SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I6X540 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I6X540
Domain Number 1 Region: 22-160
Classification Level Classification E-value
Superfamily CBS-domain pair 0.0000000000000182
Family CBS-domain pair 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I6X540
Sequence length 165
Comment (tr|I6X540|I6X540_MYCTU) Conserved protein {ECO:0000313|EMBL:CCP45481.1} KW=Complete proteome; Reference proteome OX=83332 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv). GN=Rv2683 OC=Mycobacterium; Mycobacterium tuberculosis complex.
Sequence
MKVNIDPTAPTFATYRRDMRAEQMAEDYPVVSIDSDALDAARMLAEHRLPGLLVTAGAGK
QYAVLPASQVVRFIVPRYVQDDPLLAGVLNESTADRCAERLSGKKVRDVLPDHLVEVPPA
NADDTIIEVAAVMARLRSPLLAVVKDGSLLGVVTASRLLAAALKT
Download sequence
Identical sequences A0A045JEW7 A0A0H3LGK7 A5U635 I6X540 O07185 R4LXV0 R4MJI5
gi|148662524|ref|YP_001284047.1| gi|471338690|ref|YP_007611403.1| gi|479315637|ref|YP_007855689.1| gi|385991970|ref|YP_005910268.1| gi|15609820|ref|NP_217199.1| gi|392431710|ref|YP_006472754.1| NP_217199.1.84033 WP_003899429.1.100021 WP_003899429.1.100069 WP_003899429.1.100087 WP_003899429.1.10015 WP_003899429.1.100208 WP_003899429.1.100216 WP_003899429.1.10022 WP_003899429.1.100255 WP_003899429.1.100260 WP_003899429.1.100270 WP_003899429.1.100279 WP_003899429.1.100286 WP_003899429.1.100308 WP_003899429.1.100309 WP_003899429.1.100318 WP_003899429.1.100338 WP_003899429.1.10037 WP_003899429.1.100383 WP_003899429.1.100396 WP_003899429.1.1004 WP_003899429.1.100401 WP_003899429.1.100459 WP_003899429.1.100460 WP_003899429.1.100552 WP_003899429.1.100581 WP_003899429.1.100600 WP_003899429.1.100625 WP_003899429.1.10064 WP_003899429.1.100666 WP_003899429.1.100671 WP_003899429.1.100677 WP_003899429.1.100697 WP_003899429.1.100703 WP_003899429.1.100716 WP_003899429.1.100722 WP_003899429.1.100754 WP_003899429.1.100757 WP_003899429.1.100772 WP_003899429.1.1008 WP_003899429.1.100812 WP_003899429.1.100845 WP_003899429.1.100866 WP_003899429.1.100889 WP_003899429.1.10090 WP_003899429.1.100910 WP_003899429.1.100915 WP_003899429.1.100918 WP_003899429.1.100935 WP_003899429.1.100984 WP_003899429.1.100992 WP_003899429.1.100998 WP_003899429.1.101 WP_003899429.1.101025 WP_003899429.1.101028 WP_003899429.1.10104 WP_003899429.1.101048 WP_003899429.1.101054 WP_003899429.1.101075 WP_003899429.1.101143 WP_003899429.1.10116 WP_003899429.1.10117 WP_003899429.1.101209 WP_003899429.1.10125 WP_003899429.1.101290 WP_003899429.1.101323 WP_003899429.1.101324 WP_003899429.1.101350 WP_003899429.1.101367 WP_003899429.1.101398 WP_003899429.1.101403 WP_003899429.1.101421 WP_003899429.1.10144 WP_003899429.1.101442 WP_003899429.1.10145 WP_003899429.1.101452 WP_003899429.1.101456 WP_003899429.1.101481 WP_003899429.1.101493 WP_003899429.1.101525 WP_003899429.1.101533 WP_003899429.1.101535 WP_003899429.1.101553 WP_003899429.1.101558 WP_003899429.1.10156 WP_003899429.1.101573 WP_003899429.1.101576 WP_003899429.1.10159 WP_003899429.1.101592 WP_003899429.1.101604 WP_003899429.1.101607 WP_003899429.1.101622 WP_003899429.1.101644 WP_003899429.1.101659 WP_003899429.1.101671 WP_003899429.1.101687 WP_003899429.1.101698 WP_003899429.1.10170 WP_003899429.1.101713 WP_003899429.1.101722 WP_003899429.1.101733 WP_003899429.1.101743 WP_003899429.1.101753 WP_003899429.1.101754 WP_003899429.1.101764 WP_003899429.1.101773 WP_003899429.1.101795 WP_003899429.1.101797 WP_003899429.1.101798 WP_003899429.1.101802 WP_003899429.1.101826 WP_003899429.1.101836 WP_003899429.1.101858 WP_003899429.1.101859 WP_003899429.1.101862 WP_003899429.1.101888 WP_003899429.1.101894 WP_003899429.1.101899 WP_003899429.1.1019 WP_003899429.1.101923 WP_003899429.1.10193 WP_003899429.1.102 WP_003899429.1.102008 WP_003899429.1.102017 WP_003899429.1.102053 WP_003899429.1.102055 WP_003899429.1.102063 WP_003899429.1.102099 WP_003899429.1.1021 WP_003899429.1.10211 WP_003899429.1.102119 WP_003899429.1.102121 WP_003899429.1.102143 WP_003899429.1.10216 WP_003899429.1.10224 WP_003899429.1.10253 WP_003899429.1.10262 WP_003899429.1.10272 WP_003899429.1.10277 WP_003899429.1.1033 WP_003899429.1.10350 WP_003899429.1.10362 WP_003899429.1.10366 WP_003899429.1.10376 WP_003899429.1.10396 WP_003899429.1.10410 WP_003899429.1.10430 WP_003899429.1.1044 WP_003899429.1.10440 WP_003899429.1.10445 WP_003899429.1.10471 WP_003899429.1.10472 WP_003899429.1.10489 WP_003899429.1.105 WP_003899429.1.10518 WP_003899429.1.10523 WP_003899429.1.10545 WP_003899429.1.1057 WP_003899429.1.10594 WP_003899429.1.10603 WP_003899429.1.10606 WP_003899429.1.10615 WP_003899429.1.10623 WP_003899429.1.10635 WP_003899429.1.10643 WP_003899429.1.10648 WP_003899429.1.10662 WP_003899429.1.10709 WP_003899429.1.10735 WP_003899429.1.10740 WP_003899429.1.10756 WP_003899429.1.1078 WP_003899429.1.10791 WP_003899429.1.10799 WP_003899429.1.10825 WP_003899429.1.10848 WP_003899429.1.10863 WP_003899429.1.10879 WP_003899429.1.10912 WP_003899429.1.10916 WP_003899429.1.10923 WP_003899429.1.10927 WP_003899429.1.1095 WP_003899429.1.10956 WP_003899429.1.10958 WP_003899429.1.10980 WP_003899429.1.10981 WP_003899429.1.10993 WP_003899429.1.1100 WP_003899429.1.11040 WP_003899429.1.11061 WP_003899429.1.11070 WP_003899429.1.11171 WP_003899429.1.11175 WP_003899429.1.11176 WP_003899429.1.11222 WP_003899429.1.11236 WP_003899429.1.11329 WP_003899429.1.1133 WP_003899429.1.11342 WP_003899429.1.11373 WP_003899429.1.11376 WP_003899429.1.11390 WP_003899429.1.11402 WP_003899429.1.11481 WP_003899429.1.11487 WP_003899429.1.11489 WP_003899429.1.11514 WP_003899429.1.11596 WP_003899429.1.11604 WP_003899429.1.11610 WP_003899429.1.11697 WP_003899429.1.11707 WP_003899429.1.11752 WP_003899429.1.11758 WP_003899429.1.11761 WP_003899429.1.11775 WP_003899429.1.11804 WP_003899429.1.11822 WP_003899429.1.11826 WP_003899429.1.11856 WP_003899429.1.11898 WP_003899429.1.11906 WP_003899429.1.11939 WP_003899429.1.11960 WP_003899429.1.11961 WP_003899429.1.11972 WP_003899429.1.120 WP_003899429.1.12001 WP_003899429.1.12049 WP_003899429.1.12052 WP_003899429.1.12100 WP_003899429.1.12116 WP_003899429.1.12133 WP_003899429.1.12161 WP_003899429.1.12165 WP_003899429.1.12184 WP_003899429.1.12190 WP_003899429.1.12216 WP_003899429.1.12265 WP_003899429.1.12275 WP_003899429.1.12293 WP_003899429.1.12294 WP_003899429.1.123 WP_003899429.1.1231 WP_003899429.1.12314 WP_003899429.1.12327 WP_003899429.1.12338 WP_003899429.1.1236 WP_003899429.1.12371 WP_003899429.1.12372 WP_003899429.1.12389 WP_003899429.1.12406 WP_003899429.1.1241 WP_003899429.1.12421 WP_003899429.1.12446 WP_003899429.1.12464 WP_003899429.1.12479 WP_003899429.1.12519 WP_003899429.1.12523 WP_003899429.1.12526 WP_003899429.1.1255 WP_003899429.1.12550 WP_003899429.1.12551 WP_003899429.1.12563 WP_003899429.1.12611 WP_003899429.1.12669 WP_003899429.1.1267 WP_003899429.1.12672 WP_003899429.1.12692 WP_003899429.1.1271 WP_003899429.1.12768 WP_003899429.1.1279 WP_003899429.1.12794 WP_003899429.1.12804 WP_003899429.1.12821 WP_003899429.1.12841 WP_003899429.1.12854 WP_003899429.1.12871 WP_003899429.1.12901 WP_003899429.1.12941 WP_003899429.1.12947 WP_003899429.1.12957 