945 WP_003413657.1.26959 WP_003413657.1.26969 WP_003413657.1.26984 WP_003413657.1.26992 WP_003413657.1.27004 WP_003413657.1.27017 WP_003413657.1.27045 WP_003413657.1.27075 WP_003413657.1.27128 WP_003413657.1.27130 WP_003413657.1.27139 WP_003413657.1.27152 WP_003413657.1.27162 WP_003413657.1.27164 WP_003413657.1.27193 WP_003413657.1.27235 WP_003413657.1.27254 WP_003413657.1.27278 WP_003413657.1.27343 WP_003413657.1.27352 WP_003413657.1.27369 WP_003413657.1.27391 WP_003413657.1.27398 WP_003413657.1.27402 WP_003413657.1.27410 WP_003413657.1.27411 WP_003413657.1.27449 WP_003413657.1.27463 WP_003413657.1.2749 WP_003413657.1.27492 WP_003413657.1.27528 WP_003413657.1.27541 WP_003413657.1.27582 WP_003413657.1.27596 WP_003413657.1.27607 WP_003413657.1.277 WP_003413657.1.27724 WP_003413657.1.27730 WP_003413657.1.27736 WP_003413657.1.27743 WP_003413657.1.27750 WP_003413657.1.27771 WP_003413657.1.27779 WP_003413657.1.27795 WP_003413657.1.27803 WP_003413657.1.27819 WP_003413657.1.27835 WP_003413657.1.27915 WP_003413657.1.27935 WP_003413657.1.27962 WP_003413657.1.28053 WP_003413657.1.28092 WP_003413657.1.28106 WP_003413657.1.28131 WP_003413657.1.28142 WP_003413657.1.2816 WP_003413657.1.28161 WP_003413657.1.28192 WP_003413657.1.28202 WP_003413657.1.28241 WP_003413657.1.28242 WP_003413657.1.28251 WP_003413657.1.28255 WP_003413657.1.28269 WP_003413657.1.28276 WP_003413657.1.28293 WP_003413657.1.28331 WP_003413657.1.28367 WP_003413657.1.28391 WP_003413657.1.2842 WP_003413657.1.28448 WP_003413657.1.28471 WP_003413657.1.28473 WP_003413657.1.28493 WP_003413657.1.28497 WP_003413657.1.28530 WP_003413657.1.28545 WP_003413657.1.28561 WP_003413657.1.28567 WP_003413657.1.286 WP_003413657.1.28610 WP_003413657.1.28634 WP_003413657.1.28642 WP_003413657.1.28671 WP_003413657.1.28682 WP_003413657.1.28698 WP_003413657.1.28703 WP_003413657.1.28739 WP_003413657.1.28758 WP_003413657.1.28781 WP_003413657.1.28787 WP_003413657.1.28827 WP_003413657.1.28839 WP_003413657.1.28847 WP_003413657.1.28850 WP_003413657.1.28865 WP_003413657.1.28897 WP_003413657.1.28914 WP_003413657.1.28939 WP_003413657.1.28943 WP_003413657.1.28952 WP_003413657.1.28975 WP_003413657.1.28993 WP_003413657.1.2901 WP_003413657.1.29028 WP_003413657.1.29033 WP_003413657.1.29058 WP_003413657.1.29078 WP_003413657.1.29102 WP_003413657.1.29115 WP_003413657.1.2916 WP_003413657.1.29217 WP_003413657.1.29223 WP_003413657.1.29234 WP_003413657.1.29264 WP_003413657.1.29275 WP_003413657.1.29306 WP_003413657.1.29339 WP_003413657.1.29348 WP_003413657.1.29364 WP_003413657.1.29367 WP_003413657.1.29399 WP_003413657.1.2944 WP_003413657.1.29449 WP_003413657.1.29450 WP_003413657.1.29452 WP_003413657.1.2949 WP_003413657.1.29510 WP_003413657.1.29515 WP_003413657.1.2953 WP_003413657.1.29559 WP_003413657.1.2959 WP_003413657.1.29592 WP_003413657.1.29599 WP_003413657.1.29611 WP_003413657.1.29632 WP_003413657.1.29649 WP_003413657.1.2965 WP_003413657.1.29659 WP_003413657.1.2969 WP_003413657.1.29698 WP_003413657.1.29718 WP_003413657.1.29742 WP_003413657.1.29745 WP_003413657.1.29769 WP_003413657.1.29825 WP_003413657.1.29830 WP_003413657.1.29847 WP_003413657.1.29861 WP_003413657.1.29883 WP_003413657.1.29890 WP_003413657.1.299 WP_003413657.1.29931 WP_003413657.1.29960 WP_003413657.1.30014 WP_003413657.1.3004 WP_003413657.1.30040 WP_003413657.1.30074 WP_003413657.1.30097 WP_003413657.1.30101 WP_003413657.1.30106 WP_003413657.1.30114 WP_003413657.1.30126 WP_003413657.1.30131 WP_003413657.1.30138 WP_003413657.1.30145 WP_003413657.1.30211 WP_003413657.1.30224 WP_003413657.1.30235 WP_003413657.1.30237 WP_003413657.1.3027 WP_003413657.1.30279 WP_003413657.1.30282 WP_003413657.1.30283 WP_003413657.1.30291 WP_003413657.1.30363 WP_003413657.1.30374 WP_003413657.1.30404 WP_003413657.1.3043 WP_003413657.1.30433 WP_003413657.1.30438 WP_003413657.1.30462 WP_003413657.1.30464 WP_003413657.1.30468 WP_003413657.1.30500 WP_003413657.1.3057 WP_003413657.1.30574 WP_003413657.1.30628 WP_003413657.1.30641 WP_003413657.1.30642 WP_003413657.1.30661 WP_003413657.1.30669 WP_003413657.1.30683 WP_003413657.1.30699 WP_003413657.1.30709 WP_003413657.1.30713 WP_003413657.1.30716 WP_003413657.1.30719 WP_003413657.1.30730 WP_003413657.1.30732 WP_003413657.1.30736 WP_003413657.1.30745 WP_003413657.1.30760 WP_003413657.1.30791 WP_003413657.1.308 WP_003413657.1.30807 WP_003413657.1.30818 WP_003413657.1.30824 WP_003413657.1.30877 WP_003413657.1.30888 WP_003413657.1.30901 WP_003413657.1.30912 WP_003413657.1.30913 WP_003413657.1.30914 WP_003413657.1.30919 WP_003413657.1.30977 WP_003413657.1.3100 WP_003413657.1.31002 WP_003413657.1.3101 WP_003413657.1.31034 WP_003413657.1.31047 WP_003413657.1.31074 WP_003413657.1.31102 WP_003413657.1.31184 WP_003413657.1.31226 WP_003413657.1.31233 WP_003413657.1.31263 WP_003413657.1.31264 WP_003413657.1.31270 WP_003413657.1.31287 WP_003413657.1.31304 WP_003413657.1.31346 WP_003413657.1.31348 WP_003413657.1.31354 WP_003413657.1.31390 WP_003413657.1.31414 WP_003413657.1.31417 WP_003413657.1.31428 WP_003413657.1.3143 WP_003413657.1.31458 WP_003413657.1.31483 WP_003413657.1.3149 WP_003413657.1.31498 WP_003413657.1.31507 WP_003413657.1.31548 WP_003413657.1.31569 WP_003413657.1.316 WP_003413657.1.31629 WP_003413657.1.31666 WP_003413657.1.31693 WP_003413657.1.31703 WP_003413657.1.31744 WP_003413657.1.31745 WP_003413657.1.31770 WP_003413657.1.31776 WP_003413657.1.31783 WP_003413657.1.318 WP_003413657.1.31840 WP_003413657.1.31880 WP_003413657.1.31911 WP_003413657.1.31930 WP_003413657.1.31932 WP_003413657.1.31955 WP_003413657.1.31985 WP_003413657.1.31991 WP_003413657.1.32004 WP_003413657.1.32039 WP_003413657.1.3204 WP_003413657.1.32045 WP_003413657.1.32071 WP_003413657.1.32098 WP_003413657.1.32132 WP_003413657.1.32157 WP_003413657.1.32164 WP_003413657.1.32179 WP_003413657.1.32297 WP_003413657.1.32317 WP_003413657.1.32383 WP_003413657.1.32403 WP_003413657.1.32416 WP_003413657.1.32433 WP_003413657.1.32461 WP_003413657.1.32482 WP_003413657.1.32503 WP_003413657.1.32556 WP_003413657.1.32562 WP_003413657.1.32569 WP_003413657.1.32592 WP_003413657.1.32620 WP_003413657.1.32647 WP_003413657.1.32653 WP_003413657.1.32654 WP_003413657.1.32706 WP_003413657.1.32716 WP_003413657.1.32752 WP_003413657.1.32780 WP_003413657.1.32781 WP_003413657.1.32793 WP_003413657.1.32799 WP_003413657.1.32822 WP_003413657.1.32833 WP_003413657.1.32862 WP_003413657.1.32880 WP_003413657.1.32909 WP_003413657.1.32974 WP_003413657.1.33007 WP_003413657.1.3302 WP_003413657.1.33028 WP_003413657.1.33035 WP_003413657.1.33044 WP_003413657.1.33054 WP_003413657.1.33141 WP_003413657.1.33148 WP_003413657.1.33155 WP_003413657.1.33168 WP_003413657.1.3321 WP_003413657.1.33215 WP_003413657.1.3325 WP_003413657.1.3327 WP_003413657.1.33278 WP_003413657.1.33288 WP_003413657.1.33305 WP_003413657.1.3331 WP_003413657.1.3333 WP_003413657.1.33393 WP_003413657.1.33403 WP_003413657.1.33452 WP_003413657.1.33467 WP_003413657.1.33477 WP_003413657.1.3349 WP_003413657.1.33519 WP_003413657.1.33542 WP_003413657.1.33601 WP_003413657.1.33633 WP_003413657.1.33646 WP_003413657.1.33673 WP_003413657.1.3369 WP_003413657.1.33705 WP_003413657.1.33762 WP_003413657.1.33783 WP_003413657.1.3383 WP_003413657.1.33832 WP_003413657.1.33839 WP_003413657.1.33848 WP_003413657.1.3387 WP_003413657.1.33886 WP_003413657.1.33895 WP_003413657.1.33906 WP_003413657.1.33912 WP_003413657.1.33954 WP_003413657.1.3399 WP_003413657.1.34042 WP_003413657.1.3405 WP_003413657.1.34055 WP_003413657.1.34056 WP_003413657.1.34090 WP_003413657.1.34109 WP_003413657.1.34111 WP_003413657.1.34131 WP_003413657.1.34152 WP_003413657.1.34153 WP_003413657.1.34181 WP_003413657.1.34197 WP_003413657.1.34198 WP_003413657.1.34215 WP_003413657.1.34219 WP_003413657.1.34255 WP_003413657.1.34260 WP_003413657.1.34275 WP_003413657.1.343 WP_003413657.1.34358 WP_003413657.1.34392 WP_003413657.1.344 WP_003413657.1.34428 WP_003413657.1.3443 WP_003413657.1.34435 WP_003413657.1.34446 WP_003413657.1.34499 WP_003413657.1.34505 WP_003413657.1.34516 WP_003413657.1.34529 WP_003413657.1.34551 WP_003413657.1.34563 WP_003413657.1.34576 WP_003413657.1.34581 WP_003413657.1.34588 WP_003413657.1.34596 WP_003413657.1.34599 WP_003413657.1.34639 WP_003413657.1.34673 WP_003413657.1.34724 WP_003413657.1.34740 WP_003413657.1.34755 WP_003413657.1.34777 WP_003413657.1.34783 WP_003413657.1.34841 WP_003413657.1.34908 WP_003413657.1.34919 WP_003413657.1.3492 WP_003413657.1.34933 WP_003413657.1.34946 WP_003413657.1.34954 WP_003413657.1.34961 WP_003413657.1.34963 WP_003413657.1.34965 WP_003413657.1.34968 WP_003413657.1.35023 WP_003413657.1.35069 WP_003413657.1.35072 WP_003413657.1.35078 WP_003413657.1.35100 WP_003413657.1.35146 WP_003413657.1.35156 WP_003413657.1.35160 WP_003413657.1.35162 WP_003413657.1.35173 WP_003413657.1.35176 WP_003413657.1.3520 WP_003413657.1.35213 WP_003413657.1.35221 WP_003413657.1.35246 WP_003413657.1.35278 WP_003413657.1.35301 WP_003413657.1.35311 WP_003413657.1.35312 WP_003413657.1.35319 WP_003413657.1.35347 WP_003413657.1.35363 WP_003413657.1.35382 WP_003413657.1.35385 WP_003413657.1.35396 WP_003413657.1.35426 WP_003413657.1.35439 WP_003413657.1.3548 WP_003413657.1.35484 WP_003413657.1.35492 WP_003413657.1.3553 WP_003413657.1.35553 WP_003413657.1.35555 WP_003413657.1.35561 WP_003413657.1.35602 WP_003413657.1.35610 WP_003413657.1.35635 WP_003413657.1.35680 WP_003413657.1.35689 WP_003413657.1.35732 WP_003413657.1.35754 WP_003413657.1.35767 WP_003413657.1.35770 WP_003413657.1.35780 WP_003413657.1.35805 WP_003413657.1.35811 WP_003413657.1.35821 WP_003413657.1.3584 WP_003413657.1.35848 WP_003413657.1.35864 WP_003413657.1.35874 WP_003413657.1.35876 WP_003413657.1.35897 WP_003413657.1.35899 WP_003413657.1.35923 WP_003413657.1.3593 WP_003413657.1.35954 WP_003413657.1.36005 WP_003413657.1.36014 WP_003413657.1.36023 WP_003413657.1.36053 WP_003413657.1.36075 WP_003413657.1.36089 WP_003413657.1.36097 WP_003413657.1.36098 WP_003413657.1.36116 WP_003413657.1.36145 WP_003413657.1.36156 WP_003413657.1.36205 WP_003413657.1.36228 WP_003413657.1.36246 WP_003413657.1.36252 WP_003413657.1.36260 WP_003413657.1.36270 WP_003413657.1.36271 