WP_003899429.1.13028 WP_003899429.1.13043 WP_003899429.1.13086 WP_003899429.1.13087 WP_003899429.1.13090 WP_003899429.1.13096 WP_003899429.1.13163 WP_003899429.1.13175 WP_003899429.1.13183 WP_003899429.1.132 WP_003899429.1.13249 WP_003899429.1.13282 WP_003899429.1.13284 WP_003899429.1.13296 WP_003899429.1.13298 WP_003899429.1.13306 WP_003899429.1.13312 WP_003899429.1.13313 WP_003899429.1.13345 WP_003899429.1.13358 WP_003899429.1.13370 WP_003899429.1.13375 WP_003899429.1.1338 WP_003899429.1.13420 WP_003899429.1.13433 WP_003899429.1.13435 WP_003899429.1.13438 WP_003899429.1.13461 WP_003899429.1.13466 WP_003899429.1.13489 WP_003899429.1.13551 WP_003899429.1.13561 WP_003899429.1.13564 WP_003899429.1.13579 WP_003899429.1.13647 WP_003899429.1.13687 WP_003899429.1.13697 WP_003899429.1.13719 WP_003899429.1.13763 WP_003899429.1.1377 WP_003899429.1.13774 WP_003899429.1.13786 WP_003899429.1.13793 WP_003899429.1.13794 WP_003899429.1.13817 WP_003899429.1.13834 WP_003899429.1.13866 WP_003899429.1.13880 WP_003899429.1.13899 WP_003899429.1.13909 WP_003899429.1.13910 WP_003899429.1.13919 WP_003899429.1.13920 WP_003899429.1.13952 WP_003899429.1.13953 WP_003899429.1.13962 WP_003899429.1.1398 WP_003899429.1.13988 WP_003899429.1.14027 WP_003899429.1.14046 WP_003899429.1.14115 WP_003899429.1.1415 WP_003899429.1.14152 WP_003899429.1.14158 WP_003899429.1.14162 WP_003899429.1.14175 WP_003899429.1.14178 WP_003899429.1.14194 WP_003899429.1.14195 WP_003899429.1.14208 WP_003899429.1.14238 WP_003899429.1.14266 WP_003899429.1.14303 WP_003899429.1.14306 WP_003899429.1.14307 WP_003899429.1.14310 WP_003899429.1.14382 WP_003899429.1.14416 WP_003899429.1.14428 WP_003899429.1.14441 WP_003899429.1.14469 WP_003899429.1.14477 WP_003899429.1.14504 WP_003899429.1.14514 WP_003899429.1.1452 WP_003899429.1.14527 WP_003899429.1.1454 WP_003899429.1.14544 WP_003899429.1.14548 WP_003899429.1.14551 WP_003899429.1.14561 WP_003899429.1.14573 WP_003899429.1.1462 WP_003899429.1.14667 WP_003899429.1.14668 WP_003899429.1.14675 WP_003899429.1.14694 WP_003899429.1.14695 WP_003899429.1.14709 WP_003899429.1.14766 WP_003899429.1.14783 WP_003899429.1.14865 WP_003899429.1.14872 WP_003899429.1.14905 WP_003899429.1.14926 WP_003899429.1.14951 WP_003899429.1.14955 WP_003899429.1.15003 WP_003899429.1.15009 WP_003899429.1.15028 WP_003899429.1.15040 WP_003899429.1.15052 WP_003899429.1.15065 WP_003899429.1.15072 WP_003899429.1.15089 WP_003899429.1.1509 WP_003899429.1.15126 WP_003899429.1.15131 WP_003899429.1.15168 WP_003899429.1.15174 WP_003899429.1.15187 WP_003899429.1.15196 WP_003899429.1.15210 WP_003899429.1.15216 WP_003899429.1.15217 WP_003899429.1.1523 WP_003899429.1.15232 WP_003899429.1.15238 WP_003899429.1.15240 WP_003899429.1.15253 WP_003899429.1.1527 WP_003899429.1.15292 WP_003899429.1.15299 WP_003899429.1.15302 WP_003899429.1.15322 WP_003899429.1.1534 WP_003899429.1.15365 WP_003899429.1.15386 WP_003899429.1.15387 WP_003899429.1.15442 WP_003899429.1.15447 WP_003899429.1.15449 WP_003899429.1.15477 WP_003899429.1.15481 WP_003899429.1.15492 WP_003899429.1.15511 WP_003899429.1.15512 WP_003899429.1.15558 WP_003899429.1.15559 WP_003899429.1.15566 WP_003899429.1.15599 WP_003899429.1.1560 WP_003899429.1.15611 WP_003899429.1.1563 WP_003899429.1.15633 WP_003899429.1.15688 WP_003899429.1.15755 WP_003899429.1.15774 WP_003899429.1.1578 WP_003899429.1.15780 WP_003899429.1.15834 WP_003899429.1.15842 WP_003899429.1.15848 WP_003899429.1.15853 WP_003899429.1.15870 WP_003899429.1.15877 WP_003899429.1.15893 WP_003899429.1.15896 WP_003899429.1.15926 WP_003899429.1.15933 WP_003899429.1.15946 WP_003899429.1.15958 WP_003899429.1.15973 WP_003899429.1.15987 WP_003899429.1.15993 WP_003899429.1.16009 WP_003899429.1.16025 WP_003899429.1.16043 WP_003899429.1.16066 WP_003899429.1.16069 WP_003899429.1.16077 WP_003899429.1.16106 WP_003899429.1.16108 WP_003899429.1.16130 WP_003899429.1.16136 WP_003899429.1.16139 WP_003899429.1.16141 WP_003899429.1.16143 WP_003899429.1.1630 WP_003899429.1.16318 WP_003899429.1.1632 WP_003899429.1.16327 WP_003899429.1.16334 WP_003899429.1.16341 WP_003899429.1.16345 WP_003899429.1.16374 WP_003899429.1.16384 WP_003899429.1.16386 WP_003899429.1.164 WP_003899429.1.1642 WP_003899429.1.16424 WP_003899429.1.16431 WP_003899429.1.16438 WP_003899429.1.1644 WP_003899429.1.16442 WP_003899429.1.16448 WP_003899429.1.16451 WP_003899429.1.16476 WP_003899429.1.16480 WP_003899429.1.16494 WP_003899429.1.1652 WP_003899429.1.16549 WP_003899429.1.16560 WP_003899429.1.16598 WP_003899429.1.16609 WP_003899429.1.16619 WP_003899429.1.16620 WP_003899429.1.16622 WP_003899429.1.16637 WP_003899429.1.1669 WP_003899429.1.16707 WP_003899429.1.16724 WP_003899429.1.16731 WP_003899429.1.16743 WP_003899429.1.1683 WP_003899429.1.16837 WP_003899429.1.16852 WP_003899429.1.16937 WP_003899429.1.16940 WP_003899429.1.16950 WP_003899429.1.16959 WP_003899429.1.16968 WP_003899429.1.16977 WP_003899429.1.16987 WP_003899429.1.17005 WP_003899429.1.17006 WP_003899429.1.17010 WP_003899429.1.17015 WP_003899429.1.17019 WP_003899429.1.17041 WP_003899429.1.17052 WP_003899429.1.17057 WP_003899429.1.17062 WP_003899429.1.1707 WP_003899429.1.17094 WP_003899429.1.17130 WP_003899429.1.17138 WP_003899429.1.17147 WP_003899429.1.17224 WP_003899429.1.17251 WP_003899429.1.17288 WP_003899429.1.17304 WP_003899429.1.17345 WP_003899429.1.17381 WP_003899429.1.17391 WP_003899429.1.17412 WP_003899429.1.1743 WP_003899429.1.17440 WP_003899429.1.17466 WP_003899429.1.17477 WP_003899429.1.17483 WP_003899429.1.17505 WP_003899429.1.17527 WP_003899429.1.17535 WP_003899429.1.17540 WP_003899429.1.17553 WP_003899429.1.17558 WP_003899429.1.17599 WP_003899429.1.17635 WP_003899429.1.17655 WP_003899429.1.17679 WP_003899429.1.17687 WP_003899429.1.17700 WP_003899429.1.17710 WP_003899429.1.17713 WP_003899429.1.17722 WP_003899429.1.17746 WP_003899429.1.17788 WP_003899429.1.17798 WP_003899429.1.17803 WP_003899429.1.17816 WP_003899429.1.17821 WP_003899429.1.17830 WP_003899429.1.17868 WP_003899429.1.17878 WP_003899429.1.1792 WP_003899429.1.17923 WP_003899429.1.1795 WP_003899429.1.17955 WP_003899429.1.17973 WP_003899429.1.18009 WP_003899429.1.18033 WP_003899429.1.18057 WP_003899429.1.18065 WP_003899429.1.18070 WP_003899429.1.18116 WP_003899429.1.18120 WP_003899429.1.18126 WP_003899429.1.1817 WP_003899429.1.18170 WP_003899429.1.18206 WP_003899429.1.18216 WP_003899429.1.18240 WP_003899429.1.18257 WP_003899429.1.18297 WP_003899429.1.18306 WP_003899429.1.18364 WP_003899429.1.18399 WP_003899429.1.18411 WP_003899429.1.18448 WP_003899429.1.18467 WP_003899429.1.18476 WP_003899429.1.18522 WP_003899429.1.18580 WP_003899429.1.18582 WP_003899429.1.18587 WP_003899429.1.186 WP_003899429.1.18601 WP_003899429.1.18639 WP_003899429.1.18646 WP_003899429.1.18647 WP_003899429.1.1868 WP_003899429.1.18694 WP_003899429.1.18710 WP_003899429.1.18751 WP_003899429.1.18781 WP_003899429.1.18793 WP_003899429.1.18804 WP_003899429.1.18816 WP_003899429.1.18823 WP_003899429.1.18827 WP_003899429.1.18849 WP_003899429.1.18856 WP_003899429.1.18945 WP_003899429.1.1898 WP_003899429.1.19005 WP_003899429.1.19056 WP_003899429.1.19066 WP_003899429.1.19071 WP_003899429.1.19085 WP_003899429.1.19094 WP_003899429.1.19144 WP_003899429.1.19159 WP_003899429.1.19193 WP_003899429.1.19231 WP_003899429.1.19243 WP_003899429.1.19264 WP_003899429.1.19295 WP_003899429.1.19307 WP_003899429.1.19326 WP_003899429.1.1933 WP_003899429.1.19364 WP_003899429.1.19382 WP_003899429.1.19400 WP_003899429.1.19426 WP_003899429.1.19429 WP_003899429.1.19464 WP_003899429.1.19480 WP_003899429.1.19553 WP_003899429.1.19562 WP_003899429.1.19564 WP_003899429.1.19568 WP_003899429.1.19572 WP_003899429.1.19595 WP_003899429.1.19600 WP_003899429.1.19630 WP_003899429.1.1967 WP_003899429.1.19694 WP_003899429.1.1970 WP_003899429.1.19707 WP_003899429.1.19742 WP_003899429.1.19785 WP_003899429.1.19820 WP_003899429.1.19868 WP_003899429.1.19874 WP_003899429.1.19890 WP_003899429.1.19900 WP_003899429.1.19922 WP_003899429.1.19936 WP_003899429.1.19946 WP_003899429.1.19949 WP_003899429.1.19960 WP_003899429.1.19964 WP_003899429.1.20007 WP_003899429.1.20016 WP_003899429.1.2003 WP_003899429.1.20037 WP_003899429.1.20039 WP_003899429.1.20082 WP_003899429.1.20085 WP_003899429.1.20097 WP_003899429.1.20116 WP_003899429.1.20130 WP_003899429.1.20140 WP_003899429.1.20141 WP_003899429.1.20142 WP_003899429.1.20158 WP_003899429.1.20239 WP_003899429.1.20243 WP_003899429.1.20259 WP_003899429.1.20262 WP_003899429.1.20272 WP_003899429.1.20280 WP_003899429.1.20294 WP_003899429.1.20300 WP_003899429.1.20309 WP_003899429.1.20322 WP_003899429.1.2037 WP_003899429.1.20372 WP_003899429.1.20381 WP_003899429.1.204 WP_003899429.1.20427 WP_003899429.1.20457 WP_003899429.1.20459 WP_003899429.1.20460 WP_003899429.1.20542 WP_003899429.1.20578 WP_003899429.1.20608 WP_003899429.1.20624 WP_003899429.1.20628 WP_003899429.1.2066 WP_003899429.1.20707 WP_003899429.1.20722 WP_003899429.1.20729 WP_003899429.1.20742 WP_003899429.1.20751 WP_003899429.1.20776 WP_003899429.1.20843 WP_003899429.1.20850 WP_003899429.1.2086 WP_003899429.1.20868 WP_003899429.1.20876 WP_003899429.1.20897 WP_003899429.1.20898 WP_003899429.1.2090 WP_003899429.1.20911 WP_003899429.1.20921 WP_003899429.1.20926 WP_003899429.1.20927 WP_003899429.1.20951 WP_003899429.1.20970 WP_003899429.1.2104 WP_003899429.1.21070 WP_003899429.1.21127 WP_003899429.1.21135 WP_003899429.1.21173 WP_003899429.1.21187 WP_003899429.1.212 WP_003899429.1.2120 WP_003899429.1.21218 WP_003899429.1.21219 WP_003899429.1.2123 WP_003899429.1.21231 WP_003899429.1.21234 WP_003899429.1.2126 WP_003899429.1.21292 WP_003899429.1.2131 WP_003899429.1.21311 WP_003899429.1.21321 WP_003899429.1.21365 WP_003899429.1.21392 WP_003899429.1.21397 WP_003899429.1.21415 WP_003899429.1.21430 WP_003899429.1.21434 WP_003899429.1.21444 WP_003899429.1.21468 WP_003899429.1.21498 WP_003899429.1.21509 WP_003899429.1.21513 WP_003899429.1.21560 WP_003899429.1.21565 WP_003899429.1.21586 WP_003899429.1.21591 WP_003899429.1.21594 WP_003899429.1.21602 WP_003899429.1.21615 WP_003899429.1.21638 WP_003899429.1.21639 WP_003899429.1.21655 WP_003899429.1.21658 WP_003899429.1.2168 WP_003899429.1.2174 WP_003899429.1.21741 WP_003899429.1.21777 WP_003899429.1.21786 WP_003899429.1.21795 WP_003899429.1.218 WP_003899429.1.21826 WP_003899429.1.21829 WP_003899429.1.21840 WP_003899429.1.21843 WP_003899429.1.21872 WP_003899429.1.21873 WP_003899429.1.2188 WP_003899429.1.21882 WP_003899429.1.21906 WP_003899429.1.21912 WP_003899429.1.2194 WP_003899429.1.21941 WP_003899429.1.21956 WP_003899429.1.21958 WP_003899429.1.21960 WP_003899429.1.21971 WP_003899429.1.21973 WP_003899429.1.21983 WP_003899429.1.22003 WP_003899429.1.22013 WP_003899429.1.22025 WP_003899429.1.22036 WP_003899429.1.22075 WP_003899429.1.22092 WP_003899429.1.2212 WP_003899429.1.22127 WP_003899429.1.22140 WP_003899429.1.22233 WP_003899429.1.22255 WP_003899429.1.22277 WP_003899429.1.22348 WP_003899429.1.22366 WP_003899429.1.2238 WP_003899429.1.22380 WP_003899429.1.22437 WP_003899429.1.22438 WP_003899429.1.22524 WP_003899429.1.22585 WP_003899429.1.22606 WP_003899429.1.22608 WP_003899429.1.22609 WP_003899429.1.22618 WP_003899429.1.2262 WP_003899429.1.22624 WP_003899429.1.22629 WP_003899429.1.22664 WP_003899429.1.22665 WP_003899429.1.22670 WP_003899429.1.22725 WP_003899429.1.22728 WP_003899429.1.22733 WP_003899429.1.22737 WP_003899429.1.2275 WP_003899429.1.22754 WP_003899429.1.22800 WP_003899429.1.22804 WP_003899429.1.22829 WP_003899429.1.22840 WP_003899429.1.22970 WP_003899429.1.22996 WP_003899429.1.22997 WP_003899429.1.22999 WP_003899429.1.23015 WP_003899429.1.23032 WP_003899429.1.231 WP_003899429.1.23101 WP_003899429.1.2312 WP_003899429.1.23171 WP_003899429.1.23199 WP_003899429.1.2320 WP_003899429.1.23204 WP_003899429.1.23216 WP_003899429.1.23229 WP_003899429.1.23233 WP_003899429.1.2326 WP_003899429.1.23261 WP_003899429.1.23272 WP_003899429.1.23289 WP_003899429.1.2329 WP_003899429.1.23308 WP_003899429.1.23316 WP_003899429.1.23321 WP_003899429.1.23325 WP_003899429.1.2339 WP_003899429.1.23406 WP_003899429.1.23438 WP_003899429.1.23445 WP_003899429.1.23447 WP_003899429.1.23452 WP_003899429.1.23461 WP_003899429.1.2349 WP_003899429.1.23496 WP_003899429.1.23506 WP_003899429.1.23530 WP_003899429.1.23539 WP_003899429.1.23546 WP_003899429.1.23551 WP_003899429.1.23573 WP_003899429.1.23583 WP_003899429.1.23588 WP_003899429.1.23628 WP_003899429.1.23677 WP_003899429.1.23683 WP_003899429.1.23692 WP_003899429.1.23694 WP_003899429.1.23699 WP_003899429.1.2371 WP_003899429.1.23803 WP_003899429.1.23807 WP_003899429.1.23825 WP_003899429.1.23832 WP_003899429.1.2384 WP_003899429.1.23843 WP_003899429.1.23863 WP_003899429.1.23894 WP_003899429.1.23993 WP_003899429.1.2400 WP_003899429.1.24007 WP_003899429.1.24008 WP_003899429.1.24046 WP_003899429.1.24057 WP_003899429.1.24113 WP_003899429.1.24119 WP_003899429.1.24140 WP_003899429.1.24176 WP_003899429.1.24190 WP_003899429.1.24202 WP_003899429.1.24261 WP_003899429.1.24284 WP_003899429.1.24294 WP_003899429.1.24357 WP_003899429.1.24396 WP_003899429.1.24423 WP_003899429.1.2443 WP_003899429.1.24446 WP_003899429.1.24461 WP_003899429.1.24500 WP_003899429.1.24507 WP_003899429.1.24509 WP_003899429.1.24529 WP_003899429.1.24553 WP_003899429.1.24599 WP_003899429.1.24638 WP_003899429.1.24648 WP_003899429.1.2466 WP_003899429.1.24824 WP_003899429.1.24831 WP_003899429.1.24840 WP_003899429.1.24848 WP_003899429.1.24857 WP_003899429.1.2487 WP_003899429.1.24893 WP_003899429.1.24933 WP_003899429.1.24956 WP_003899429.1.24958 WP_003899429.1.24985 WP_003899429.1.2499 WP_003899429.1.25004 WP_003899429.1.2505 WP_003899429.1.25051 WP_003899429.1.2507 WP_003899429.1.25096 WP_003899429.1.25103 WP_003899429.1.25129 WP_003899429.1.25171 WP_003899429.1.25184 WP_003899429.1.25247 WP_003899429.1.25278 WP_003899429.1.25309 WP_003899429.1.25313 WP_003899429.1.25338 WP_003899429.1.25342 WP_003899429.1.25343 WP_003899429.1.25367 WP_003899429.1.25393 WP_003899429.1.25406 WP_003899429.1.25435 WP_003899429.1.25437 WP_003899429.1.25445 WP_003899429.1.25455 WP_003899429.1.25473 WP_003899429.1.25504 WP_003899429.1.25513 WP_003899429.1.25542 WP_003899429.1.25579 WP_003899429.1.25594 WP_003899429.1.25606 WP_003899429.1.25645 WP_003899429.1.2566 WP_003899429.1.25673 WP_003899429.1.25674 