WP_003413657.1.36303 WP_003413657.1.36309 WP_003413657.1.36315 WP_003413657.1.36319 WP_003413657.1.36321 WP_003413657.1.36326 WP_003413657.1.3634 WP_003413657.1.36356 WP_003413657.1.36357 WP_003413657.1.3636 WP_003413657.1.36385 WP_003413657.1.36399 WP_003413657.1.36436 WP_003413657.1.36465 WP_003413657.1.36469 WP_003413657.1.36473 WP_003413657.1.36485 WP_003413657.1.36508 WP_003413657.1.36540 WP_003413657.1.36561 WP_003413657.1.36571 WP_003413657.1.36573 WP_003413657.1.36578 WP_003413657.1.36585 WP_003413657.1.36597 WP_003413657.1.36614 WP_003413657.1.36657 WP_003413657.1.36674 WP_003413657.1.36720 WP_003413657.1.36727 WP_003413657.1.36733 WP_003413657.1.36785 WP_003413657.1.36810 WP_003413657.1.36844 WP_003413657.1.36851 WP_003413657.1.36862 WP_003413657.1.36893 WP_003413657.1.36921 WP_003413657.1.36935 WP_003413657.1.36941 WP_003413657.1.3695 WP_003413657.1.36951 WP_003413657.1.3700 WP_003413657.1.37012 WP_003413657.1.37071 WP_003413657.1.37088 WP_003413657.1.37131 WP_003413657.1.37157 WP_003413657.1.37175 WP_003413657.1.37188 WP_003413657.1.37213 WP_003413657.1.37229 WP_003413657.1.3724 WP_003413657.1.37277 WP_003413657.1.37305 WP_003413657.1.37330 WP_003413657.1.37389 WP_003413657.1.37400 WP_003413657.1.37440 WP_003413657.1.37459 WP_003413657.1.37468 WP_003413657.1.37475 WP_003413657.1.37484 WP_003413657.1.37601 WP_003413657.1.37612 WP_003413657.1.37632 WP_003413657.1.37643 WP_003413657.1.37655 WP_003413657.1.37660 WP_003413657.1.37674 WP_003413657.1.37700 WP_003413657.1.37701 WP_003413657.1.37709 WP_003413657.1.37711 WP_003413657.1.37721 WP_003413657.1.37722 WP_003413657.1.37765 WP_003413657.1.37772 WP_003413657.1.37804 WP_003413657.1.37859 WP_003413657.1.37877 WP_003413657.1.37912 WP_003413657.1.37913 WP_003413657.1.37943 WP_003413657.1.37950 WP_003413657.1.37973 WP_003413657.1.37975 WP_003413657.1.37983 WP_003413657.1.38 WP_003413657.1.38002 WP_003413657.1.3802 WP_003413657.1.38039 WP_003413657.1.38040 WP_003413657.1.38067 WP_003413657.1.38068 WP_003413657.1.38135 WP_003413657.1.38138 WP_003413657.1.38144 WP_003413657.1.38158 WP_003413657.1.38159 WP_003413657.1.38210 WP_003413657.1.38240 WP_003413657.1.38299 WP_003413657.1.38332 WP_003413657.1.38347 WP_003413657.1.38354 WP_003413657.1.38380 WP_003413657.1.38384 WP_003413657.1.38389 WP_003413657.1.38398 WP_003413657.1.38402 WP_003413657.1.38418 WP_003413657.1.38421 WP_003413657.1.38466 WP_003413657.1.38477 WP_003413657.1.38483 WP_003413657.1.3849 WP_003413657.1.385 WP_003413657.1.38530 WP_003413657.1.38535 WP_003413657.1.38539 WP_003413657.1.38594 WP_003413657.1.38611 WP_003413657.1.38638 WP_003413657.1.38639 WP_003413657.1.38646 WP_003413657.1.38648 WP_003413657.1.38654 WP_003413657.1.38659 WP_003413657.1.38660 WP_003413657.1.38666 WP_003413657.1.38671 WP_003413657.1.38677 WP_003413657.1.38750 WP_003413657.1.38772 WP_003413657.1.38812 WP_003413657.1.38821 WP_003413657.1.38844 WP_003413657.1.38863 WP_003413657.1.38865 WP_003413657.1.38873 WP_003413657.1.3889 WP_003413657.1.38894 WP_003413657.1.38909 WP_003413657.1.38939 WP_003413657.1.38975 WP_003413657.1.38991 WP_003413657.1.39025 WP_003413657.1.39070 WP_003413657.1.39072 WP_003413657.1.39095 WP_003413657.1.39106 WP_003413657.1.39165 WP_003413657.1.39176 WP_003413657.1.39190 WP_003413657.1.39201 WP_003413657.1.39207 WP_003413657.1.39211 WP_003413657.1.39236 WP_003413657.1.39239 WP_003413657.1.39252 WP_003413657.1.39288 WP_003413657.1.39295 WP_003413657.1.39306 WP_003413657.1.39359 WP_003413657.1.39364 WP_003413657.1.39400 WP_003413657.1.39447 WP_003413657.1.3945 WP_003413657.1.39450 WP_003413657.1.39455 WP_003413657.1.3949 WP_003413657.1.39521 WP_003413657.1.39560 WP_003413657.1.39592 WP_003413657.1.39593 WP_003413657.1.396 WP_003413657.1.3960 WP_003413657.1.39654 WP_003413657.1.39657 WP_003413657.1.39661 WP_003413657.1.39674 WP_003413657.1.39678 WP_003413657.1.3968 WP_003413657.1.39694 WP_003413657.1.3971 WP_003413657.1.39728 WP_003413657.1.39739 WP_003413657.1.39748 WP_003413657.1.39751 WP_003413657.1.39759 WP_003413657.1.39801 WP_003413657.1.39804 WP_003413657.1.39848 WP_003413657.1.39877 WP_003413657.1.39925 WP_003413657.1.3994 WP_003413657.1.39959 WP_003413657.1.3996 WP_003413657.1.39960 WP_003413657.1.3997 WP_003413657.1.39980 WP_003413657.1.40000 WP_003413657.1.40028 WP_003413657.1.40029 WP_003413657.1.4003 WP_003413657.1.40094 WP_003413657.1.40096 WP_003413657.1.40150 WP_003413657.1.40156 WP_003413657.1.40174 WP_003413657.1.40186 WP_003413657.1.40276 WP_003413657.1.40323 WP_003413657.1.40336 WP_003413657.1.40353 WP_003413657.1.40372 WP_003413657.1.40413 WP_003413657.1.40440 WP_003413657.1.40446 WP_003413657.1.40451 WP_003413657.1.40455 WP_003413657.1.40523 WP_003413657.1.40543 WP_003413657.1.40641 WP_003413657.1.40646 WP_003413657.1.40651 WP_003413657.1.40653 WP_003413657.1.4067 WP_003413657.1.40705 WP_003413657.1.40723 WP_003413657.1.40731 WP_003413657.1.40735 WP_003413657.1.40795 WP_003413657.1.40799 WP_003413657.1.40852 WP_003413657.1.40876 WP_003413657.1.40881 WP_003413657.1.40922 WP_003413657.1.40948 WP_003413657.1.4095 WP_003413657.1.40956 WP_003413657.1.40957 WP_003413657.1.4097 WP_003413657.1.410 WP_003413657.1.41000 WP_003413657.1.41055 WP_003413657.1.41123 WP_003413657.1.41177 WP_003413657.1.41202 WP_003413657.1.41219 WP_003413657.1.41231 WP_003413657.1.41249 WP_003413657.1.4127 WP_003413657.1.41296 WP_003413657.1.41355 WP_003413657.1.41376 WP_003413657.1.41430 WP_003413657.1.41447 WP_003413657.1.41469 WP_003413657.1.41504 WP_003413657.1.41564 WP_003413657.1.41583 WP_003413657.1.41616 WP_003413657.1.41635 WP_003413657.1.41636 WP_003413657.1.41648 WP_003413657.1.41660 WP_003413657.1.41685 WP_003413657.1.41695 WP_003413657.1.41704 WP_003413657.1.4171 WP_003413657.1.41719 WP_003413657.1.41733 WP_003413657.1.41744 WP_003413657.1.41774 WP_003413657.1.41791 WP_003413657.1.41803 WP_003413657.1.41820 WP_003413657.1.41828 WP_003413657.1.41829 WP_003413657.1.41860 WP_003413657.1.41912 WP_003413657.1.41933 WP_003413657.1.41944 WP_003413657.1.42043 WP_003413657.1.42075 WP_003413657.1.42078 WP_003413657.1.42094 WP_003413657.1.42112 WP_003413657.1.4212 WP_003413657.1.42134 WP_003413657.1.42183 WP_003413657.1.42188 WP_003413657.1.42201 WP_003413657.1.42202 WP_003413657.1.42208 WP_003413657.1.42247 WP_003413657.1.42255 WP_003413657.1.42273 WP_003413657.1.42278 WP_003413657.1.42304 WP_003413657.1.42309 WP_003413657.1.42370 WP_003413657.1.42385 WP_003413657.1.42409 WP_003413657.1.42414 WP_003413657.1.42417 WP_003413657.1.42430 WP_003413657.1.42461 WP_003413657.1.42465 WP_003413657.1.42467 WP_003413657.1.42473 WP_003413657.1.42474 WP_003413657.1.42494 WP_003413657.1.42519 WP_003413657.1.42524 WP_003413657.1.42534 WP_003413657.1.42562 WP_003413657.1.42568 WP_003413657.1.42570 WP_003413657.1.42618 WP_003413657.1.42660 WP_003413657.1.42695 WP_003413657.1.42704 WP_003413657.1.42705 WP_003413657.1.42777 WP_003413657.1.42782 WP_003413657.1.42835 WP_003413657.1.42839 WP_003413657.1.42842 WP_003413657.1.42905 WP_003413657.1.42916 WP_003413657.1.42930 WP_003413657.1.42971 WP_003413657.1.43005 WP_003413657.1.43009 WP_003413657.1.43053 WP_003413657.1.43082 WP_003413657.1.43087 WP_003413657.1.43098 WP_003413657.1.43208 WP_003413657.1.43236 WP_003413657.1.43246 WP_003413657.1.43255 WP_003413657.1.43266 WP_003413657.1.43269 WP_003413657.1.43273 WP_003413657.1.43296 WP_003413657.1.4335 WP_003413657.1.43368 WP_003413657.1.43395 WP_003413657.1.43475 WP_003413657.1.43484 WP_003413657.1.43557 WP_003413657.1.43578 WP_003413657.1.43588 WP_003413657.1.43643 WP_003413657.1.43664 WP_003413657.1.43686 WP_003413657.1.43706 WP_003413657.1.43716 WP_003413657.1.4377 WP_003413657.1.43781 WP_003413657.1.43794 WP_003413657.1.43815 WP_003413657.1.43846 WP_003413657.1.43861 WP_003413657.1.43863 WP_003413657.1.43866 WP_003413657.1.43872 WP_003413657.1.43885 WP_003413657.1.43897 WP_003413657.1.4390 WP_003413657.1.43902 WP_003413657.1.43921 WP_003413657.1.43936 WP_003413657.1.43937 WP_003413657.1.43960 WP_003413657.1.43965 WP_003413657.1.4399 WP_003413657.1.43993 WP_003413657.1.43996 WP_003413657.1.44 WP_003413657.1.44001 WP_003413657.1.44008 WP_003413657.1.44016 WP_003413657.1.44033 WP_003413657.1.44041 WP_003413657.1.44070 WP_003413657.1.44071 WP_003413657.1.44076 WP_003413657.1.44104 WP_003413657.1.44111 WP_003413657.1.44124 WP_003413657.1.44169 WP_003413657.1.44219 WP_003413657.1.44237 WP_003413657.1.44277 WP_003413657.1.44279 WP_003413657.1.44336 WP_003413657.1.44355 WP_003413657.1.44358 WP_003413657.1.4438 WP_003413657.1.44392 WP_003413657.1.4441 WP_003413657.1.44415 WP_003413657.1.44464 WP_003413657.1.44466 WP_003413657.1.44489 WP_003413657.1.44492 WP_003413657.1.44494 WP_003413657.1.44500 WP_003413657.1.44519 WP_003413657.1.44526 WP_003413657.1.44532 WP_003413657.1.44534 WP_003413657.1.44589 WP_003413657.1.44597 WP_003413657.1.44600 WP_003413657.1.44615 WP_003413657.1.4464 WP_003413657.1.44651 WP_003413657.1.44659 WP_003413657.1.44665 WP_003413657.1.44694 WP_003413657.1.44700 WP_003413657.1.44713 WP_003413657.1.44735 WP_003413657.1.44740 WP_003413657.1.44757 WP_003413657.1.4476 WP_003413657.1.44761 WP_003413657.1.44767 WP_003413657.1.44776 WP_003413657.1.44786 WP_003413657.1.44808 WP_003413657.1.44864 WP_003413657.1.44901 WP_003413657.1.44908 WP_003413657.1.44913 WP_003413657.1.44939 WP_003413657.1.44981 WP_003413657.1.45002 WP_003413657.1.45011 WP_003413657.1.4504 WP_003413657.1.45062 WP_003413657.1.45066 WP_003413657.1.45081 WP_003413657.1.45113 WP_003413657.1.45129 WP_003413657.1.45135 WP_003413657.1.45147 WP_003413657.1.45168 WP_003413657.1.4517 WP_003413657.1.45181 WP_003413657.1.45185 WP_003413657.1.45192 WP_003413657.1.45200 WP_003413657.1.45205 WP_003413657.1.45211 WP_003413657.1.45249 WP_003413657.1.4526 WP_003413657.1.45286 WP_003413657.1.45347 WP_003413657.1.45374 WP_003413657.1.45390 WP_003413657.1.454 WP_003413657.1.45407 WP_003413657.1.45451 WP_003413657.1.45453 WP_003413657.1.45460 WP_003413657.1.45463 WP_003413657.1.45470 WP_003413657.1.45474 WP_003413657.1.45491 WP_003413657.1.45510 WP_003413657.1.45563 WP_003413657.1.45584 WP_003413657.1.45590 