WP_003899429.1.25693 WP_003899429.1.25699 WP_003899429.1.25727 WP_003899429.1.25736 WP_003899429.1.25738 WP_003899429.1.25756 WP_003899429.1.2580 WP_003899429.1.25813 WP_003899429.1.25854 WP_003899429.1.25874 WP_003899429.1.25885 WP_003899429.1.25892 WP_003899429.1.25906 WP_003899429.1.25914 WP_003899429.1.25916 WP_003899429.1.2594 WP_003899429.1.25954 WP_003899429.1.25972 WP_003899429.1.26017 WP_003899429.1.26038 WP_003899429.1.26072 WP_003899429.1.26089 WP_003899429.1.26097 WP_003899429.1.26098 WP_003899429.1.26108 WP_003899429.1.26109 WP_003899429.1.26118 WP_003899429.1.26126 WP_003899429.1.2614 WP_003899429.1.26168 WP_003899429.1.26182 WP_003899429.1.26190 WP_003899429.1.2620 WP_003899429.1.26243 WP_003899429.1.26267 WP_003899429.1.26292 WP_003899429.1.26310 WP_003899429.1.26328 WP_003899429.1.26349 WP_003899429.1.26366 WP_003899429.1.26374 WP_003899429.1.26407 WP_003899429.1.26454 WP_003899429.1.26464 WP_003899429.1.2653 WP_003899429.1.26560 WP_003899429.1.26571 WP_003899429.1.2659 WP_003899429.1.26597 WP_003899429.1.26603 WP_003899429.1.26629 WP_003899429.1.26651 WP_003899429.1.26702 WP_003899429.1.26707 WP_003899429.1.26710 WP_003899429.1.26719 WP_003899429.1.26737 WP_003899429.1.26738 WP_003899429.1.26745 WP_003899429.1.26756 WP_003899429.1.2676 WP_003899429.1.2677 WP_003899429.1.26779 WP_003899429.1.26780 WP_003899429.1.26854 WP_003899429.1.26868 WP_003899429.1.26888 WP_003899429.1.26914 WP_003899429.1.26945 WP_003899429.1.26959 WP_003899429.1.26969 WP_003899429.1.26984 WP_003899429.1.26992 WP_003899429.1.27017 WP_003899429.1.27045 WP_003899429.1.27074 WP_003899429.1.27075 WP_003899429.1.27128 WP_003899429.1.27130 WP_003899429.1.27139 WP_003899429.1.27152 WP_003899429.1.27162 WP_003899429.1.27164 WP_003899429.1.27193 WP_003899429.1.27235 WP_003899429.1.27278 WP_003899429.1.27343 WP_003899429.1.27352 WP_003899429.1.27369 WP_003899429.1.27391 WP_003899429.1.27398 WP_003899429.1.27402 WP_003899429.1.27410 WP_003899429.1.27411 WP_003899429.1.27449 WP_003899429.1.27460 WP_003899429.1.27463 WP_003899429.1.2749 WP_003899429.1.27492 WP_003899429.1.27528 WP_003899429.1.27541 WP_003899429.1.27576 WP_003899429.1.27596 WP_003899429.1.27607 WP_003899429.1.2766 WP_003899429.1.277 WP_003899429.1.27724 WP_003899429.1.27730 WP_003899429.1.27736 WP_003899429.1.27743 WP_003899429.1.27750 WP_003899429.1.27771 WP_003899429.1.27779 WP_003899429.1.27795 WP_003899429.1.27819 WP_003899429.1.27835 WP_003899429.1.27915 WP_003899429.1.27935 WP_003899429.1.27962 WP_003899429.1.28053 WP_003899429.1.28092 WP_003899429.1.28106 WP_003899429.1.28131 WP_003899429.1.28142 WP_003899429.1.28159 WP_003899429.1.2816 WP_003899429.1.28161 WP_003899429.1.28192 WP_003899429.1.28202 WP_003899429.1.28241 WP_003899429.1.28242 WP_003899429.1.28251 WP_003899429.1.28255 WP_003899429.1.28269 WP_003899429.1.28276 WP_003899429.1.28293 WP_003899429.1.28331 WP_003899429.1.28367 WP_003899429.1.28378 WP_003899429.1.28391 WP_003899429.1.2842 WP_003899429.1.28448 WP_003899429.1.2847 WP_003899429.1.28471 WP_003899429.1.28473 WP_003899429.1.28493 WP_003899429.1.28497 WP_003899429.1.28530 WP_003899429.1.28545 WP_003899429.1.28561 WP_003899429.1.28567 WP_003899429.1.28585 WP_003899429.1.286 WP_003899429.1.28610 WP_003899429.1.28617 WP_003899429.1.28634 WP_003899429.1.28642 WP_003899429.1.28671 WP_003899429.1.28698 WP_003899429.1.28703 WP_003899429.1.28739 WP_003899429.1.28781 WP_003899429.1.28787 WP_003899429.1.28827 WP_003899429.1.28839 WP_003899429.1.28847 WP_003899429.1.28850 WP_003899429.1.28851 WP_003899429.1.28865 WP_003899429.1.28897 WP_003899429.1.28914 WP_003899429.1.28935 WP_003899429.1.28936 WP_003899429.1.28939 WP_003899429.1.28943 WP_003899429.1.28952 WP_003899429.1.28975 WP_003899429.1.2899 WP_003899429.1.28993 WP_003899429.1.29000 WP_003899429.1.2901 WP_003899429.1.29028 WP_003899429.1.29033 WP_003899429.1.29058 WP_003899429.1.29115 WP_003899429.1.2916 WP_003899429.1.29217 WP_003899429.1.29234 WP_003899429.1.29264 WP_003899429.1.29275 WP_003899429.1.29306 WP_003899429.1.29339 WP_003899429.1.29348 WP_003899429.1.29364 WP_003899429.1.29367 WP_003899429.1.2938 WP_003899429.1.29426 WP_003899429.1.2944 WP_003899429.1.29449 WP_003899429.1.29450 WP_003899429.1.29452 WP_003899429.1.29510 WP_003899429.1.29515 WP_003899429.1.29525 WP_003899429.1.2953 WP_003899429.1.29587 WP_003899429.1.2959 WP_003899429.1.29592 WP_003899429.1.29599 WP_003899429.1.29611 WP_003899429.1.29632 WP_003899429.1.29649 WP_003899429.1.2965 WP_003899429.1.29659 WP_003899429.1.2969 WP_003899429.1.29696 WP_003899429.1.29698 WP_003899429.1.29718 WP_003899429.1.29745 WP_003899429.1.29747 WP_003899429.1.29769 WP_003899429.1.29825 WP_003899429.1.29830 WP_003899429.1.29847 WP_003899429.1.29861 WP_003899429.1.29869 WP_003899429.1.29883 WP_003899429.1.29890 WP_003899429.1.299 WP_003899429.1.29931 WP_003899429.1.29960 WP_003899429.1.30014 WP_003899429.1.3004 WP_003899429.1.30040 WP_003899429.1.30043 WP_003899429.1.30074 WP_003899429.1.30097 WP_003899429.1.30106 WP_003899429.1.30114 WP_003899429.1.30126 WP_003899429.1.30131 WP_003899429.1.30138 WP_003899429.1.30139 WP_003899429.1.30145 WP_003899429.1.30235 WP_003899429.1.30237 WP_003899429.1.3027 WP_003899429.1.30279 WP_003899429.1.30282 WP_003899429.1.30283 WP_003899429.1.30288 WP_003899429.1.30291 WP_003899429.1.30363 WP_003899429.1.30374 WP_003899429.1.30404 WP_003899429.1.30433 WP_003899429.1.30438 WP_003899429.1.30462 WP_003899429.1.30464 WP_003899429.1.30468 WP_003899429.1.30500 WP_003899429.1.3057 WP_003899429.1.30574 WP_003899429.1.30628 WP_003899429.1.30641 WP_003899429.1.30642 WP_003899429.1.30661 WP_003899429.1.30683 WP_003899429.1.30699 WP_003899429.1.30709 WP_003899429.1.30713 WP_003899429.1.30716 WP_003899429.1.30719 WP_003899429.1.30730 WP_003899429.1.30760 WP_003899429.1.30791 WP_003899429.1.308 WP_003899429.1.30807 WP_003899429.1.30818 WP_003899429.1.30824 WP_003899429.1.30848 WP_003899429.1.30888 WP_003899429.1.30901 WP_003899429.1.30903 WP_003899429.1.30912 WP_003899429.1.30913 WP_003899429.1.30914 WP_003899429.1.30919 WP_003899429.1.30977 WP_003899429.1.3100 WP_003899429.1.31002 WP_003899429.1.3101 WP_003899429.1.31034 WP_003899429.1.31047 WP_003899429.1.31070 WP_003899429.1.31074 WP_003899429.1.31102 WP_003899429.1.31127 WP_003899429.1.31184 WP_003899429.1.31199 WP_003899429.1.31226 WP_003899429.1.31230 WP_003899429.1.31233 WP_003899429.1.31263 WP_003899429.1.31264 WP_003899429.1.31270 WP_003899429.1.31287 WP_003899429.1.31290 WP_003899429.1.31304 WP_003899429.1.31346 WP_003899429.1.31348 WP_003899429.1.31354 WP_003899429.1.31390 WP_003899429.1.31414 WP_003899429.1.31417 WP_003899429.1.31428 WP_003899429.1.3143 WP_003899429.1.31458 WP_003899429.1.31483 WP_003899429.1.3149 WP_003899429.1.31498 WP_003899429.1.31507 WP_003899429.1.31537 WP_003899429.1.31548 WP_003899429.1.31569 WP_003899429.1.31573 WP_003899429.1.316 WP_003899429.1.31629 WP_003899429.1.31666 WP_003899429.1.31693 WP_003899429.1.31703 WP_003899429.1.31744 WP_003899429.1.31745 WP_003899429.1.31770 WP_003899429.1.31776 WP_003899429.1.31783 WP_003899429.1.318 WP_003899429.1.3184 WP_003899429.1.31840 WP_003899429.1.31880 