WP_003413657.1.45619 WP_003413657.1.45666 WP_003413657.1.45697 WP_003413657.1.4571 WP_003413657.1.45731 WP_003413657.1.45743 WP_003413657.1.45765 WP_003413657.1.45776 WP_003413657.1.45783 WP_003413657.1.45805 WP_003413657.1.45815 WP_003413657.1.45849 WP_003413657.1.45867 WP_003413657.1.45884 WP_003413657.1.4590 WP_003413657.1.45923 WP_003413657.1.45926 WP_003413657.1.45963 WP_003413657.1.45989 WP_003413657.1.45992 WP_003413657.1.46025 WP_003413657.1.46083 WP_003413657.1.46090 WP_003413657.1.46092 WP_003413657.1.46101 WP_003413657.1.46107 WP_003413657.1.46127 WP_003413657.1.46128 WP_003413657.1.46129 WP_003413657.1.46141 WP_003413657.1.46150 WP_003413657.1.46201 WP_003413657.1.46226 WP_003413657.1.4624 WP_003413657.1.46253 WP_003413657.1.46268 WP_003413657.1.46285 WP_003413657.1.46300 WP_003413657.1.46336 WP_003413657.1.46365 WP_003413657.1.46370 WP_003413657.1.46381 WP_003413657.1.46402 WP_003413657.1.46411 WP_003413657.1.4644 WP_003413657.1.46453 WP_003413657.1.46463 WP_003413657.1.46478 WP_003413657.1.46492 WP_003413657.1.46521 WP_003413657.1.4653 WP_003413657.1.46532 WP_003413657.1.46539 WP_003413657.1.46568 WP_003413657.1.46585 WP_003413657.1.46613 WP_003413657.1.46625 WP_003413657.1.46642 WP_003413657.1.46647 WP_003413657.1.46674 WP_003413657.1.46773 WP_003413657.1.46786 WP_003413657.1.46792 WP_003413657.1.46847 WP_003413657.1.46851 WP_003413657.1.4687 WP_003413657.1.46897 WP_003413657.1.46936 WP_003413657.1.46980 WP_003413657.1.47011 WP_003413657.1.47012 WP_003413657.1.47066 WP_003413657.1.47106 WP_003413657.1.47142 WP_003413657.1.47147 WP_003413657.1.47166 WP_003413657.1.47194 WP_003413657.1.47207 WP_003413657.1.47210 WP_003413657.1.47261 WP_003413657.1.47262 WP_003413657.1.47402 WP_003413657.1.47423 WP_003413657.1.47467 WP_003413657.1.47502 WP_003413657.1.47511 WP_003413657.1.47540 WP_003413657.1.47568 WP_003413657.1.47588 WP_003413657.1.47636 WP_003413657.1.4764 WP_003413657.1.47679 WP_003413657.1.47681 WP_003413657.1.47690 WP_003413657.1.4771 WP_003413657.1.47717 WP_003413657.1.47743 WP_003413657.1.47754 WP_003413657.1.47773 WP_003413657.1.47776 WP_003413657.1.47780 WP_003413657.1.47805 WP_003413657.1.47832 WP_003413657.1.47847 WP_003413657.1.47858 WP_003413657.1.47861 WP_003413657.1.47893 WP_003413657.1.47899 WP_003413657.1.479 WP_003413657.1.47912 WP_003413657.1.47913 WP_003413657.1.47926 WP_003413657.1.4794 WP_003413657.1.47943 WP_003413657.1.47944 WP_003413657.1.47959 WP_003413657.1.47974 WP_003413657.1.47993 WP_003413657.1.48004 WP_003413657.1.48039 WP_003413657.1.48050 WP_003413657.1.48084 WP_003413657.1.48097 WP_003413657.1.48101 WP_003413657.1.48109 WP_003413657.1.4813 WP_003413657.1.48130 WP_003413657.1.48135 WP_003413657.1.48143 WP_003413657.1.48152 WP_003413657.1.48155 WP_003413657.1.48170 WP_003413657.1.48173 WP_003413657.1.48177 WP_003413657.1.48185 WP_003413657.1.48219 WP_003413657.1.4823 WP_003413657.1.48240 WP_003413657.1.48256 WP_003413657.1.48264 WP_003413657.1.48287 WP_003413657.1.48330 WP_003413657.1.48348 WP_003413657.1.48354 WP_003413657.1.48372 WP_003413657.1.48383 WP_003413657.1.48388 WP_003413657.1.48419 WP_003413657.1.48423 WP_003413657.1.48443 WP_003413657.1.48450 WP_003413657.1.48543 WP_003413657.1.48550 WP_003413657.1.48605 WP_003413657.1.4863 WP_003413657.1.48648 WP_003413657.1.48658 WP_003413657.1.48666 WP_003413657.1.48687 WP_003413657.1.48779 WP_003413657.1.48798 WP_003413657.1.48802 WP_003413657.1.48826 WP_003413657.1.48843 WP_003413657.1.48857 WP_003413657.1.4890 WP_003413657.1.48946 WP_003413657.1.48979 WP_003413657.1.49017 WP_003413657.1.49048 WP_003413657.1.4906 WP_003413657.1.4907 WP_003413657.1.49103 WP_003413657.1.49110 WP_003413657.1.49111 WP_003413657.1.4919 WP_003413657.1.49254 WP_003413657.1.49263 WP_003413657.1.49291 WP_003413657.1.49296 WP_003413657.1.49335 WP_003413657.1.49337 WP_003413657.1.49419 WP_003413657.1.49426 WP_003413657.1.49437 WP_003413657.1.49439 WP_003413657.1.49474 WP_003413657.1.49506 WP_003413657.1.49516 WP_003413657.1.49523 WP_003413657.1.49526 WP_003413657.1.49532 WP_003413657.1.49588 WP_003413657.1.4959 WP_003413657.1.49687 WP_003413657.1.49699 WP_003413657.1.49709 WP_003413657.1.4971 WP_003413657.1.4972 WP_003413657.1.49746 WP_003413657.1.49764 WP_003413657.1.49773 WP_003413657.1.49796 WP_003413657.1.49814 WP_003413657.1.49815 WP_003413657.1.49816 WP_003413657.1.49839 WP_003413657.1.49857 WP_003413657.1.49878 WP_003413657.1.49880 WP_003413657.1.49944 WP_003413657.1.4999 WP_003413657.1.50068 WP_003413657.1.5008 WP_003413657.1.50081 WP_003413657.1.50122 WP_003413657.1.50126 WP_003413657.1.50149 WP_003413657.1.5018 WP_003413657.1.50194 WP_003413657.1.50218 WP_003413657.1.50235 WP_003413657.1.50249 WP_003413657.1.50265 WP_003413657.1.50271 WP_003413657.1.50324 WP_003413657.1.50372 WP_003413657.1.50398 WP_003413657.1.50407 WP_003413657.1.50444 WP_003413657.1.50466 WP_003413657.1.50472 WP_003413657.1.5048 WP_003413657.1.50498 WP_003413657.1.5050 WP_003413657.1.50540 WP_003413657.1.50554 WP_003413657.1.50557 WP_003413657.1.50610 WP_003413657.1.50632 WP_003413657.1.50633 WP_003413657.1.50642 WP_003413657.1.50655 WP_003413657.1.50659 WP_003413657.1.50683 WP_003413657.1.50689 WP_003413657.1.50692 WP_003413657.1.50714 WP_003413657.1.50729 WP_003413657.1.50756 WP_003413657.1.50784 WP_003413657.1.50794 WP_003413657.1.50841 WP_003413657.1.50868 WP_003413657.1.50877 WP_003413657.1.5096 WP_003413657.1.50981 WP_003413657.1.50987 WP_003413657.1.51037 WP_003413657.1.51074 WP_003413657.1.51082 WP_003413657.1.51101 WP_003413657.1.51116 WP_003413657.1.51149 WP_003413657.1.51156 WP_003413657.1.51157 WP_003413657.1.51213 WP_003413657.1.51232 WP_003413657.1.51247 WP_003413657.1.51266 WP_003413657.1.51279 WP_003413657.1.51291 WP_003413657.1.51301 WP_003413657.1.51329 WP_003413657.1.51391 WP_003413657.1.51422 WP_003413657.1.51455 WP_003413657.1.51466 WP_003413657.1.51468 WP_003413657.1.51478 WP_003413657.1.51497 WP_003413657.1.51593 WP_003413657.1.51628 WP_003413657.1.5164 WP_003413657.1.51647 WP_003413657.1.51660 WP_003413657.1.51721 WP_003413657.1.51788 WP_003413657.1.51795 WP_003413657.1.51801 WP_003413657.1.51817 WP_003413657.1.51819 WP_003413657.1.51854 WP_003413657.1.51923 WP_003413657.1.51942 WP_003413657.1.51948 WP_003413657.1.51963 WP_003413657.1.51969 WP_003413657.1.52000 WP_003413657.1.52001 WP_003413657.1.52006 WP_003413657.1.52036 WP_003413657.1.52038 WP_003413657.1.52046 WP_003413657.1.52059 WP_003413657.1.52082 WP_003413657.1.52102 WP_003413657.1.52106 WP_003413657.1.52166 WP_003413657.1.52168 WP_003413657.1.52173 WP_003413657.1.52178 WP_003413657.1.52206 WP_003413657.1.52216 WP_003413657.1.52238 WP_003413657.1.52241 WP_003413657.1.52280 WP_003413657.1.52314 WP_003413657.1.52385 WP_003413657.1.52390 WP_003413657.1.524 WP_003413657.1.52460 WP_003413657.1.52485 WP_003413657.1.52486 WP_003413657.1.52495 WP_003413657.1.52504 WP_003413657.1.52522 WP_003413657.1.52531 WP_003413657.1.52533 WP_003413657.1.52545 WP_003413657.1.52563 WP_003413657.1.52564 WP_003413657.1.52574 WP_003413657.1.52641 WP_003413657.1.52673 WP_003413657.1.52674 WP_003413657.1.52708 WP_003413657.1.52713 WP_003413657.1.52761 WP_003413657.1.52778 WP_003413657.1.52791 WP_003413657.1.52797 WP_003413657.1.52818 WP_003413657.1.52872 WP_003413657.1.52873 WP_003413657.1.52891 WP_003413657.1.52892 WP_003413657.1.52909 WP_003413657.1.52970 WP_003413657.1.52998 WP_003413657.1.53053 WP_003413657.1.53056 WP_003413657.1.5306 WP_003413657.1.53088 WP_003413657.1.5309 WP_003413657.1.531 WP_003413657.1.53117 WP_003413657.1.53118 WP_003413657.1.53142 WP_003413657.1.53143 WP_003413657.1.53157 WP_003413657.1.53167 WP_003413657.1.53200 WP_003413657.1.53204 WP_003413657.1.53217 WP_003413657.1.53226 WP_003413657.1.53229 WP_003413657.1.53230 WP_003413657.1.53237 WP_003413657.1.53254 WP_003413657.1.53257 WP_003413657.1.5327 WP_003413657.1.53276 WP_003413657.1.53278 WP_003413657.1.53302 WP_003413657.1.53306 WP_003413657.1.5334 WP_003413657.1.5335 WP_003413657.1.53353 WP_003413657.1.53413 WP_003413657.1.53458 WP_003413657.1.53460 WP_003413657.1.53480 WP_003413657.1.53517 WP_003413657.1.53522 WP_003413657.1.53525 WP_003413657.1.53526 WP_003413657.1.53553 WP_003413657.1.53606 WP_003413657.1.53609 WP_003413657.1.53628 WP_003413657.1.53643 WP_003413657.1.53667 WP_003413657.1.53679 WP_003413657.1.53715 WP_003413657.1.53730 WP_003413657.1.53742 WP_003413657.1.53743 WP_003413657.1.53775 WP_003413657.1.53787 WP_003413657.1.53803 WP_003413657.1.53818 WP_003413657.1.53822 WP_003413657.1.53853 WP_003413657.1.53865 WP_003413657.1.53888 WP_003413657.1.53912 WP_003413657.1.53914 WP_003413657.1.53952 WP_003413657.1.5398 WP_003413657.1.54089 WP_003413657.1.54093 WP_003413657.1.54099 WP_003413657.1.54112 WP_003413657.1.54125 WP_003413657.1.54141 WP_003413657.1.54162 WP_003413657.1.54179 WP_003413657.1.54218 WP_003413657.1.54225 WP_003413657.1.54227 WP_003413657.1.54232 WP_003413657.1.54241 WP_003413657.1.54247 WP_003413657.1.54260 WP_003413657.1.54280 WP_003413657.1.5429 WP_003413657.1.54294 WP_003413657.1.54314 WP_003413657.1.54347 WP_003413657.1.54351 WP_003413657.1.54370 WP_003413657.1.54428 WP_003413657.1.54449 WP_003413657.1.54494 WP_003413657.1.54502 WP_003413657.1.54514 WP_003413657.1.54519 WP_003413657.1.5452 WP_003413657.1.54531 WP_003413657.1.54537 WP_003413657.1.54553 WP_003413657.1.54555 WP_003413657.1.54575 WP_003413657.1.54633 WP_003413657.1.54686 WP_003413657.1.54687 WP_003413657.1.54705 WP_003413657.1.54730 WP_003413657.1.54732 WP_003413657.1.5475 WP_003413657.1.54797 WP_003413657.1.54807 WP_003413657.1.54836 WP_003413657.1.54838 WP_003413657.1.54888 WP_003413657.1.54897 WP_003413657.1.54905 WP_003413657.1.54909 WP_003413657.1.54937 WP_003413657.1.54939 WP_003413657.1.54944 WP_003413657.1.54945 WP_003413657.1.54953 WP_003413657.1.54964 WP_003413657.1.55015 WP_003413657.1.55022 WP_003413657.1.55023 WP_003413657.1.55051 WP_003413657.1.55072 WP_003413657.1.55088 WP_003413657.1.55106 WP_003413657.1.55126 WP_003413657.1.55128 WP_003413657.1.55150 WP_003413657.1.55210 WP_003413657.1.55227 WP_003413657.1.55248 WP_003413657.1.55257 WP_003413657.1.55258 