WP_003899429.1.31911 WP_003899429.1.31930 WP_003899429.1.31932 WP_003899429.1.31955 WP_003899429.1.31985 WP_003899429.1.31991 WP_003899429.1.31995 WP_003899429.1.32004 WP_003899429.1.32039 WP_003899429.1.3204 WP_003899429.1.32045 WP_003899429.1.32071 WP_003899429.1.32098 WP_003899429.1.32132 WP_003899429.1.32157 WP_003899429.1.32164 WP_003899429.1.32179 WP_003899429.1.32198 WP_003899429.1.32297 WP_003899429.1.32317 WP_003899429.1.32383 WP_003899429.1.32400 WP_003899429.1.32403 WP_003899429.1.32416 WP_003899429.1.32421 WP_003899429.1.32433 WP_003899429.1.32461 WP_003899429.1.32482 WP_003899429.1.32503 WP_003899429.1.32556 WP_003899429.1.32562 WP_003899429.1.32569 WP_003899429.1.32592 WP_003899429.1.32620 WP_003899429.1.32653 WP_003899429.1.32654 WP_003899429.1.3268 WP_003899429.1.32695 WP_003899429.1.32706 WP_003899429.1.32716 WP_003899429.1.32738 WP_003899429.1.32752 WP_003899429.1.32780 WP_003899429.1.32781 WP_003899429.1.32793 WP_003899429.1.32799 WP_003899429.1.32833 WP_003899429.1.32862 WP_003899429.1.32897 WP_003899429.1.32909 WP_003899429.1.32935 WP_003899429.1.32974 WP_003899429.1.33007 WP_003899429.1.3302 WP_003899429.1.33028 WP_003899429.1.33044 WP_003899429.1.33054 WP_003899429.1.33082 WP_003899429.1.33141 WP_003899429.1.33148 WP_003899429.1.33155 WP_003899429.1.3321 WP_003899429.1.33215 WP_003899429.1.3325 WP_003899429.1.3327 WP_003899429.1.33278 WP_003899429.1.33288 WP_003899429.1.33305 WP_003899429.1.3331 WP_003899429.1.33319 WP_003899429.1.3333 WP_003899429.1.33393 WP_003899429.1.33403 WP_003899429.1.33452 WP_003899429.1.33467 WP_003899429.1.33477 WP_003899429.1.3349 WP_003899429.1.33519 WP_003899429.1.33542 WP_003899429.1.33601 WP_003899429.1.33602 WP_003899429.1.33633 WP_003899429.1.33646 WP_003899429.1.33673 WP_003899429.1.3369 WP_003899429.1.33705 WP_003899429.1.33762 WP_003899429.1.33783 WP_003899429.1.33789 WP_003899429.1.3383 WP_003899429.1.33832 WP_003899429.1.33839 WP_003899429.1.33848 WP_003899429.1.3387 WP_003899429.1.33886 WP_003899429.1.33895 WP_003899429.1.33912 WP_003899429.1.33954 WP_003899429.1.34042 WP_003899429.1.3405 WP_003899429.1.34055 WP_003899429.1.34056 WP_003899429.1.34065 WP_003899429.1.3408 WP_003899429.1.34090 WP_003899429.1.34109 WP_003899429.1.34152 WP_003899429.1.34163 WP_003899429.1.34181 WP_003899429.1.34197 WP_003899429.1.34198 WP_003899429.1.34215 WP_003899429.1.34219 WP_003899429.1.34255 WP_003899429.1.34260 WP_003899429.1.34275 WP_003899429.1.343 WP_003899429.1.34347 WP_003899429.1.34392 WP_003899429.1.344 WP_003899429.1.34428 WP_003899429.1.3443 WP_003899429.1.34435 WP_003899429.1.34446 WP_003899429.1.34499 WP_003899429.1.34505 WP_003899429.1.34516 WP_003899429.1.34529 WP_003899429.1.34551 WP_003899429.1.34563 WP_003899429.1.34576 WP_003899429.1.34581 WP_003899429.1.34596 WP_003899429.1.34599 WP_003899429.1.34639 WP_003899429.1.34673 WP_003899429.1.34724 WP_003899429.1.34740 WP_003899429.1.34755 WP_003899429.1.34777 WP_003899429.1.34783 WP_003899429.1.34841 WP_003899429.1.34908 WP_003899429.1.34919 WP_003899429.1.3492 WP_003899429.1.34933 WP_003899429.1.34945 WP_003899429.1.34946 WP_003899429.1.34954 WP_003899429.1.34960 WP_003899429.1.34961 WP_003899429.1.34963 WP_003899429.1.34965 WP_003899429.1.34968 WP_003899429.1.35023 WP_003899429.1.35069 WP_003899429.1.35072 WP_003899429.1.35078 WP_003899429.1.35156 WP_003899429.1.35160 WP_003899429.1.35162 WP_003899429.1.35176 WP_003899429.1.3520 WP_003899429.1.35213 WP_003899429.1.35221 WP_003899429.1.35246 WP_003899429.1.35278 WP_003899429.1.35301 WP_003899429.1.35312 WP_003899429.1.35317 WP_003899429.1.35319 WP_003899429.1.35347 WP_003899429.1.35363 WP_003899429.1.35382 WP_003899429.1.35385 WP_003899429.1.35396 WP_003899429.1.35397 WP_003899429.1.35426 WP_003899429.1.35439 WP_003899429.1.35455 WP_003899429.1.3548 WP_003899429.1.35484 WP_003899429.1.35492 WP_003899429.1.3553 WP_003899429.1.35553 WP_003899429.1.35555 WP_003899429.1.35561 WP_003899429.1.35610 WP_003899429.1.35635 WP_003899429.1.35657 WP_003899429.1.35687 WP_003899429.1.35689 WP_003899429.1.35707 WP_003899429.1.35732 WP_003899429.1.35754 WP_003899429.1.35767 WP_003899429.1.35770 WP_003899429.1.35771 WP_003899429.1.35780 WP_003899429.1.35805 WP_003899429.1.35821 WP_003899429.1.3584 WP_003899429.1.35848 WP_003899429.1.35864 WP_003899429.1.35874 WP_003899429.1.35876 WP_003899429.1.35899 WP_003899429.1.35954 WP_003899429.1.36005 WP_003899429.1.36014 WP_003899429.1.36023 WP_003899429.1.36051 WP_003899429.1.36053 WP_003899429.1.36075 WP_003899429.1.36089 WP_003899429.1.36097 WP_003899429.1.36098 WP_003899429.1.36116 WP_003899429.1.36145 WP_003899429.1.36205 WP_003899429.1.36228 WP_003899429.1.36252 WP_003899429.1.36260 WP_003899429.1.36271 WP_003899429.1.36303 WP_003899429.1.36309 WP_003899429.1.36315 WP_003899429.1.36319 WP_003899429.1.36321 WP_003899429.1.36326 WP_003899429.1.3634 WP_003899429.1.36356 WP_003899429.1.36357 WP_003899429.1.3636 WP_003899429.1.36385 WP_003899429.1.36399 WP_003899429.1.36436 WP_003899429.1.36465 WP_003899429.1.36469 WP_003899429.1.36473 WP_003899429.1.36485 WP_003899429.1.36508 WP_003899429.1.36540 WP_003899429.1.36561 WP_003899429.1.36571 WP_003899429.1.36573 WP_003899429.1.36578 WP_003899429.1.36585 WP_003899429.1.36597 WP_003899429.1.36614 WP_003899429.1.36674 WP_003899429.1.36720 WP_003899429.1.36727 WP_003899429.1.36733 WP_003899429.1.36785 WP_003899429.1.36810 WP_003899429.1.36862 WP_003899429.1.36893 WP_003899429.1.36901 WP_003899429.1.36921 WP_003899429.1.36935 WP_003899429.1.36941 WP_003899429.1.3695 WP_003899429.1.36968 WP_003899429.1.3700 WP_003899429.1.37004 WP_003899429.1.37012 WP_003899429.1.37071 WP_003899429.1.37088 WP_003899429.1.37157 WP_003899429.1.37175 WP_003899429.1.37188 WP_003899429.1.37213 WP_003899429.1.37229 WP_003899429.1.3724 WP_003899429.1.37277 WP_003899429.1.37305 WP_003899429.1.37330 WP_003899429.1.37389 WP_003899429.1.37400 WP_003899429.1.37440 WP_003899429.1.37459 WP_003899429.1.37468 WP_003899429.1.37475 WP_003899429.1.37484 WP_003899429.1.37612 WP_003899429.1.37632 WP_003899429.1.37643 WP_003899429.1.37655 WP_003899429.1.37660 WP_003899429.1.37674 WP_003899429.1.37700 WP_003899429.1.37701 WP_003899429.1.37709 WP_003899429.1.37711 WP_003899429.1.37721 WP_003899429.1.37722 WP_003899429.1.37747 WP_003899429.1.37765 WP_003899429.1.37772 WP_003899429.1.37804 WP_003899429.1.37809 WP_003899429.1.37859 WP_003899429.1.37877 WP_003899429.1.37912 WP_003899429.1.37913 WP_003899429.1.37943 WP_003899429.1.37950 WP_003899429.1.37973 WP_003899429.1.37975 WP_003899429.1.37983 WP_003899429.1.38 WP_003899429.1.38002 WP_003899429.1.3802 WP_003899429.1.38039 WP_003899429.1.38040 WP_003899429.1.38067 WP_003899429.1.38068 WP_003899429.1.38138 WP_003899429.1.38144 WP_003899429.1.38158 WP_003899429.1.38159 WP_003899429.1.38210 WP_003899429.1.38233 WP_003899429.1.38240 WP_003899429.1.38299 WP_003899429.1.38332 WP_003899429.1.38347 WP_003899429.1.38354 WP_003899429.1.38389 WP_003899429.1.38398 WP_003899429.1.38402 WP_003899429.1.38418 WP_003899429.1.38421 WP_003899429.1.38466 WP_003899429.1.38477 WP_003899429.1.38483 WP_003899429.1.3849 WP_003899429.1.385 WP_003899429.1.38530 WP_003899429.1.38594 WP_003899429.1.38611 WP_003899429.1.38638 WP_003899429.1.38646 WP_003899429.1.38648 WP_003899429.1.38654 WP_003899429.1.38660 WP_003899429.1.38666 WP_003899429.1.38671 WP_003899429.1.38672 WP_003899429.1.38677 WP_003899429.1.38750 WP_003899429.1.38772 WP_003899429.1.38812 WP_003899429.1.38821 WP_003899429.1.38844 WP_003899429.1.38863 WP_003899429.1.38873 WP_003899429.1.3889 WP_003899429.1.38894 WP_003899429.1.38909 WP_003899429.1.38939 WP_003899429.1.38974 WP_003899429.1.38975 WP_003899429.1.38991 WP_003899429.1.39025 WP_003899429.1.39070 WP_003899429.1.39072 WP_003899429.1.39095 WP_003899429.1.39106 WP_003899429.1.39165 WP_003899429.1.39174 WP_003899429.1.39176 WP_003899429.1.39178 WP_003899429.1.39190 WP_003899429.1.39201 WP_003899429.1.39207 WP_003899429.1.39236 WP_003899429.1.39239 WP_003899429.1.39252 WP_003899429.1.39288 WP_003899429.1.39295 WP_003899429.1.39306 WP_003899429.1.39359 WP_003899429.1.39364 WP_003899429.1.39400 WP_003899429.1.39447 WP_003899429.1.3945 WP_003899429.1.39450 WP_003899429.1.39455 WP_003899429.1.39521 WP_003899429.1.39560 WP_003899429.1.39592 WP_003899429.1.39593 WP_003899429.1.396 WP_003899429.1.3960 WP_003899429.1.39616 WP_003899429.1.39654 WP_003899429.1.39657 WP_003899429.1.39661 WP_003899429.1.39674 WP_003899429.1.39678 WP_003899429.1.3968 WP_003899429.1.39694 WP_003899429.1.3971 WP_003899429.1.39718 WP_003899429.1.39728 WP_003899429.1.39739 WP_003899429.1.39748 WP_003899429.1.39751 WP_003899429.1.39759 WP_003899429.1.39801 WP_003899429.1.39804 WP_003899429.1.39848 WP_003899429.1.39877 WP_003899429.1.39925 WP_003899429.1.3994 WP_003899429.1.39959 WP_003899429.1.3996 WP_003899429.1.39960 WP_003899429.1.3997 WP_003899429.1.39980 WP_003899429.1.40000 WP_003899429.1.40028 WP_003899429.1.4003 WP_003899429.1.40094 WP_003899429.1.40096 WP_003899429.1.40150 WP_003899429.1.40156 WP_003899429.1.40174 WP_003899429.1.40186 WP_003899429.1.40276 WP_003899429.1.40277 WP_003899429.1.40323 WP_003899429.1.40336 WP_003899429.1.40353 WP_003899429.1.4036 WP_003899429.1.40372 WP_003899429.1.40402 WP_003899429.1.40413 WP_003899429.1.40440 WP_003899429.1.40446 WP_003899429.1.40455 WP_003899429.1.40523 WP_003899429.1.40641 WP_003899429.1.40646 WP_003899429.1.40651 WP_003899429.1.40653 WP_003899429.1.4067 WP_003899429.1.40705 WP_003899429.1.40723 WP_003899429.1.40731 WP_003899429.1.40735 WP_003899429.1.40795 WP_003899429.1.40799 WP_003899429.1.40876 WP_003899429.1.40881 WP_003899429.1.40922 WP_003899429.1.4095 WP_003899429.1.40956 WP_003899429.1.40957 WP_003899429.1.40964 WP_003899429.1.4097 WP_003899429.1.410 WP_003899429.1.41000 WP_003899429.1.41055 WP_003899429.1.41108 WP_003899429.1.41123 WP_003899429.1.41177 WP_003899429.1.41202 WP_003899429.1.41219 WP_003899429.1.41231 WP_003899429.1.41249 WP_003899429.1.4127 WP_003899429.1.41376 WP_003899429.1.41430 WP_003899429.1.41447 WP_003899429.1.41469 WP_003899429.1.41504 WP_003899429.1.41553 WP_003899429.1.41564 WP_003899429.1.41632 WP_003899429.1.41635 WP_003899429.1.41636 WP_003899429.1.41648 WP_003899429.1.41660 WP_003899429.1.41685 WP_003899429.1.41695 WP_003899429.1.41704 WP_003899429.1.4171 WP_003899429.1.41719 WP_003899429.1.41733 WP_003899429.1.41744 WP_003899429.1.41774 WP_003899429.1.41791 WP_003899429.1.41803 WP_003899429.1.41820 WP_003899429.1.41828 WP_003899429.1.41829 WP_003899429.1.41860 WP_003899429.1.41912 WP_003899429.1.41921 WP_003899429.1.41933 WP_003899429.1.41944 WP_003899429.1.42043 WP_003899429.1.42078 WP_003899429.1.42094 WP_003899429.1.42112 WP_003899429.1.4212 WP_003899429.1.42122 WP_003899429.1.42134 WP_003899429.1.42183 WP_003899429.1.42188 WP_003899429.1.42202 WP_003899429.1.42208 WP_003899429.1.42247 WP_003899429.1.42255 WP_003899429.1.42273 WP_003899429.1.42278 WP_003899429.1.42304 WP_003899429.1.42309 WP_003899429.1.42370 WP_003899429.1.42385 WP_003899429.1.42400 WP_003899429.1.42409 WP_003899429.1.42414 WP_003899429.1.42430 WP_003899429.1.42461 WP_003899429.1.42465 WP_003899429.1.42467 WP_003899429.1.42473 WP_003899429.1.42474 WP_003899429.1.4248 WP_003899429.1.42494 WP_003899429.1.42519 WP_003899429.1.42524 WP_003899429.1.42534 WP_003899429.1.4255 WP_003899429.1.42562 WP_003899429.1.42568 WP_003899429.1.42618 WP_003899429.1.42660 WP_003899429.1.42695 WP_003899429.1.42704 WP_003899429.1.42705 WP_003899429.1.42722 WP_003899429.1.42777 WP_003899429.1.42782 WP_003899429.1.42835 WP_003899429.1.42839 WP_003899429.1.42842 WP_003899429.1.42905 WP_003899429.1.42916 WP_003899429.1.42930 WP_003899429.1.42971 WP_003899429.1.43005 WP_003899429.1.43009 WP_003899429.1.43053 WP_003899429.1.43082 WP_003899429.1.43087 WP_003899429.1.43098 WP_003899429.1.43208 WP_003899429.1.43236 WP_003899429.1.43246 WP_003899429.1.43255 WP_003899429.1.43269 WP_003899429.1.43273 WP_003899429.1.43296 WP_003899429.1.43306 WP_003899429.1.4335 WP_003899429.1.43368 WP_003899429.1.43395 WP_003899429.1.43457 WP_003899429.1.43462 WP_003899429.1.43475 WP_003899429.1.43478 WP_003899429.1.43484 WP_003899429.1.43557 WP_003899429.1.43578 WP_003899429.1.43588 WP_003899429.1.43643 WP_003899429.1.43664 WP_003899429.1.43684 WP_003899429.1.43686 WP_003899429.1.43706 WP_003899429.1.43716 WP_003899429.1.4377 WP_003899429.1.43781 WP_003899429.1.43794 WP_003899429.1.43815 WP_003899429.1.43846 WP_003899429.1.43861 WP_003899429.1.43863 WP_003899429.1.43866 WP_003899429.1.43872 WP_003899429.1.43885 WP_003899429.1.43897 WP_003899429.1.4390 WP_003899429.1.43902 WP_003899429.1.43921 WP_003899429.1.43936 WP_003899429.1.43937 WP_003899429.1.43960 WP_003899429.1.43965 WP_003899429.1.4399 WP_003899429.1.43993 WP_003899429.1.43996 WP_003899429.1.44 WP_003899429.1.44001 WP_003899429.1.44008 WP_003899429.1.44033 WP_003899429.1.44037 WP_003899429.1.44070 WP_003899429.1.44071 WP_003899429.1.44076 WP_003899429.1.44104 WP_003899429.1.44111 WP_003899429.1.44124 WP_003899429.1.44169 WP_003899429.1.44219 WP_003899429.1.44237 WP_003899429.1.44277 WP_003899429.1.44279 WP_003899429.1.44336 WP_003899429.1.44355 WP_003899429.1.44358 WP_003899429.1.4438 WP_003899429.1.44390 WP_003899429.1.44392 WP_003899429.1.4441 WP_003899429.1.44415 WP_003899429.1.44489 WP_003899429.1.44492 WP_003899429.1.44494 WP_003899429.1.44500 WP_003899429.1.44532 WP_003899429.1.44534 WP_003899429.1.44562 WP_003899429.1.44597 WP_003899429.1.44600 WP_003899429.1.44602 WP_003899429.1.44615 WP_003899429.1.4464 WP_003899429.1.44651 WP_003899429.1.44659 WP_003899429.1.44665 WP_003899429.1.44694 WP_003899429.1.44700 WP_003899429.1.44713 WP_003899429.1.44735 WP_003899429.1.44740 WP_003899429.1.44757 WP_003899429.1.4476 WP_003899429.1.44761 WP_003899429.1.44776 WP_003899429.1.44779 WP_003899429.1.44808 WP_003899429.1.44864 WP_003899429.1.44901 WP_003899429.1.44908 WP_003899429.1.44913 WP_003899429.1.4492 WP_003899429.1.44939 WP_003899429.1.44979 WP_003899429.1.44981 WP_003899429.1.45002 WP_003899429.1.45011 WP_003899429.1.4504 WP_003899429.1.45081 WP_003899429.1.45113 WP_003899429.1.45129 WP_003899429.1.45135 WP_003899429.1.45147 WP_003899429.1.45168 WP_003899429.1.4517 WP_003899429.1.45181 WP_003899429.1.45185 WP_003899429.1.45192 