WP_003413657.1.55267 WP_003413657.1.55279 WP_003413657.1.55307 WP_003413657.1.55326 WP_003413657.1.55328 WP_003413657.1.5533 WP_003413657.1.55345 WP_003413657.1.55396 WP_003413657.1.55398 WP_003413657.1.55441 WP_003413657.1.55459 WP_003413657.1.55501 WP_003413657.1.55504 WP_003413657.1.55578 WP_003413657.1.55626 WP_003413657.1.55641 WP_003413657.1.5569 WP_003413657.1.55723 WP_003413657.1.55735 WP_003413657.1.5574 WP_003413657.1.55772 WP_003413657.1.55802 WP_003413657.1.55807 WP_003413657.1.55819 WP_003413657.1.55821 WP_003413657.1.5583 WP_003413657.1.55856 WP_003413657.1.55883 WP_003413657.1.55902 WP_003413657.1.55909 WP_003413657.1.5591 WP_003413657.1.55961 WP_003413657.1.55977 WP_003413657.1.56028 WP_003413657.1.56057 WP_003413657.1.56060 WP_003413657.1.56107 WP_003413657.1.56132 WP_003413657.1.56163 WP_003413657.1.56167 WP_003413657.1.56178 WP_003413657.1.56287 WP_003413657.1.56292 WP_003413657.1.56327 WP_003413657.1.56341 WP_003413657.1.56359 WP_003413657.1.56365 WP_003413657.1.56394 WP_003413657.1.56443 WP_003413657.1.56473 WP_003413657.1.56478 WP_003413657.1.56500 WP_003413657.1.56517 WP_003413657.1.56534 WP_003413657.1.5656 WP_003413657.1.56577 WP_003413657.1.56593 WP_003413657.1.56625 WP_003413657.1.56637 WP_003413657.1.56670 WP_003413657.1.56697 WP_003413657.1.567 WP_003413657.1.56701 WP_003413657.1.56709 WP_003413657.1.56729 WP_003413657.1.56743 WP_003413657.1.56755 WP_003413657.1.56769 WP_003413657.1.56770 WP_003413657.1.56795 WP_003413657.1.5681 WP_003413657.1.56827 WP_003413657.1.56839 WP_003413657.1.56863 WP_003413657.1.56868 WP_003413657.1.56915 WP_003413657.1.56926 WP_003413657.1.56961 WP_003413657.1.56971 WP_003413657.1.56972 WP_003413657.1.57023 WP_003413657.1.57035 WP_003413657.1.57077 WP_003413657.1.57087 WP_003413657.1.57094 WP_003413657.1.57134 WP_003413657.1.57151 WP_003413657.1.57169 WP_003413657.1.57208 WP_003413657.1.57212 WP_003413657.1.57230 WP_003413657.1.5724 WP_003413657.1.5725 WP_003413657.1.5727 WP_003413657.1.57273 WP_003413657.1.573 WP_003413657.1.57314 WP_003413657.1.57326 WP_003413657.1.57331 WP_003413657.1.57340 WP_003413657.1.57351 WP_003413657.1.57352 WP_003413657.1.57380 WP_003413657.1.57430 WP_003413657.1.5744 WP_003413657.1.57440 WP_003413657.1.5745 WP_003413657.1.57461 WP_003413657.1.57469 WP_003413657.1.57489 WP_003413657.1.575 WP_003413657.1.57509 WP_003413657.1.57519 WP_003413657.1.57525 WP_003413657.1.57551 WP_003413657.1.5758 WP_003413657.1.57596 WP_003413657.1.57604 WP_003413657.1.57616 WP_003413657.1.57617 WP_003413657.1.57619 WP_003413657.1.57627 WP_003413657.1.57642 WP_003413657.1.57658 WP_003413657.1.57667 WP_003413657.1.57675 WP_003413657.1.57689 WP_003413657.1.57708 WP_003413657.1.57794 WP_003413657.1.57821 WP_003413657.1.57825 WP_003413657.1.57843 WP_003413657.1.57906 WP_003413657.1.57924 WP_003413657.1.57926 WP_003413657.1.57930 WP_003413657.1.57957 WP_003413657.1.57960 WP_003413657.1.57964 WP_003413657.1.57991 WP_003413657.1.58000 WP_003413657.1.58086 WP_003413657.1.58101 WP_003413657.1.58103 WP_003413657.1.58108 WP_003413657.1.5811 WP_003413657.1.58121 WP_003413657.1.58145 WP_003413657.1.58164 WP_003413657.1.58174 WP_003413657.1.582 WP_003413657.1.58202 WP_003413657.1.5824 WP_003413657.1.58259 WP_003413657.1.58283 WP_003413657.1.58288 WP_003413657.1.5830 WP_003413657.1.58303 WP_003413657.1.58311 WP_003413657.1.58330 WP_003413657.1.58359 WP_003413657.1.58386 WP_003413657.1.58393 WP_003413657.1.58431 WP_003413657.1.5844 WP_003413657.1.58488 WP_003413657.1.58518 WP_003413657.1.58534 WP_003413657.1.58559 WP_003413657.1.58567 WP_003413657.1.58573 WP_003413657.1.58602 WP_003413657.1.58619 WP_003413657.1.58630 WP_003413657.1.5865 WP_003413657.1.58671 WP_003413657.1.58690 WP_003413657.1.58702 WP_003413657.1.58743 WP_003413657.1.58754 WP_003413657.1.5881 WP_003413657.1.58848 WP_003413657.1.58857 WP_003413657.1.58891 WP_003413657.1.58892 WP_003413657.1.5890 WP_003413657.1.58921 WP_003413657.1.58939 WP_003413657.1.58941 WP_003413657.1.58953 WP_003413657.1.5898 WP_003413657.1.59025 WP_003413657.1.59029 WP_003413657.1.59037 WP_003413657.1.59044 WP_003413657.1.59085 WP_003413657.1.59088 WP_003413657.1.59130 WP_003413657.1.5914 WP_003413657.1.59147 WP_003413657.1.59166 WP_003413657.1.59205 WP_003413657.1.59209 WP_003413657.1.59237 WP_003413657.1.59240 WP_003413657.1.59253 WP_003413657.1.59254 WP_003413657.1.59262 WP_003413657.1.59270 WP_003413657.1.5928 WP_003413657.1.59304 WP_003413657.1.59305 WP_003413657.1.59309 WP_003413657.1.59316 WP_003413657.1.59326 WP_003413657.1.59328 WP_003413657.1.59333 WP_003413657.1.59338 WP_003413657.1.59388 WP_003413657.1.59428 WP_003413657.1.59487 WP_003413657.1.59537 WP_003413657.1.59561 WP_003413657.1.59677 WP_003413657.1.59722 WP_003413657.1.59732 WP_003413657.1.59738 WP_003413657.1.59750 WP_003413657.1.59757 WP_003413657.1.59808 WP_003413657.1.59850 WP_003413657.1.59856 WP_003413657.1.59861 WP_003413657.1.5987 WP_003413657.1.59878 WP_003413657.1.59888 WP_003413657.1.59952 WP_003413657.1.5996 WP_003413657.1.59961 WP_003413657.1.59974 WP_003413657.1.6000 WP_003413657.1.60007 WP_003413657.1.60016 WP_003413657.1.6003 WP_003413657.1.60047 WP_003413657.1.6007 WP_003413657.1.60091 WP_003413657.1.60121 WP_003413657.1.60125 WP_003413657.1.60135 WP_003413657.1.60139 WP_003413657.1.60152 WP_003413657.1.60171 WP_003413657.1.60197 WP_003413657.1.6020 WP_003413657.1.60205 WP_003413657.1.60207 WP_003413657.1.60215 WP_003413657.1.60267 WP_003413657.1.60288 WP_003413657.1.60291 WP_003413657.1.60301 WP_003413657.1.60305 WP_003413657.1.60312 WP_003413657.1.60313 WP_003413657.1.60314 WP_003413657.1.60413 WP_003413657.1.60421 WP_003413657.1.60451 WP_003413657.1.60460 WP_003413657.1.60479 WP_003413657.1.60487 WP_003413657.1.60512 WP_003413657.1.60573 WP_003413657.1.60583 WP_003413657.1.60632 WP_003413657.1.60657 WP_003413657.1.60687 WP_003413657.1.60689 WP_003413657.1.60727 WP_003413657.1.60738 WP_003413657.1.60763 WP_003413657.1.60791 WP_003413657.1.60834 WP_003413657.1.60870 WP_003413657.1.60878 WP_003413657.1.60879 WP_003413657.1.60913 WP_003413657.1.60978 WP_003413657.1.61000 WP_003413657.1.61001 WP_003413657.1.61012 WP_003413657.1.61014 WP_003413657.1.61015 WP_003413657.1.61037 WP_003413657.1.61052 WP_003413657.1.61065 WP_003413657.1.61100 WP_003413657.1.61101 WP_003413657.1.61138 WP_003413657.1.61142 WP_003413657.1.61198 WP_003413657.1.612 WP_003413657.1.61234 WP_003413657.1.61256 WP_003413657.1.61281 WP_003413657.1.61314 WP_003413657.1.61321 WP_003413657.1.61328 WP_003413657.1.61368 WP_003413657.1.61391 WP_003413657.1.61409 WP_003413657.1.61420 WP_003413657.1.61422 WP_003413657.1.61428 WP_003413657.1.61469 WP_003413657.1.61494 WP_003413657.1.61522 WP_003413657.1.61552 WP_003413657.1.61567 WP_003413657.1.61573 WP_003413657.1.61584 WP_003413657.1.61586 WP_003413657.1.6159 WP_003413657.1.61592 WP_003413657.1.6160 WP_003413657.1.61614 WP_003413657.1.6163 WP_003413657.1.61665 WP_003413657.1.61669 WP_003413657.1.61682 WP_003413657.1.61692 WP_003413657.1.61719 WP_003413657.1.61728 WP_003413657.1.61750 WP_003413657.1.61754 WP_003413657.1.61755 WP_003413657.1.61757 WP_003413657.1.61778 WP_003413657.1.6179 WP_003413657.1.61793 WP_003413657.1.61816 WP_003413657.1.61842 WP_003413657.1.61850 WP_003413657.1.61862 WP_003413657.1.61865 WP_003413657.1.61868 WP_003413657.1.61911 WP_003413657.1.61925 WP_003413657.1.61941 WP_003413657.1.61953 WP_003413657.1.61979 WP_003413657.1.61986 WP_003413657.1.61987 WP_003413657.1.62021 WP_003413657.1.62087 WP_003413657.1.62089 WP_003413657.1.62104 WP_003413657.1.6211 WP_003413657.1.62132 WP_003413657.1.62162 WP_003413657.1.62225 WP_003413657.1.62238 WP_003413657.1.62249 WP_003413657.1.62270 WP_003413657.1.62281 WP_003413657.1.62307 WP_003413657.1.6231 WP_003413657.1.62359 WP_003413657.1.62360 WP_003413657.1.62371 WP_003413657.1.62379 WP_003413657.1.62395 WP_003413657.1.62408 WP_003413657.1.62468 WP_003413657.1.6248 WP_003413657.1.62508 WP_003413657.1.62565 WP_003413657.1.62594 WP_003413657.1.62606 WP_003413657.1.62616 WP_003413657.1.62687 WP_003413657.1.62715 WP_003413657.1.62730 WP_003413657.1.62738 WP_003413657.1.62761 WP_003413657.1.62766 WP_003413657.1.62786 WP_003413657.1.62813 WP_003413657.1.62839 WP_003413657.1.62909 WP_003413657.1.62936 WP_003413657.1.6294 WP_003413657.1.6295 WP_003413657.1.62962 WP_003413657.1.63007 WP_003413657.1.63019 WP_003413657.1.63032 WP_003413657.1.63064 WP_003413657.1.63066 WP_003413657.1.63072 WP_003413657.1.6308 WP_003413657.1.63081 WP_003413657.1.63096 WP_003413657.1.63106 WP_003413657.1.6314 WP_003413657.1.63144 WP_003413657.1.63154 WP_003413657.1.63160 WP_003413657.1.63161 WP_003413657.1.63166 WP_003413657.1.63194 WP_003413657.1.6322 WP_003413657.1.63222 WP_003413657.1.63247 WP_003413657.1.6328 WP_003413657.1.63291 WP_003413657.1.63317 WP_003413657.1.63331 WP_003413657.1.63373 WP_003413657.1.63384 WP_003413657.1.63403 WP_003413657.1.63424 WP_003413657.1.63428 WP_003413657.1.6345 WP_003413657.1.63464 WP_003413657.1.63483 WP_003413657.1.63502 WP_003413657.1.63504 WP_003413657.1.63538 WP_003413657.1.63564 WP_003413657.1.63567 WP_003413657.1.63596 WP_003413657.1.63600 WP_003413657.1.63623 WP_003413657.1.63625 WP_003413657.1.63627 WP_003413657.1.63654 WP_003413657.1.63662 WP_003413657.1.63711 WP_003413657.1.63734 WP_003413657.1.63819 WP_003413657.1.63844 WP_003413657.1.63913 WP_003413657.1.63915 WP_003413657.1.63918 WP_003413657.1.63961 WP_003413657.1.63970 WP_003413657.1.64000 WP_003413657.1.64027 WP_003413657.1.64058 WP_003413657.1.64065 WP_003413657.1.64082 WP_003413657.1.64091 WP_003413657.1.64102 WP_003413657.1.64104 WP_003413657.1.64119 WP_003413657.1.64219 WP_003413657.1.6422 WP_003413657.1.64222 WP_003413657.1.64223 WP_003413657.1.64228 WP_003413657.1.64235 WP_003413657.1.64249 WP_003413657.1.6427 WP_003413657.1.64278 WP_003413657.1.64414 WP_003413657.1.64419 WP_003413657.1.6443 WP_003413657.1.64463 WP_003413657.1.64480 WP_003413657.1.64506 WP_003413657.1.64513 WP_003413657.1.64514 WP_003413657.1.64515 WP_003413657.1.64522 WP_003413657.1.64526 WP_003413657.1.64543 WP_003413657.1.6456 WP_003413657.1.64567 WP_003413657.1.64588 WP_003413657.1.64589 WP_003413657.1.64594 WP_003413657.1.64595 WP_003413657.1.64608 WP_003413657.1.64619 WP_003413657.1.64629 WP_003413657.1.6464 WP_003413657.1.64664 WP_003413657.1.64669 WP_003413657.1.64672 WP_003413657.1.64680 WP_003413657.1.64682 WP_003413657.1.64727 WP_003413657.1.64729 WP_003413657.1.64774 WP_003413657.1.64776 WP_003413657.1.64802 WP_003413657.1.64832 WP_003413657.1.6486 WP_003413657.1.64870 WP_003413657.1.64898 WP_003413657.1.64922 WP_003413657.1.64924 WP_003413657.1.6493 WP_003413657.1.64937 WP_003413657.1.64941 WP_003413657.1.64966 WP_003413657.1.64973 WP_003413657.1.65001 WP_003413657.1.65026 WP_003413657.1.65053 WP_003413657.1.65102 WP_003413657.1.65157 WP_003413657.1.65181 WP_003413657.1.65212 WP_003413657.1.65229 WP_003413657.1.6523 WP_003413657.1.65253 WP_003413657.1.65289 WP_003413657.1.65291 WP_003413657.1.65315 WP_003413657.1.65329 WP_003413657.1.6536 WP_003413657.1.65414 WP_003413657.1.65416 WP_003413657.1.65433 WP_003413657.1.65455 WP_003413657.1.65467 WP_003413657.1.65488 WP_003413657.1.65529 WP_003413657.1.65539 WP_003413657.1.65583 WP_003413657.1.65612 WP_003413657.1.65623 WP_003413657.1.65635 WP_003413657.1.65648 WP_003413657.1.65683 WP_003413657.1.65686 WP_003413657.1.65688 WP_003413657.1.65707 WP_003413657.1.65733 WP_003413657.1.65746 WP_003413657.1.65747 WP_003413657.1.65759 WP_003413657.1.65816 WP_003413657.1.65830 WP_003413657.1.65862 WP_003413657.1.65869 WP_003413657.1.65929 WP_003413657.1.65958 WP_003413657.1.65974 WP_003413657.1.66004 WP_003413657.1.66013 WP_003413657.1.6606 WP_003413657.1.66089 WP_003413657.1.66149 WP_003413657.1.66151 WP_003413657.1.66229 WP_003413657.1.66276 WP_003413657.1.66293 WP_003413657.1.66297 WP_003413657.1.66323 WP_003413657.1.66325 WP_003413657.1.6633 WP_003413657.1.66334 WP_003413657.1.66355 WP_003413657.1.66367 WP_003413657.1.66394 WP_003413657.1.66396 WP_003413657.1.66451 WP_003413657.1.66455 WP_003413657.1.66457 WP_003413657.1.66460 WP_003413657.1.66466 WP_003413657.1.66487 WP_003413657.1.66504 WP_003413657.1.66580 WP_003413657.1.66582 WP_003413657.1.66612 WP_003413657.1.66615 WP_003413657.1.66617 WP_003413657.1.66656 WP_003413657.1.66663 WP_003413657.1.66675 WP_003413657.1.66715 WP_003413657.1.66718 WP_003413657.1.66762 WP_003413657.1.66776 WP_003413657.1.66817 WP_003413657.1.66826 WP_003413657.1.66830 WP_003413657.1.66868 WP_003413657.1.66878 WP_003413657.1.66880 WP_003413657.1.66893 WP_003413657.1.66961 WP_003413657.1.67005 WP_003413657.1.6704 WP_003413657.1.67044 WP_003413657.1.67061 WP_003413657.1.67089 WP_003413657.1.67098 WP_003413657.1.67146 WP_003413657.1.67170 WP_003413657.1.67197 WP_003413657.1.67198 WP_003413657.1.6720 WP_003413657.1.67207 WP_003413657.1.67220 WP_003413657.1.67225 WP_003413657.1.67231 WP_003413657.1.6724 WP_003413657.1.67257 WP_003413657.1.67298 WP_003413657.1.67307 WP_003413657.1.67324 WP_003413657.1.67332 WP_003413657.1.67346 WP_003413657.1.67354 WP_003413657.1.67360 WP_003413657.1.67381 WP_003413657.1.67396 WP_003413657.1.67417 WP_003413657.1.67422 WP_003413657.1.67453 WP_003413657.1.67459 WP_003413657.1.6746 WP_003413657.1.67473 WP_003413657.1.67481 WP_003413657.1.67482 WP_003413657.1.67496 WP_003413657.1.67499 WP_003413657.1.67516 WP_003413657.1.67523 WP_003413657.1.67536 WP_003413657.1.67575 WP_003413657.1.67598 WP_003413657.1.67600 WP_003413657.1.67602 WP_003413657.1.67692 WP_003413657.1.67744 WP_003413657.1.6775 WP_003413657.1.67750 WP_003413657.1.6777 WP_003413657.1.67809 WP_003413657.1.67816 WP_003413657.1.67844 WP_003413657.1.67848 WP_003413657.1.67870 WP_003413657.1.67888 WP_003413657.1.67915 WP_003413657.1.67945 WP_003413657.1.67949 WP_003413657.1.67980 WP_003413657.1.67982 WP_003413657.1.68029 WP_003413657.1.68037 WP_003413657.1.68045 WP_003413657.1.68057 WP_003413657.1.68083 WP_003413657.1.68088 WP_003413657.1.68106 WP_003413657.1.68164 WP_003413657.1.68193 WP_003413657.1.68212 WP_003413657.1.68227 WP_003413657.1.6825 WP_003413657.1.68297 WP_003413657.1.68325 WP_003413657.1.68329 WP_003413657.1.68340 WP_003413657.1.68384 WP_003413657.1.68388 WP_003413657.1.68429 WP_003413657.1.6843 WP_003413657.1.68433 WP_003413657.1.68444 WP_003413657.1.68465 WP_003413657.1.68484 WP_003413657.1.68518 WP_003413657.1.68569 WP_003413657.1.68576 WP_003413657.1.68580 WP_003413657.1.68623 WP_003413657.1.68624 WP_003413657.1.68637 WP_003413657.1.68646 WP_003413657.1.68667 WP_003413657.1.68669 WP_003413657.1.68672 WP_003413657.1.68684 WP_003413657.1.68704 WP_003413657.1.68708 WP_003413657.1.68730 WP_003413657.1.68734 WP_003413657.1.68748 WP_003413657.1.68754 WP_003413657.1.6876 WP_003413657.1.68761 WP_003413657.1.68763 WP_003413657.1.68766 WP_003413657.1.68774 WP_003413657.1.68796 WP_003413657.1.68832 WP_003413657.1.68833 WP_003413657.1.68841 WP_003413657.1.68859 WP_003413657.1.68876 WP_003413657.1.68906 WP_003413657.1.68916 WP_003413657.1.68923 WP_003413657.1.68945 WP_003413657.1.6896 WP_003413657.1.68981 WP_003413657.1.68984 WP_003413657.1.68997 WP_003413657.1.69008 WP_003413657.1.69076 WP_003413657.1.69079 WP_003413657.1.69082 WP_003413657.1.69178 WP_003413657.1.69181 WP_003413657.1.69231 WP_003413657.1.69256 WP_003413657.1.69311 WP_003413657.1.69315 WP_003413657.1.69322 WP_003413657.1.69342 WP_003413657.1.6935 WP_003413657.1.6936 WP_003413657.1.69374 WP_003413657.1.69398 WP_003413657.1.69401 WP_003413657.1.69426 WP_003413657.1.69427 WP_003413657.1.69429 WP_003413657.1.6951 WP_003413657.1.69511 WP_003413657.1.69526 WP_003413657.1.69528 WP_003413657.1.69547 WP_003413657.1.69573 WP_003413657.1.69581 WP_003413657.1.6960 WP_003413657.1.69617 WP_003413657.1.69634 WP_003413657.1.69647 WP_003413657.1.69659 WP_003413657.1.69673 WP_003413657.1.69684 WP_003413657.1.69686 WP_003413657.1.69707 WP_003413657.1.69709 WP_003413657.1.69723 WP_003413657.1.69736 WP_003413657.1.69778 WP_003413657.1.69800 WP_003413657.1.69802 WP_003413657.1.69845 WP_003413657.1.69870 WP_003413657.1.69873 WP_003413657.1.69898 WP_003413657.1.69913 WP_003413657.1.69925 WP_003413657.1.69931 WP_003413657.1.69938 WP_003413657.1.69955 WP_003413657.1.69957 WP_003413657.1.69981 WP_003413657.1.69990 WP_003413657.1.70 WP_003413657.1.70017 WP_003413657.1.70032 WP_003413657.1.70055 WP_003413657.1.70062 WP_003413657.1.70072 WP_003413657.1.70131 WP_003413657.1.70132 WP_003413657.1.7022 WP_003413657.1.70227 WP_003413657.1.70255 WP_003413657.1.70271 WP_003413657.1.70274 WP_003413657.1.7029 WP_003413657.1.70325 WP_003413657.1.70328 WP_003413657.1.70356 WP_003413657.1.70364 WP_003413657.1.70369 WP_003413657.1.70418 WP_003413657.1.70422 WP_003413657.1.70435 WP_003413657.1.70444 WP_003413657.1.70463 WP_003413657.1.70471 WP_003413657.1.70480 WP_003413657.1.70494 WP_003413657.1.70498 WP_003413657.1.70505 WP_003413657.1.70525 WP_003413657.1.70573 WP_003413657.1.70577 WP_003413657.1.70610 WP_003413657.1.70615 WP_003413657.1.70618 WP_003413657.1.70622 WP_003413657.1.70626 WP_003413657.1.70699 WP_003413657.1.70704 WP_003413657.1.70729 WP_003413657.1.70757 WP_003413657.1.70782 WP_003413657.1.70796 WP_003413657.1.70830 WP_003413657.1.70834 WP_003413657.1.7084 WP_003413657.1.70840 WP_003413657.1.70871 WP_003413657.1.70915 WP_003413657.1.70955 WP_003413657.1.70958 WP_003413657.1.70964 WP_003413657.1.70976 WP_003413657.1.71015 WP_003413657.1.71026 WP_003413657.1.71063 WP_003413657.1.71076 WP_003413657.1.71083 WP_003413657.1.7111 WP_003413657.1.71118 WP_003413657.1.71128 WP_003413657.1.7113 WP_003413657.1.71187 WP_003413657.1.71191 WP_003413657.1.71255 WP_003413657.1.71258 WP_003413657.1.71259 WP_003413657.1.71289 WP_003413657.1.71326 WP_003413657.1.71329 WP_003413657.1.71331 WP_003413657.1.71344 WP_003413657.1.71390 WP_003413657.1.71399 WP_003413657.1.71440 WP_003413657.1.71457 WP_003413657.1.7146 WP_003413657.1.71464 WP_003413657.1.71490 WP_003413657.1.71492 WP_003413657.1.71509 WP_003413657.1.71516 WP_003413657.1.71517 WP_003413657.1.71527 WP_003413657.1.71532 WP_003413657.1.71545 WP_003413657.1.71546 WP_003413657.1.71569 WP_003413657.1.71604 WP_003413657.1.71621 WP_003413657.1.71630 WP_003413657.1.71638 WP_003413657.1.71654 WP_003413657.1.71664 WP_003413657.1.71665 WP_003413657.1.71683 WP_003413657.1.71701 WP_003413657.1.71718 WP_003413657.1.71731 WP_003413657.1.71778 WP_003413657.1.71781 WP_003413657.1.71803 WP_003413657.1.71820 WP_003413657.1.71847 WP_003413657.1.7185 WP_003413657.1.71851 WP_003413657.1.71871 WP_003413657.1.71909 WP_003413657.1.71957 WP_003413657.1.71970 WP_003413657.1.72061 WP_003413657.1.72111 WP_003413657.1.72122 WP_003413657.1.72128 WP_003413657.1.72143 WP_003413657.1.7216 WP_003413657.1.72168 WP_003413657.1.72179 WP_003413657.1.72209 WP_003413657.1.72218 WP_003413657.1.72219 WP_003413657.1.72227 WP_003413657.1.7224 WP_003413657.1.72268 WP_003413657.1.72332 WP_003413657.1.72380 WP_003413657.1.72401 WP_003413657.1.72405 WP_003413657.1.72420 WP_003413657.1.72441 WP_003413657.1.72451 WP_003413657.1.72457 WP_003413657.1.72459 WP_003413657.1.72460 WP_003413657.1.72466 WP_003413657.1.72487 WP_003413657.1.72488 WP_003413657.1.72492 WP_003413657.1.72506 WP_003413657.1.72543 WP_003413657.1.7256 WP_003413657.1.72576 WP_003413657.1.72585 WP_003413657.1.72591 WP_003413657.1.72592 WP_003413657.1.72640 WP_003413657.1.7266 WP_003413657.1.72684 WP_003413657.1.72739 WP_003413657.1.72744 WP_003413657.1.72755 WP_003413657.1.72759 WP_003413657.1.72784 WP_003413657.1.72792 WP_003413657.1.72831 WP_003413657.1.72852 WP_003413657.1.72853 WP_003413657.1.72879 WP_003413657.1.72880 WP_003413657.1.72954 WP_003413657.1.72957 WP_003413657.1.72959 WP_003413657.1.72973 WP_003413657.1.7298 WP_003413657.1.72982 WP_003413657.1.72988 WP_003413657.1.72993 WP_003413657.1.73006 WP_003413657.1.73013 WP_003413657.1.73025 WP_003413657.1.73028 WP_003413657.1.73042 WP_003413657.1.73092 WP_003413657.1.73118 WP_003413657.1.7312 WP_003413657.1.73127 WP_003413657.1.73134 WP_003413657.1.73150 WP_003413657.1.73154 WP_003413657.1.73163 WP_003413657.1.73182 WP_003413657.1.73205 WP_003413657.1.7321 WP_003413657.1.73310 WP_003413657.1.73315 WP_003413657.1.73365 WP_003413657.1.73391 WP_003413657.1.73404 WP_003413657.1.73424 WP_003413657.1.73436 