WP_003899429.1.45200 WP_003899429.1.45205 WP_003899429.1.45211 WP_003899429.1.45249 WP_003899429.1.4526 WP_003899429.1.45286 WP_003899429.1.45326 WP_003899429.1.45347 WP_003899429.1.45374 WP_003899429.1.45390 WP_003899429.1.454 WP_003899429.1.45407 WP_003899429.1.45451 WP_003899429.1.45453 WP_003899429.1.45460 WP_003899429.1.45463 WP_003899429.1.45470 WP_003899429.1.45474 WP_003899429.1.45491 WP_003899429.1.45510 WP_003899429.1.45563 WP_003899429.1.45584 WP_003899429.1.45590 WP_003899429.1.45619 WP_003899429.1.45626 WP_003899429.1.45631 WP_003899429.1.45666 WP_003899429.1.45697 WP_003899429.1.4571 WP_003899429.1.45731 WP_003899429.1.45743 WP_003899429.1.45765 WP_003899429.1.45776 WP_003899429.1.45805 WP_003899429.1.45815 WP_003899429.1.45849 WP_003899429.1.45867 WP_003899429.1.4590 WP_003899429.1.45923 WP_003899429.1.45926 WP_003899429.1.45963 WP_003899429.1.45992 WP_003899429.1.46025 WP_003899429.1.46083 WP_003899429.1.46090 WP_003899429.1.46092 WP_003899429.1.46100 WP_003899429.1.46101 WP_003899429.1.46103 WP_003899429.1.46107 WP_003899429.1.46127 WP_003899429.1.46128 WP_003899429.1.46129 WP_003899429.1.46141 WP_003899429.1.46150 WP_003899429.1.46201 WP_003899429.1.46226 WP_003899429.1.4624 WP_003899429.1.46253 WP_003899429.1.46268 WP_003899429.1.46285 WP_003899429.1.46300 WP_003899429.1.46313 WP_003899429.1.46336 WP_003899429.1.46365 WP_003899429.1.46370 WP_003899429.1.46381 WP_003899429.1.46411 WP_003899429.1.46442 WP_003899429.1.46453 WP_003899429.1.46521 WP_003899429.1.4653 WP_003899429.1.46532 WP_003899429.1.46539 WP_003899429.1.46568 WP_003899429.1.46585 WP_003899429.1.46609 WP_003899429.1.46613 WP_003899429.1.46625 WP_003899429.1.46642 WP_003899429.1.46647 WP_003899429.1.46724 WP_003899429.1.46758 WP_003899429.1.46773 WP_003899429.1.46777 WP_003899429.1.46786 WP_003899429.1.46792 WP_003899429.1.46847 WP_003899429.1.46851 WP_003899429.1.4687 WP_003899429.1.46936 WP_003899429.1.46980 WP_003899429.1.47011 WP_003899429.1.47066 WP_003899429.1.47077 WP_003899429.1.47083 WP_003899429.1.47106 WP_003899429.1.47142 WP_003899429.1.47147 WP_003899429.1.47166 WP_003899429.1.47178 WP_003899429.1.47179 WP_003899429.1.47194 WP_003899429.1.47207 WP_003899429.1.47210 WP_003899429.1.47261 WP_003899429.1.47262 WP_003899429.1.47402 WP_003899429.1.47423 WP_003899429.1.47467 WP_003899429.1.47502 WP_003899429.1.4751 WP_003899429.1.47511 WP_003899429.1.47537 WP_003899429.1.47540 WP_003899429.1.47568 WP_003899429.1.47572 WP_003899429.1.47588 WP_003899429.1.47636 WP_003899429.1.4764 WP_003899429.1.47653 WP_003899429.1.47679 WP_003899429.1.47681 WP_003899429.1.47690 WP_003899429.1.4771 WP_003899429.1.47717 WP_003899429.1.47743 WP_003899429.1.47754 WP_003899429.1.47773 WP_003899429.1.47776 WP_003899429.1.47780 WP_003899429.1.47805 WP_003899429.1.47832 WP_003899429.1.47847 WP_003899429.1.47858 WP_003899429.1.47861 WP_003899429.1.47868 WP_003899429.1.47893 WP_003899429.1.47899 WP_003899429.1.479 WP_003899429.1.47912 WP_003899429.1.47913 WP_003899429.1.47926 WP_003899429.1.4794 WP_003899429.1.47943 WP_003899429.1.47944 WP_003899429.1.47959 WP_003899429.1.47974 WP_003899429.1.47993 WP_003899429.1.48004 WP_003899429.1.48039 WP_003899429.1.48050 WP_003899429.1.48084 WP_003899429.1.48097 WP_003899429.1.48101 WP_003899429.1.4813 WP_003899429.1.48130 WP_003899429.1.48135 WP_003899429.1.48143 WP_003899429.1.48152 WP_003899429.1.48155 WP_003899429.1.48170 WP_003899429.1.48173 WP_003899429.1.48177 WP_003899429.1.48185 WP_003899429.1.48204 WP_003899429.1.48219 WP_003899429.1.4823 WP_003899429.1.48240 WP_003899429.1.48256 WP_003899429.1.48264 WP_003899429.1.48287 WP_003899429.1.48330 WP_003899429.1.48333 WP_003899429.1.48348 WP_003899429.1.48354 WP_003899429.1.48372 WP_003899429.1.48383 WP_003899429.1.48388 WP_003899429.1.48419 WP_003899429.1.48423 WP_003899429.1.48443 WP_003899429.1.48462 WP_003899429.1.48543 WP_003899429.1.48550 WP_003899429.1.48605 WP_003899429.1.48618 WP_003899429.1.4863 WP_003899429.1.48648 WP_003899429.1.48658 WP_003899429.1.48666 WP_003899429.1.48687 WP_003899429.1.48779 WP_003899429.1.4878 WP_003899429.1.48798 WP_003899429.1.48802 WP_003899429.1.48826 WP_003899429.1.48831 WP_003899429.1.48843 WP_003899429.1.48857 WP_003899429.1.4890 WP_003899429.1.48946 WP_003899429.1.48979 WP_003899429.1.49017 WP_003899429.1.49048 WP_003899429.1.49059 WP_003899429.1.4906 WP_003899429.1.4907 WP_003899429.1.49103 WP_003899429.1.49110 WP_003899429.1.4919 WP_003899429.1.49251 WP_003899429.1.49254 WP_003899429.1.49263 WP_003899429.1.49291 WP_003899429.1.49296 WP_003899429.1.49335 WP_003899429.1.49337 WP_003899429.1.49419 WP_003899429.1.49426 WP_003899429.1.49437 WP_003899429.1.49439 WP_003899429.1.49474 WP_003899429.1.49506 WP_003899429.1.49523 WP_003899429.1.49526 WP_003899429.1.49532 WP_003899429.1.4959 WP_003899429.1.49678 WP_003899429.1.49687 WP_003899429.1.49699 WP_003899429.1.49709 WP_003899429.1.4971 WP_003899429.1.4972 WP_003899429.1.49736 WP_003899429.1.49746 WP_003899429.1.49764 WP_003899429.1.49773 WP_003899429.1.49796 WP_003899429.1.49814 WP_003899429.1.49815 WP_003899429.1.49816 WP_003899429.1.49839 WP_003899429.1.49857 WP_003899429.1.49878 WP_003899429.1.49880 WP_003899429.1.49944 WP_003899429.1.4999 WP_003899429.1.49990 WP_003899429.1.50068 WP_003899429.1.50077 WP_003899429.1.5008 WP_003899429.1.50081 WP_003899429.1.50122 WP_003899429.1.50126 WP_003899429.1.50149 WP_003899429.1.50162 WP_003899429.1.5018 WP_003899429.1.50194 WP_003899429.1.50218 WP_003899429.1.50235 WP_003899429.1.50249 WP_003899429.1.50265 WP_003899429.1.50271 WP_003899429.1.50324 WP_003899429.1.50347 WP_003899429.1.50372 WP_003899429.1.50398 WP_003899429.1.50407 WP_003899429.1.50472 WP_003899429.1.5048 WP_003899429.1.50498 WP_003899429.1.5050 WP_003899429.1.50540 WP_003899429.1.50554 WP_003899429.1.50557 WP_003899429.1.50601 WP_003899429.1.50610 WP_003899429.1.50632 WP_003899429.1.50633 WP_003899429.1.50655 WP_003899429.1.50659 WP_003899429.1.50683 WP_003899429.1.50689 WP_003899429.1.50692 WP_003899429.1.50714 WP_003899429.1.50729 WP_003899429.1.50756 WP_003899429.1.50784 WP_003899429.1.50794 WP_003899429.1.50841 WP_003899429.1.50877 WP_003899429.1.5096 WP_003899429.1.50981 WP_003899429.1.50987 WP_003899429.1.51003 WP_003899429.1.51009 WP_003899429.1.51037 WP_003899429.1.51074 WP_003899429.1.51082 WP_003899429.1.51101 WP_003899429.1.51116 WP_003899429.1.51149 WP_003899429.1.51156 WP_003899429.1.51157 WP_003899429.1.51213 WP_003899429.1.51232 WP_003899429.1.51239 WP_003899429.1.51247 WP_003899429.1.51266 WP_003899429.1.51279 WP_003899429.1.51291 WP_003899429.1.51294 WP_003899429.1.51301 WP_003899429.1.51329 WP_003899429.1.51391 WP_003899429.1.51422 WP_003899429.1.51445 WP_003899429.1.51455 WP_003899429.1.51466 WP_003899429.1.51468 WP_003899429.1.51478 WP_003899429.1.51497 WP_003899429.1.51520 WP_003899429.1.51593 WP_003899429.1.51628 WP_003899429.1.5164 WP_003899429.1.51647 WP_003899429.1.51660 WP_003899429.1.51696 WP_003899429.1.51721 WP_003899429.1.51788 WP_003899429.1.51795 WP_003899429.1.51801 WP_003899429.1.51817 WP_003899429.1.51819 WP_003899429.1.51854 WP_003899429.1.51923 WP_003899429.1.51942 WP_003899429.1.51948 