WP_003413657.1.73445 WP_003413657.1.73453 WP_003413657.1.73465 WP_003413657.1.73466 WP_003413657.1.73470 WP_003413657.1.73471 WP_003413657.1.73478 WP_003413657.1.73482 WP_003413657.1.73507 WP_003413657.1.73532 WP_003413657.1.73550 WP_003413657.1.73564 WP_003413657.1.73623 WP_003413657.1.73629 WP_003413657.1.73644 WP_003413657.1.73661 WP_003413657.1.7368 WP_003413657.1.73688 WP_003413657.1.73744 WP_003413657.1.73750 WP_003413657.1.73760 WP_003413657.1.73774 WP_003413657.1.7379 WP_003413657.1.73813 WP_003413657.1.73840 WP_003413657.1.73876 WP_003413657.1.7389 WP_003413657.1.73986 WP_003413657.1.74016 WP_003413657.1.74039 WP_003413657.1.74083 WP_003413657.1.74101 WP_003413657.1.74107 WP_003413657.1.74120 WP_003413657.1.74129 WP_003413657.1.74144 WP_003413657.1.7417 WP_003413657.1.74190 WP_003413657.1.74210 WP_003413657.1.7423 WP_003413657.1.74259 WP_003413657.1.74262 WP_003413657.1.74269 WP_003413657.1.74291 WP_003413657.1.74296 WP_003413657.1.74304 WP_003413657.1.7432 WP_003413657.1.74347 WP_003413657.1.7436 WP_003413657.1.74378 WP_003413657.1.74395 WP_003413657.1.74400 WP_003413657.1.74401 WP_003413657.1.74432 WP_003413657.1.74442 WP_003413657.1.74477 WP_003413657.1.74487 WP_003413657.1.74499 WP_003413657.1.74504 WP_003413657.1.74511 WP_003413657.1.74523 WP_003413657.1.74525 WP_003413657.1.74551 WP_003413657.1.74555 WP_003413657.1.74628 WP_003413657.1.74641 WP_003413657.1.74653 WP_003413657.1.74660 WP_003413657.1.74683 WP_003413657.1.7469 WP_003413657.1.74725 WP_003413657.1.74760 WP_003413657.1.74786 WP_003413657.1.74809 WP_003413657.1.74820 WP_003413657.1.74870 WP_003413657.1.74881 WP_003413657.1.74888 WP_003413657.1.7496 WP_003413657.1.75043 WP_003413657.1.75045 WP_003413657.1.75055 WP_003413657.1.75078 WP_003413657.1.75081 WP_003413657.1.75120 WP_003413657.1.75163 WP_003413657.1.75188 WP_003413657.1.75200 WP_003413657.1.75202 WP_003413657.1.75239 WP_003413657.1.75250 WP_003413657.1.75263 WP_003413657.1.75281 WP_003413657.1.75342 WP_003413657.1.7535 WP_003413657.1.75376 WP_003413657.1.75391 WP_003413657.1.75441 WP_003413657.1.75510 WP_003413657.1.75581 WP_003413657.1.75598 WP_003413657.1.75635 WP_003413657.1.75645 WP_003413657.1.75665 WP_003413657.1.75671 WP_003413657.1.75741 WP_003413657.1.75749 WP_003413657.1.75772 WP_003413657.1.75774 WP_003413657.1.75811 WP_003413657.1.75833 WP_003413657.1.7585 WP_003413657.1.75868 WP_003413657.1.75878 WP_003413657.1.75927 WP_003413657.1.75946 WP_003413657.1.75968 WP_003413657.1.75974 WP_003413657.1.76007 WP_003413657.1.76016 WP_003413657.1.76032 WP_003413657.1.76037 WP_003413657.1.7604 WP_003413657.1.76052 WP_003413657.1.76058 WP_003413657.1.76064 WP_003413657.1.76110 WP_003413657.1.76138 WP_003413657.1.76172 WP_003413657.1.76177 WP_003413657.1.76183 WP_003413657.1.76239 WP_003413657.1.76272 WP_003413657.1.76277 WP_003413657.1.76280 WP_003413657.1.76281 WP_003413657.1.76291 WP_003413657.1.76297 WP_003413657.1.76360 WP_003413657.1.76379 WP_003413657.1.76403 WP_003413657.1.76414 WP_003413657.1.76427 WP_003413657.1.76436 WP_003413657.1.76442 WP_003413657.1.76443 WP_003413657.1.76456 WP_003413657.1.76521 WP_003413657.1.76533 WP_003413657.1.76616 WP_003413657.1.76625 WP_003413657.1.76629 WP_003413657.1.76635 WP_003413657.1.76638 WP_003413657.1.76639 WP_003413657.1.76640 WP_003413657.1.76644 WP_003413657.1.76677 WP_003413657.1.76678 WP_003413657.1.76679 WP_003413657.1.76734 WP_003413657.1.76744 WP_003413657.1.76750 WP_003413657.1.76754 WP_003413657.1.76757 WP_003413657.1.76781 WP_003413657.1.76818 WP_003413657.1.76824 WP_003413657.1.76835 WP_003413657.1.76873 WP_003413657.1.76881 WP_003413657.1.76900 WP_003413657.1.7691 WP_003413657.1.76947 WP_003413657.1.76954 WP_003413657.1.76955 WP_003413657.1.76963 WP_003413657.1.76976 WP_003413657.1.77000 WP_003413657.1.77008 WP_003413657.1.77021 WP_003413657.1.77056 WP_003413657.1.77065 WP_003413657.1.77075 WP_003413657.1.77093 WP_003413657.1.77107 WP_003413657.1.77115 WP_003413657.1.77118 WP_003413657.1.77125 WP_003413657.1.77141 WP_003413657.1.77142 WP_003413657.1.77166 WP_003413657.1.77250 WP_003413657.1.77252 WP_003413657.1.77260 WP_003413657.1.77266 WP_003413657.1.77280 WP_003413657.1.77285 WP_003413657.1.77312 WP_003413657.1.77348 WP_003413657.1.77351 WP_003413657.1.77352 WP_003413657.1.77361 WP_003413657.1.774 WP_003413657.1.7740 WP_003413657.1.77404 WP_003413657.1.77425 WP_003413657.1.77463 WP_003413657.1.77474 WP_003413657.1.7748 WP_003413657.1.77484 WP_003413657.1.77491 WP_003413657.1.77510 WP_003413657.1.77530 WP_003413657.1.77599 WP_003413657.1.77605 WP_003413657.1.7762 WP_003413657.1.77627 WP_003413657.1.77649 WP_003413657.1.77654 WP_003413657.1.7766 WP_003413657.1.77667 WP_003413657.1.77704 WP_003413657.1.77706 WP_003413657.1.77726 WP_003413657.1.77774 WP_003413657.1.7778 WP_003413657.1.77790 WP_003413657.1.77809 WP_003413657.1.77820 WP_003413657.1.77843 WP_003413657.1.77865 WP_003413657.1.77868 WP_003413657.1.77879 WP_003413657.1.77909 WP_003413657.1.77911 WP_003413657.1.77931 WP_003413657.1.77984 WP_003413657.1.78020 WP_003413657.1.78024 WP_003413657.1.78075 WP_003413657.1.78084 WP_003413657.1.78086 WP_003413657.1.7809 WP_003413657.1.78098 WP_003413657.1.78105 WP_003413657.1.78113 WP_003413657.1.78136 WP_003413657.1.78162 WP_003413657.1.7817 WP_003413657.1.78200 WP_003413657.1.78216 WP_003413657.1.78236 WP_003413657.1.78238 WP_003413657.1.78322 WP_003413657.1.78338 WP_003413657.1.7836 WP_003413657.1.78360 WP_003413657.1.78429 WP_003413657.1.78435 WP_003413657.1.78459 WP_003413657.1.78488 WP_003413657.1.7849 WP_003413657.1.78499 WP_003413657.1.785 WP_003413657.1.78516 WP_003413657.1.78524 WP_003413657.1.78526 WP_003413657.1.78544 WP_003413657.1.78545 WP_003413657.1.78547 WP_003413657.1.78574 WP_003413657.1.78580 WP_003413657.1.7860 WP_003413657.1.78620 WP_003413657.1.78646 WP_003413657.1.78648 WP_003413657.1.78649 WP_003413657.1.78655 WP_003413657.1.78657 WP_003413657.1.78659 WP_003413657.1.7869 WP_003413657.1.78692 WP_003413657.1.78760 WP_003413657.1.78766 WP_003413657.1.78776 WP_003413657.1.78778 WP_003413657.1.78784 WP_003413657.1.78788 WP_003413657.1.78790 WP_003413657.1.78793 WP_003413657.1.78848 WP_003413657.1.78860 WP_003413657.1.7887 WP_003413657.1.78884 WP_003413657.1.78932 WP_003413657.1.78969 WP_003413657.1.78977 WP_003413657.1.78980 WP_003413657.1.79005 WP_003413657.1.79016 WP_003413657.1.79033 WP_003413657.1.79064 WP_003413657.1.79066 WP_003413657.1.79068 WP_003413657.1.79077 WP_003413657.1.79112 WP_003413657.1.79122 WP_003413657.1.79145 WP_003413657.1.79152 WP_003413657.1.79163 WP_003413657.1.79182 WP_003413657.1.79198 WP_003413657.1.79213 WP_003413657.1.79218 WP_003413657.1.79268 WP_003413657.1.79273 WP_003413657.1.79290 WP_003413657.1.79319 WP_003413657.1.79325 WP_003413657.1.79326 WP_003413657.1.79330 WP_003413657.1.79339 WP_003413657.1.79394 WP_003413657.1.79399 WP_003413657.1.79413 WP_003413657.1.79422 WP_003413657.1.79445 WP_003413657.1.79447 WP_003413657.1.79455 WP_003413657.1.79471 WP_003413657.1.79480 WP_003413657.1.79482 WP_003413657.1.79488 WP_003413657.1.79500 WP_003413657.1.79502 WP_003413657.1.79508 WP_003413657.1.79514 WP_003413657.1.79561 WP_003413657.1.79565 WP_003413657.1.79578 WP_003413657.1.79588 WP_003413657.1.79598 WP_003413657.1.79615 WP_003413657.1.79684 WP_003413657.1.79698 WP_003413657.1.797 WP_003413657.1.79744 WP_003413657.1.79784 WP_003413657.1.79802 WP_003413657.1.79806 WP_003413657.1.79819 WP_003413657.1.79828 WP_003413657.1.79851 WP_003413657.1.79853 WP_003413657.1.79863 WP_003413657.1.79881 WP_003413657.1.79885 WP_003413657.1.7990 WP_003413657.1.79900 WP_003413657.1.79913 WP_003413657.1.79918 WP_003413657.1.79947 WP_003413657.1.79948 WP_003413657.1.7995 WP_003413657.1.7997 WP_003413657.1.80004 WP_003413657.1.80015 WP_003413657.1.80022 WP_003413657.1.80030 WP_003413657.1.80054 WP_003413657.1.80084 WP_003413657.1.80129 WP_003413657.1.80177 WP_003413657.1.80234 WP_003413657.1.8026 WP_003413657.1.80275 WP_003413657.1.8029 WP_003413657.1.80299 WP_003413657.1.80300 WP_003413657.1.80304 WP_003413657.1.80326 WP_003413657.1.80351 WP_003413657.1.8037 WP_003413657.1.80370 WP_003413657.1.80387 WP_003413657.1.80399 WP_003413657.1.80451 WP_003413657.1.80458 WP_003413657.1.80461 WP_003413657.1.80490 WP_003413657.1.80503 WP_003413657.1.80507 WP_003413657.1.80552 WP_003413657.1.80576 WP_003413657.1.80588 WP_003413657.1.80599 WP_003413657.1.8060 WP_003413657.1.80624 WP_003413657.1.80636 WP_003413657.1.80669 WP_003413657.1.80673 WP_003413657.1.80711 WP_003413657.1.80714 WP_003413657.1.80743 WP_003413657.1.80815 WP_003413657.1.80853 WP_003413657.1.80918 WP_003413657.1.8093 WP_003413657.1.80967 WP_003413657.1.8097 WP_003413657.1.80988 WP_003413657.1.81013 WP_003413657.1.8105 WP_003413657.1.81059 WP_003413657.1.81063 WP_003413657.1.81066 WP_003413657.1.81075 WP_003413657.1.81091 WP_003413657.1.81119 WP_003413657.1.81125 WP_003413657.1.81136 WP_003413657.1.8114 WP_003413657.1.81189 WP_003413657.1.81192 WP_003413657.1.81230 WP_003413657.1.81249 WP_003413657.1.81250 WP_003413657.1.8128 WP_003413657.1.81287 WP_003413657.1.81297 WP_003413657.1.8138 WP_003413657.1.81407 WP_003413657.1.8143 WP_003413657.1.81439 WP_003413657.1.81465 WP_003413657.1.81505 WP_003413657.1.81529 WP_003413657.1.81538 WP_003413657.1.81541 WP_003413657.1.81560 WP_003413657.1.81561 WP_003413657.1.81567 WP_003413657.1.81583 WP_003413657.1.81686 WP_003413657.1.81712 WP_003413657.1.81720 WP_003413657.1.81731 WP_003413657.1.81774 WP_003413657.1.81788 WP_003413657.1.81809 WP_003413657.1.81820 WP_003413657.1.81850 WP_003413657.1.81883 WP_003413657.1.81891 WP_003413657.1.81911 WP_003413657.1.81918 WP_003413657.1.82011 WP_003413657.1.82048 WP_003413657.1.82069 WP_003413657.1.82071 WP_003413657.1.82108 WP_003413657.1.82136 WP_003413657.1.82142 WP_003413657.1.8215 WP_003413657.1.82158 WP_003413657.1.8217 WP_003413657.1.82209 WP_003413657.1.82210 WP_003413657.1.82228 WP_003413657.1.82236 WP_003413657.1.82251 WP_003413657.1.82271 WP_003413657.1.82307 WP_003413657.1.82309 WP_003413657.1.82317 WP_003413657.1.82346 WP_003413657.1.82374 WP_003413657.1.82385 WP_003413657.1.82429 WP_003413657.1.82460 WP_003413657.1.82462 WP_003413657.1.82483 WP_003413657.1.82494 WP_003413657.1.82531 WP_003413657.1.82546 WP_003413657.1.82547 WP_003413657.1.82549 WP_003413657.1.82577 WP_003413657.1.82592 WP_003413657.1.82598 WP_003413657.1.82625 WP_003413657.1.82642 WP_003413657.1.82651 WP_003413657.1.82681 WP_003413657.1.82685 WP_003413657.1.8271 WP_003413657.1.82712 WP_003413657.1.8273 WP_003413657.1.82743 WP_003413657.1.82757 WP_003413657.1.82774 WP_003413657.1.82803 WP_003413657.1.82836 WP_003413657.1.82860 WP_003413657.1.82892 WP_003413657.1.82935 WP_003413657.1.82957 WP_003413657.1.82973 WP_003413657.1.82981 WP_003413657.1.82983 WP_003413657.1.83004 WP_003413657.1.83009 WP_003413657.1.83065 WP_003413657.1.83074 WP_003413657.1.83110 WP_003413657.1.83146 WP_003413657.1.83149 WP_003413657.1.83159 WP_003413657.1.8317 WP_003413657.1.83173 WP_003413657.1.83181 WP_003413657.1.83191 WP_003413657.1.83197 WP_003413657.1.83212 WP_003413657.1.83262 WP_003413657.1.83268 WP_003413657.1.83273 WP_003413657.1.83309 WP_003413657.1.83332 WP_003413657.1.83334 WP_003413657.1.83341 WP_003413657.1.83349 WP_003413657.1.8335 WP_003413657.1.83367 WP_003413657.1.83380 WP_003413657.1.83389 WP_003413657.1.83408 WP_003413657.1.83409 WP_003413657.1.83435 WP_003413657.1.83470 WP_003413657.1.83524 WP_003413657.1.83526 WP_003413657.1.8358 WP_003413657.1.83589 WP_003413657.1.83601 WP_003413657.1.83638 WP_003413657.1.83648 WP_003413657.1.83656 WP_003413657.1.83667 WP_003413657.1.83692 WP_003413657.1.83704 WP_003413657.1.83705 WP_003413657.1.83766 WP_003413657.1.83793 WP_003413657.1.83794 WP_003413657.1.83802 WP_003413657.1.83805 WP_003413657.1.83839 WP_003413657.1.83842 WP_003413657.1.83850 WP_003413657.1.83861 WP_003413657.1.83884 WP_003413657.1.83920 WP_003413657.1.83929 WP_003413657.1.83930 WP_003413657.1.83975 WP_003413657.1.83991 WP_003413657.1.8400 WP_003413657.1.84027 WP_003413657.1.8404 WP_003413657.1.84057 WP_003413657.1.84070 WP_003413657.1.8409 WP_003413657.1.84112 WP_003413657.1.84146 WP_003413657.1.8415 WP_003413657.1.84176 WP_003413657.1.84186 WP_003413657.1.84192 WP_003413657.1.8424 WP_003413657.1.84244 WP_003413657.1.84259 WP_003413657.1.8426 WP_003413657.1.84277 WP_003413657.1.84287 WP_003413657.1.8434 WP_003413657.1.84388 WP_003413657.1.84408 WP_003413657.1.84409 WP_003413657.1.84438 WP_003413657.1.84460 WP_003413657.1.84488 WP_003413657.1.84620 WP_003413657.1.84641 WP_003413657.1.84655 WP_003413657.1.84666 WP_003413657.1.84670 WP_003413657.1.84739 WP_003413657.1.84748 WP_003413657.1.84766 WP_003413657.1.84772 WP_003413657.1.84774 WP_003413657.1.848 WP_003413657.1.84812 WP_003413657.1.84839 WP_003413657.1.84846 WP_003413657.1.84873 WP_003413657.1.84911 WP_003413657.1.84938 WP_003413657.1.84968 WP_003413657.1.84973 WP_003413657.1.8503 WP_003413657.1.85038 WP_003413657.1.85041 WP_003413657.1.85043 WP_003413657.1.8505 WP_003413657.1.85074 WP_003413657.1.8509 WP_003413657.1.8512 WP_003413657.1.85148 WP_003413657.1.8518 WP_003413657.1.8522 WP_003413657.1.85242 WP_003413657.1.85276 WP_003413657.1.85281 WP_003413657.1.85284 WP_003413657.1.85314 WP_003413657.1.85330 WP_003413657.1.85341 WP_003413657.1.85346 WP_003413657.1.8535 WP_003413657.1.85363 WP_003413657.1.85371 WP_003413657.1.85377 WP_003413657.1.85387 WP_003413657.1.85399 WP_003413657.1.85458 WP_003413657.1.8546 WP_003413657.1.85464 WP_003413657.1.85478 WP_003413657.1.85480 WP_003413657.1.85488 WP_003413657.1.85495 WP_003413657.1.85551 WP_003413657.1.85557 WP_003413657.1.85577 WP_003413657.1.85597 WP_003413657.1.85599 WP_003413657.1.85610 WP_003413657.1.8563 WP_003413657.1.85648 WP_003413657.1.85679 WP_003413657.1.85704 WP_003413657.1.85727 WP_003413657.1.85737 WP_003413657.1.85808 WP_003413657.1.85819 WP_003413657.1.85820 WP_003413657.1.85823 WP_003413657.1.8586 WP_003413657.1.85872 WP_003413657.1.85894 WP_003413657.1.85913 WP_003413657.1.85953 WP_003413657.1.85986 WP_003413657.1.86032 WP_003413657.1.86048 WP_003413657.1.86052 WP_003413657.1.86067 WP_003413657.1.86103 WP_003413657.1.86122 WP_003413657.1.86124 WP_003413657.1.86160 WP_003413657.1.86164 WP_003413657.1.86168 WP_003413657.1.86190 WP_003413657.1.86204 WP_003413657.1.86208 WP_003413657.1.86235 WP_003413657.1.86249 WP_003413657.1.86260 WP_003413657.1.86290 WP_003413657.1.863 WP_003413657.1.86327 WP_003413657.1.86334 WP_003413657.1.86337 WP_003413657.1.86368 WP_003413657.1.86377 WP_003413657.1.86425 WP_003413657.1.86459 WP_003413657.1.8649 WP_003413657.1.86499 WP_003413657.1.86520 WP_003413657.1.86561 WP_003413657.1.86568 WP_003413657.1.86575 WP_003413657.1.86584 WP_003413657.1.86605 WP_003413657.1.86626 WP_003413657.1.86648 WP_003413657.1.8666 WP_003413657.1.86684 WP_003413657.1.86696 WP_003413657.1.86705 WP_003413657.1.86725 WP_003413657.1.86766 WP_003413657.1.86801 WP_003413657.1.86814 WP_003413657.1.86820 WP_003413657.1.86825 WP_003413657.1.86834 WP_003413657.1.8685 WP_003413657.1.86851 WP_003413657.1.86867 WP_003413657.1.86877 WP_003413657.1.86883 WP_003413657.1.8689 WP_003413657.1.86892 WP_003413657.1.86933 WP_003413657.1.86941 WP_003413657.1.86950 WP_003413657.1.86962 WP_003413657.1.86963 WP_003413657.1.86979 WP_003413657.1.8700 WP_003413657.1.87001 WP_003413657.1.87031 WP_003413657.1.87116 WP_003413657.1.87117 WP_003413657.1.8714 WP_003413657.1.87162 WP_003413657.1.87178 WP_003413657.1.87191 WP_003413657.1.87201 WP_003413657.1.87209 WP_003413657.1.87240 WP_003413657.1.87266 WP_003413657.1.87273 WP_003413657.1.87275 WP_003413657.1.8733 WP_003413657.1.87345 WP_003413657.1.87369 WP_003413657.1.8737 WP_003413657.1.87401 WP_003413657.1.87404 WP_003413657.1.87406 WP_003413657.1.87409 WP_003413657.1.87444 WP_003413657.1.87446 WP_003413657.1.87472 WP_003413657.1.87489 WP_003413657.1.87494 WP_003413657.1.87496 WP_003413657.1.87582 WP_003413657.1.87588 WP_003413657.1.87619 WP_003413657.1.87620 WP_003413657.1.87634 WP_003413657.1.87643 WP_003413657.1.8765 WP_003413657.1.87650 WP_003413657.1.87654 WP_003413657.1.87658 WP_003413657.1.87665 WP_003413657.1.87676 WP_003413657.1.87677 WP_003413657.1.87684 WP_003413657.1.87692 WP_003413657.1.87707 WP_003413657.1.87732 WP_003413657.1.87784 WP_003413657.1.87796 WP_003413657.1.87809 WP_003413657.1.87817 WP_003413657.1.87827 WP_003413657.1.87831 WP_003413657.1.87835 WP_003413657.1.87837 WP_003413657.1.8789 WP_003413657.1.87911 WP_003413657.1.87924 WP_003413657.1.87951 WP_003413657.1.87955 WP_003413657.1.87956 WP_003413657.1.87991 WP_003413657.1.88 WP_003413657.1.88002 WP_003413657.1.88037 WP_003413657.1.88039 WP_003413657.1.88072 WP_003413657.1.88077 WP_003413657.1.88121 WP_003413657.1.88180 WP_003413657.1.88205 WP_003413657.1.88217 WP_003413657.1.88219 WP_003413657.1.88245 WP_003413657.1.88253 WP_003413657.1.88294 WP_003413657.1.88315 WP_003413657.1.88320 WP_003413657.1.88338 WP_003413657.1.8840 WP_003413657.1.88437 WP_003413657.1.88453 WP_003413657.1.88469 WP_003413657.1.88507 WP_003413657.1.88521 WP_003413657.1.88530 WP_003413657.1.88537 WP_003413657.1.88541 WP_003413657.1.88616 WP_003413657.1.88618 WP_003413657.1.8862 WP_003413657.1.88625 WP_003413657.1.88632 WP_003413657.1.88634 WP_003413657.1.88649 WP_003413657.1.8870 WP_003413657.1.888 WP_003413657.1.88824 WP_003413657.1.88886 WP_003413657.1.88965 WP_003413657.1.88985 WP_003413657.1.8902 WP_003413657.1.89025 WP_003413657.1.89041 WP_003413657.1.89046 WP_003413657.1.89082 WP_003413657.1.89162 WP_003413657.1.89168 WP_003413657.1.8917 WP_003413657.1.89193 WP_003413657.1.89205 WP_003413657.1.89207 WP_003413657.1.89225 WP_003413657.1.89277 WP_003413657.1.89286 WP_003413657.1.89293 WP_003413657.1.89320 WP_003413657.1.89371 WP_003413657.1.89378 WP_003413657.1.89392 WP_003413657.1.89406 WP_003413657.1.8943 WP_003413657.1.89451 WP_003413657.1.89453 WP_003413657.1.89473 WP_003413657.1.89475 WP_003413657.1.89483 WP_003413657.1.895 WP_003413657.1.89513 WP_003413657.1.89517 WP_003413657.1.89522 WP_003413657.1.8954 WP_003413657.1.89543 WP_003413657.1.89567 WP_003413657.1.8957 WP_003413657.1.89572 WP_003413657.1.89589 WP_003413657.1.89607 WP_003413657.1.89613 WP_003413657.1.89625 WP_003413657.1.89648 WP_003413657.1.8967 WP_003413657.1.89670 WP_003413657.1.89676 WP_003413657.1.89729 WP_003413657.1.89739 WP_003413657.1.89762 WP_003413657.1.8977 WP_003413657.1.89802 WP_003413657.1.89808 WP_003413657.1.8982 WP_003413657.1.89829 WP_003413657.1.89831 WP_003413657.1.89844 WP_003413657.1.89849 WP_003413657.1.8989 WP_003413657.1.89901 WP_003413657.1.89903 WP_003413657.1.89909 WP_003413657.1.89922 WP_003413657.1.89926 WP_003413657.1.89963 WP_003413657.1.89971 WP_003413657.1.8998 WP_003413657.1.89987 WP_003413657.1.900 WP_003413657.1.90048 WP_003413657.1.9007 WP_003413657.1.90080 WP_003413657.1.90134 WP_003413657.1.90137 WP_003413657.1.90157 WP_003413657.1.90184 WP_003413657.1.90199 WP_003413657.1.90231 WP_003413657.1.90245 WP_003413657.1.90308 WP_003413657.1.90322 WP_003413657.1.90328 WP_003413657.1.90372 WP_003413657.1.90439 WP_003413657.1.90481 WP_003413657.1.90499 WP_003413657.1.9050 WP_003413657.1.90527 WP_003413657.1.90550 WP_003413657.1.90560 WP_003413657.1.90612 WP_003413657.1.90640 WP_003413657.1.90672 WP_003413657.1.90691 WP_003413657.1.90711 WP_003413657.1.90722 WP_003413657.1.90744 WP_003413657.1.9075 WP_003413657.1.90756 WP_003413657.1.90767 WP_003413657.1.90771 WP_003413657.1.90785 WP_003413657.1.90788 WP_003413657.1.90800 WP_003413657.1.90810 WP_003413657.1.90816 WP_003413657.1.90819 WP_003413657.1.9082 WP_003413657.1.90884 WP_003413657.1.90906 WP_003413657.1.90958 WP_003413657.1.90976 WP_003413657.1.90977 WP_003413657.1.90987 WP_003413657.1.9102 WP_003413657.1.91026 WP_003413657.1.91043 WP_003413657.1.91053 WP_003413657.1.91082 WP_003413657.1.91106 WP_003413657.1.91112 WP_003413657.1.91144 WP_003413657.1.91157 WP_003413657.1.91167 WP_003413657.1.91169 WP_003413657.1.91192 WP_003413657.1.91201 WP_003413657.1.91207 WP_003413657.1.91208 WP_003413657.1.91211 WP_003413657.1.91214 WP_003413657.1.91230 WP_003413657.1.91244 WP_003413657.1.91251 WP_003413657.1.91260 WP_003413657.1.91265 WP_003413657.1.9128 WP_003413657.1.91284 WP_003413657.1.91294 WP_003413657.1.91303 WP_003413657.1.91352 WP_003413657.1.91386 WP_003413657.1.9139 WP_003413657.1.91398 WP_003413657.1.91411 WP_003413657.1.91430 WP_003413657.1.91436 WP_003413657.1.91483 WP_003413657.1.91496 WP_003413657.1.91508 WP_003413657.1.91576 WP_003413657.1.91589 WP_003413657.1.91695 WP_003413657.1.91713 WP_003413657.1.91716 WP_003413657.1.91717 WP_003413657.1.91728 WP_003413657.1.91759 WP_003413657.1.91786 WP_003413657.1.91802 WP_003413657.1.91822 WP_003413657.1.91828 WP_003413657.1.9189 WP_003413657.1.91896 WP_003413657.1.9190 WP_003413657.1.91915 WP_003413657.1.91937 WP_003413657.1.91944 WP_003413657.1.91953 WP_003413657.1.91957 WP_003413657.1.91978 WP_003413657.1.92021 WP_003413657.1.92083 WP_003413657.1.92127 WP_003413657.1.92144 WP_003413657.1.92150 WP_003413657.1.92153 WP_003413657.1.92190 WP_003413657.1.92192 WP_003413657.1.92200 WP_003413657.1.92222 WP_003413657.1.92273 WP_003413657.1.92289 WP_003413657.1.9229 WP_003413657.1.92294 WP_003413657.1.92300 WP_003413657.1.92317 WP_003413657.1.92334 WP_003413657.1.92338 WP_003413657.1.92345 WP_003413657.1.92364 WP_003413657.1.92380 WP_003413657.1.92416 WP_003413657.1.92428 WP_003413657.1.92471 WP_003413657.1.92490 WP_003413657.1.92508 WP_003413657.1.9251 WP_003413657.1.92511 WP_003413657.1.92523 WP_003413657.1.92536 WP_003413657.1.92592 WP_003413657.1.92597 WP_003413657.1.92603 WP_003413657.1.92606 WP_003413657.1.92610 WP_003413657.1.92613 WP_003413657.1.9263 WP_003413657.1.9265 WP_003413657.1.92650 WP_003413657.1.92660 WP_003413657.1.92677 WP_003413657.1.92685 WP_003413657.1.92690 WP_003413657.1.92706 WP_003413657.1.92714 WP_003413657.1.92736 WP_003413657.1.9274 WP_003413657.1.92752 WP_003413657.1.92760 WP_003413657.1.92777 WP_003413657.1.92803 WP_003413657.1.92833 WP_003413657.1.92856 WP_003413657.1.92881 WP_003413657.1.92892 WP_003413657.1.92907 WP_003413657.1.92908 WP_003413657.1.9291 WP_003413657.1.92917 WP_003413657.1.92996 WP_003413657.1.93006 WP_003413657.1.93008 WP_003413657.1.93009 WP_003413657.1.93015 WP_003413657.1.93043 WP_003413657.1.9307 WP_003413657.1.93083 WP_003413657.1.93097 WP_003413657.1.93137 WP_003413657.1.93192 WP_003413657.1.93199 WP_003413657.1.93203 WP_003413657.1.93212 WP_003413657.1.93234 WP_003413657.1.93245 WP_003413657.1.93257 WP_003413657.1.93265 WP_003413657.1.93297 WP_003413657.1.93320 WP_003413657.1.93328 WP_003413657.1.93337 WP_003413657.1.93349 WP_003413657.1.93363 WP_003413657.1.93377 WP_003413657.1.9338 WP_003413657.1.93407 WP_003413657.1.93417 WP_003413657.1.93419 WP_003413657.1.93426 WP_003413657.1.9344 WP_003413657.1.93443 WP_003413657.1.93447 WP_003413657.1.93470 WP_003413657.1.93483 WP_003413657.1.93487 WP_003413657.1.93495 WP_003413657.1.93499 WP_003413657.1.93516 WP_003413657.1.93536 WP_003413657.1.93555 WP_003413657.1.93560 WP_003413657.1.93564 WP_003413657.1.9357 WP_003413657.1.93573 WP_003413657.1.93576 WP_003413657.1.93588 WP_003413657.1.9363 WP_003413657.1.93645 WP_003413657.1.93649 WP_003413657.1.93659 WP_003413657.1.93677 WP_003413657.1.9368 WP_003413657.1.93693 WP_003413657.1.93698 WP_003413657.1.93706 WP_003413657.1.9371 WP_003413657.1.93792 WP_003413657.1.93823 WP_003413657.1.93871 WP_003413657.1.9388 WP_003413657.1.93903 WP_003413657.1.93907 WP_003413657.1.93913 WP_003413657.1.93946 WP_003413657.1.93950 WP_003413657.1.93953 WP_003413657.1.93954 WP_003413657.1.93988 WP_003413657.1.9407 WP_003413657.1.94143 WP_003413657.1.94154 WP_003413657.1.94184 WP_003413657.1.94204 WP_003413657.1.94205 WP_003413657.1.94226 WP_003413657.1.94256 WP_003413657.1.94261 WP_003413657.1.94281 WP_003413657.1.94292 WP_003413657.1.94297 WP_003413657.1.9431 WP_003413657.1.94326 WP_003413657.1.94339 WP_003413657.1.94392 WP_003413657.1.94416 WP_003413657.1.94456 WP_003413657.1.94470 WP_003413657.1.94480 WP_003413657.1.94495 WP_003413657.1.94511 WP_003413657.1.94512 WP_003413657.1.94525 WP_003413657.1.94528 WP_003413657.1.94564 WP_003413657.1.94602 WP_003413657.1.94623 WP_003413657.1.94673 WP_003413657.1.94714 WP_003413657.1.94730 WP_003413657.1.94776 WP_003413657.1.9478 WP_003413657.1.94834 WP_003413657.1.94872 WP_003413657.1.9488 WP_003413657.1.94902 WP_003413657.1.94916 WP_003413657.1.94979 WP_003413657.1.94994 WP_003413657.1.94996 WP_003413657.1.94998 WP_003413657.1.95007 WP_003413657.1.95015 WP_003413657.1.95034 WP_003413657.1.95068 WP_003413657.1.95081 WP_003413657.1.95082 WP_003413657.1.95096 WP_003413657.1.95112 WP_003413657.1.95138 WP_003413657.1.9514 WP_003413657.1.95179 WP_003413657.1.95188 WP_003413657.1.95234 WP_003413657.1.95241 WP_003413657.1.95245 WP_003413657.1.95257 WP_003413657.1.95279 WP_003413657.1.9531 WP_003413657.1.9535 WP_003413657.1.95370 WP_003413657.1.95392 WP_003413657.1.95416 WP_003413657.1.95417 WP_003413657.1.95454 WP_003413657.1.95455 WP_003413657.1.95491 WP_003413657.1.95508 WP_003413657.1.95509 WP_003413657.1.95529 WP_003413657.1.95556 WP_003413657.1.95557 WP_003413657.1.95565 WP_003413657.1.95578 WP_003413657.1.95580 WP_003413657.1.95585 WP_003413657.1.95679 WP_003413657.1.95685 WP_003413657.1.957 WP_003413657.1.95724 WP_003413657.1.95727 WP_003413657.1.95730 WP_003413657.1.95735 WP_003413657.1.95758 WP_003413657.1.95772 WP_003413657.1.95797 WP_003413657.1.95839 WP_003413657.1.9585 WP_003413657.1.9590 WP_003413657.1.95902 WP_003413657.1.95908 WP_003413657.1.95924 WP_003413657.1.95926 WP_003413657.1.95953 WP_003413657.1.95958 WP_003413657.1.95964 WP_003413657.1.95973 WP_003413657.1.96006 WP_003413657.1.9602 WP_003413657.1.96036 WP_003413657.1.96062 WP_003413657.1.96065 WP_003413657.1.96098 WP_003413657.1.96146 WP_003413657.1.96166 WP_003413657.1.96171 WP_003413657.1.96230 WP_003413657.1.96235 WP_003413657.1.96242 WP_003413657.1.96245 WP_003413657.1.96254 WP_003413657.1.96259 WP_003413657.1.96318 WP_003413657.1.96345 WP_003413657.1.96360 WP_003413657.1.96373 WP_003413657.1.96456 WP_003413657.1.96560 WP_003413657.1.96569 WP_003413657.1.96573 WP_003413657.1.96575 WP_003413657.1.96576 WP_003413657.1.96621 WP_003413657.1.9667 WP_003413657.1.96681 WP_003413657.1.96726 WP_003413657.1.96733 WP_003413657.1.96742 WP_003413657.1.96754 WP_003413657.1.9678 WP_003413657.1.96832 WP_003413657.1.9685 WP_003413657.1.97008 WP_003413657.1.97009 WP_003413657.1.97056 WP_003413657.1.97084 WP_003413657.1.97087 WP_003413657.1.97099 WP_003413657.1.97108 WP_003413657.1.97113 WP_003413657.1.97122 WP_003413657.1.97127 WP_003413657.1.97129 WP_003413657.1.97136 WP_003413657.1.9716 WP_003413657.1.97176 WP_003413657.1.97222 WP_003413657.1.97223 WP_003413657.1.97237 WP_003413657.1.97242 WP_003413657.1.97270 WP_003413657.1.97283 WP_003413657.1.97296 WP_003413657.1.97321 WP_003413657.1.97330 WP_003413657.1.97366 WP_003413657.1.97376 WP_003413657.1.97380 WP_003413657.1.9739 WP_003413657.1.97462 WP_003413657.1.97517 WP_003413657.1.97519 WP_003413657.1.97535 WP_003413657.1.97540 WP_003413657.1.97546 WP_003413657.1.97550 WP_003413657.1.97568 WP_003413657.1.97577 WP_003413657.1.97584 WP_003413657.1.9759 WP_003413657.1.97591 WP_003413657.1.97596 WP_003413657.1.97609 WP_003413657.1.97618 WP_003413657.1.9763 WP_003413657.1.97669 WP_003413657.1.97673 WP_003413657.1.97700 WP_003413657.1.97701 WP_003413657.1.97730 WP_003413657.1.97740 WP_003413657.1.97751 WP_003413657.1.97754 WP_003413657.1.97797 WP_003413657.1.9782 WP_003413657.1.9784 WP_003413657.1.97888 WP_003413657.1.9795 WP_003413657.1.97951 WP_003413657.1.97958 WP_003413657.1.97966 WP_003413657.1.97979 WP_003413657.1.97995 WP_003413657.1.98018 WP_003413657.1.98034 WP_003413657.1.98052 WP_003413657.1.98071 WP_003413657.1.98072 WP_003413657.1.98113 WP_003413657.1.98114 WP_003413657.1.98128 WP_003413657.1.98181 WP_003413657.1.98188 WP_003413657.1.98189 WP_003413657.1.98213 WP_003413657.1.98225 WP_003413657.1.98291 WP_003413657.1.98335 WP_003413657.1.98350 WP_003413657.1.98395 WP_003413657.1.98412 WP_003413657.1.98443 WP_003413657.1.98462 WP_003413657.1.9848 WP_003413657.1.98482 WP_003413657.1.98486 WP_003413657.1.98488 WP_003413657.1.98503 WP_003413657.1.98516 WP_003413657.1.98524 WP_003413657.1.98536 WP_003413657.1.98541 WP_003413657.1.98590 WP_003413657.1.98599 WP_003413657.1.98629 WP_003413657.1.98646 WP_003413657.1.98649 WP_003413657.1.98656 WP_003413657.1.98674 WP_003413657.1.98697 WP_003413657.1.98701 WP_003413657.1.98749 WP_003413657.1.98765 WP_003413657.1.98770 WP_003413657.1.98777 WP_003413657.1.98778 WP_003413657.1.98802 WP_003413657.1.98838 WP_003413657.1.98850 WP_003413657.1.98906 WP_003413657.1.98935 WP_003413657.1.98948 WP_003413657.1.98953 WP_003413657.1.98984 WP_003413657.1.99000 WP_003413657.1.99023 WP_003413657.1.99030 WP_003413657.1.99037 WP_003413657.1.99055 WP_003413657.1.99062 WP_003413657.1.99086 WP_003413657.1.99115 WP_003413657.1.99117 WP_003413657.1.99161 WP_003413657.1.99205 WP_003413657.1.99211 WP_003413657.1.99216 WP_003413657.1.99222 WP_003413657.1.99251 WP_003413657.1.99269 WP_003413657.1.99294 WP_003413657.1.99312 WP_003413657.1.99315 WP_003413657.1.99316 WP_003413657.1.99322 WP_003413657.1.99328 WP_003413657.1.99365 WP_003413657.1.99368 WP_003413657.1.99379 WP_003413657.1.99396 WP_003413657.1.99402 WP_003413657.1.99404 WP_003413657.1.99419 WP_003413657.1.99438 WP_003413657.1.99460 WP_003413657.1.99468 WP_003413657.1.99473 WP_003413657.1.99513 WP_003413657.1.99529 WP_003413657.1.99548 WP_003413657.1.99572 WP_003413657.1.99578 WP_003413657.1.99605 WP_003413657.1.99609 WP_003413657.1.99617 WP_003413657.1.99635 WP_003413657.1.99650 WP_003413657.1.99701 WP_003413657.1.99711 WP_003413657.1.99716 WP_003413657.1.99740 WP_003413657.1.99745 WP_003413657.1.99749 WP_003413657.1.9976 WP_003413657.1.99832 WP_003413657.1.99847 WP_003413657.1.99852 WP_003413657.1.99886 WP_003413657.1.99897 WP_003413657.1.99915 WP_003413657.1.9993 WP_003413657.1.99982 WP_003413657.1.99991 gi|479315593|ref|YP_007855645.1| gi|385999420|ref|YP_005917719.1| gi|494701075|ref|YP_007966557.1| gi|506927178|ref|YP_008007628.1| gi|15609775|ref|NP_217154.1| gi|433642842|ref|YP_007288601.1| gi|378772382|ref|YP_005172115.1| gi|525675186|ref|YP_008226736.1| gi|339632665|ref|YP_004724307.1| gi|340627659|ref|YP_004746111.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]