WP_003899429.1.51963 WP_003899429.1.51969 WP_003899429.1.52000 WP_003899429.1.52001 WP_003899429.1.52003 WP_003899429.1.52006 WP_003899429.1.52036 WP_003899429.1.52046 WP_003899429.1.52059 WP_003899429.1.52069 WP_003899429.1.52082 WP_003899429.1.52102 WP_003899429.1.52166 WP_003899429.1.52168 WP_003899429.1.52173 WP_003899429.1.52178 WP_003899429.1.52206 WP_003899429.1.52216 WP_003899429.1.52238 WP_003899429.1.52241 WP_003899429.1.52280 WP_003899429.1.52314 WP_003899429.1.52385 WP_003899429.1.52390 WP_003899429.1.524 WP_003899429.1.52460 WP_003899429.1.52485 WP_003899429.1.52486 WP_003899429.1.52504 WP_003899429.1.52522 WP_003899429.1.52531 WP_003899429.1.52533 WP_003899429.1.52545 WP_003899429.1.52553 WP_003899429.1.52563 WP_003899429.1.52564 WP_003899429.1.52574 WP_003899429.1.52641 WP_003899429.1.52673 WP_003899429.1.52674 WP_003899429.1.52708 WP_003899429.1.52713 WP_003899429.1.52761 WP_003899429.1.52778 WP_003899429.1.52797 WP_003899429.1.52818 WP_003899429.1.52872 WP_003899429.1.52873 WP_003899429.1.52891 WP_003899429.1.52892 WP_003899429.1.52909 WP_003899429.1.52970 WP_003899429.1.52998 WP_003899429.1.53053 WP_003899429.1.53056 WP_003899429.1.5306 WP_003899429.1.53088 WP_003899429.1.5309 WP_003899429.1.531 WP_003899429.1.53117 WP_003899429.1.53118 WP_003899429.1.53142 WP_003899429.1.53143 WP_003899429.1.53157 WP_003899429.1.53167 WP_003899429.1.53200 WP_003899429.1.53213 WP_003899429.1.53217 WP_003899429.1.53226 WP_003899429.1.53229 WP_003899429.1.53230 WP_003899429.1.53237 WP_003899429.1.53254 WP_003899429.1.53257 WP_003899429.1.5327 WP_003899429.1.53276 WP_003899429.1.53278 WP_003899429.1.533 WP_003899429.1.53306 WP_003899429.1.5334 WP_003899429.1.5335 WP_003899429.1.53353 WP_003899429.1.53381 WP_003899429.1.53413 WP_003899429.1.53458 WP_003899429.1.53460 WP_003899429.1.53480 WP_003899429.1.53517 WP_003899429.1.53522 WP_003899429.1.53525 WP_003899429.1.53526 WP_003899429.1.53553 WP_003899429.1.53606 WP_003899429.1.53628 WP_003899429.1.53643 WP_003899429.1.53667 WP_003899429.1.53679 WP_003899429.1.53715 WP_003899429.1.53730 WP_003899429.1.53742 WP_003899429.1.53743 WP_003899429.1.53754 WP_003899429.1.53775 WP_003899429.1.53787 WP_003899429.1.53803 WP_003899429.1.53818 WP_003899429.1.53853 WP_003899429.1.53865 WP_003899429.1.53888 WP_003899429.1.53900 WP_003899429.1.53912 WP_003899429.1.53914 WP_003899429.1.53952 WP_003899429.1.5398 WP_003899429.1.5408 WP_003899429.1.54089 WP_003899429.1.54093 WP_003899429.1.54099 WP_003899429.1.54112 WP_003899429.1.54125 WP_003899429.1.54141 WP_003899429.1.54162 WP_003899429.1.54179 WP_003899429.1.54206 WP_003899429.1.54218 WP_003899429.1.54225 WP_003899429.1.54227 WP_003899429.1.54232 WP_003899429.1.54241 WP_003899429.1.54245 WP_003899429.1.54247 WP_003899429.1.54260 WP_003899429.1.54275 WP_003899429.1.54280 WP_003899429.1.5429 WP_003899429.1.54294 WP_003899429.1.54314 WP_003899429.1.54351 WP_003899429.1.54370 WP_003899429.1.54428 WP_003899429.1.54449 WP_003899429.1.54514 WP_003899429.1.54519 WP_003899429.1.5452 WP_003899429.1.54531 WP_003899429.1.54537 WP_003899429.1.54553 WP_003899429.1.54555 WP_003899429.1.54575 WP_003899429.1.54633 WP_003899429.1.54686 WP_003899429.1.54687 WP_003899429.1.54705 WP_003899429.1.54730 WP_003899429.1.54732 WP_003899429.1.5475 WP_003899429.1.54797 WP_003899429.1.54807 WP_003899429.1.54836 WP_003899429.1.54838 WP_003899429.1.54860 WP_003899429.1.54888 WP_003899429.1.54897 WP_003899429.1.54905 WP_003899429.1.54909 WP_003899429.1.54937 WP_003899429.1.54939 WP_003899429.1.54944 WP_003899429.1.54945 WP_003899429.1.54953 WP_003899429.1.54964 WP_003899429.1.55015 WP_003899429.1.55022 WP_003899429.1.55023 WP_003899429.1.55051 WP_003899429.1.55072 WP_003899429.1.55088 WP_003899429.1.55106 WP_003899429.1.55126 WP_003899429.1.55128 WP_003899429.1.55140 WP_003899429.1.55150 WP_003899429.1.55210 WP_003899429.1.55227 WP_003899429.1.55248 WP_003899429.1.55257 WP_003899429.1.55258 WP_003899429.1.55267 WP_003899429.1.55279 WP_003899429.1.55307 WP_003899429.1.55326 WP_003899429.1.55328 WP_003899429.1.5533 WP_003899429.1.55345 WP_003899429.1.55396 WP_003899429.1.55398 WP_003899429.1.55441 WP_003899429.1.55459 WP_003899429.1.55501 WP_003899429.1.55578 WP_003899429.1.55626 WP_003899429.1.55641 WP_003899429.1.5569 WP_003899429.1.55723 WP_003899429.1.55735 WP_003899429.1.5574 WP_003899429.1.55772 WP_003899429.1.55802 WP_003899429.1.55819 WP_003899429.1.55821 WP_003899429.1.5583 WP_003899429.1.55849 WP_003899429.1.55856 WP_003899429.1.55860 WP_003899429.1.55882 WP_003899429.1.55883 WP_003899429.1.55894 WP_003899429.1.55902 WP_003899429.1.55908 WP_003899429.1.55909 WP_003899429.1.5591 WP_003899429.1.55961 WP_003899429.1.55977 WP_003899429.1.55983 WP_003899429.1.56028 WP_003899429.1.56057 WP_003899429.1.56060 WP_003899429.1.56107 WP_003899429.1.56132 WP_003899429.1.56163 WP_003899429.1.56167 WP_003899429.1.56178 WP_003899429.1.56287 WP_003899429.1.56292 WP_003899429.1.56327 WP_003899429.1.56341 WP_003899429.1.56359 WP_003899429.1.56365 WP_003899429.1.56394 WP_003899429.1.56443 WP_003899429.1.56473 WP_003899429.1.56478 WP_003899429.1.56500 WP_003899429.1.56517 WP_003899429.1.5656 WP_003899429.1.56577 WP_003899429.1.56593 WP_003899429.1.56625 WP_003899429.1.56637 WP_003899429.1.56670 WP_003899429.1.56697 WP_003899429.1.567 WP_003899429.1.56701 WP_003899429.1.56743 WP_003899429.1.56755 WP_003899429.1.56764 WP_003899429.1.56769 WP_003899429.1.56770 WP_003899429.1.56795 WP_003899429.1.5681 WP_003899429.1.56827 WP_003899429.1.56839 WP_003899429.1.56863 WP_003899429.1.56868 WP_003899429.1.56869 WP_003899429.1.56915 WP_003899429.1.56926 WP_003899429.1.56961 WP_003899429.1.56971 WP_003899429.1.56972 WP_003899429.1.57023 WP_003899429.1.57035 WP_003899429.1.57077 WP_003899429.1.57087 WP_003899429.1.57094 WP_003899429.1.57134 WP_003899429.1.57169 WP_003899429.1.57208 WP_003899429.1.57212 WP_003899429.1.57230 WP_003899429.1.5724 WP_003899429.1.5725 WP_003899429.1.5727 WP_003899429.1.57273 WP_003899429.1.573 WP_003899429.1.57326 WP_003899429.1.57328 WP_003899429.1.57331 WP_003899429.1.57340 WP_003899429.1.57351 WP_003899429.1.57380 WP_003899429.1.57430 WP_003899429.1.5744 WP_003899429.1.57440 WP_003899429.1.5745 WP_003899429.1.57461 WP_003899429.1.57469 WP_003899429.1.57489 WP_003899429.1.575 WP_003899429.1.57509 WP_003899429.1.57519 WP_003899429.1.57525 WP_003899429.1.57551 WP_003899429.1.57596 WP_003899429.1.57604 WP_003899429.1.57619 WP_003899429.1.57627 WP_003899429.1.57642 WP_003899429.1.57658 WP_003899429.1.57667 WP_003899429.1.57675 WP_003899429.1.57689 WP_003899429.1.57708 WP_003899429.1.57794 WP_003899429.1.57821 WP_003899429.1.57825 WP_003899429.1.57843 WP_003899429.1.57906 WP_003899429.1.57924 WP_003899429.1.57926 WP_003899429.1.57957 WP_003899429.1.57960 WP_003899429.1.57964 WP_003899429.1.57991 WP_003899429.1.58086 WP_003899429.1.58103 WP_003899429.1.58108 WP_003899429.1.5811 WP_003899429.1.58121 WP_003899429.1.58145 WP_003899429.1.58164 WP_003899429.1.58174 WP_003899429.1.582 WP_003899429.1.58209 WP_003899429.1.58215 WP_003899429.1.5824 WP_003899429.1.58250 WP_003899429.1.58259 WP_003899429.1.58283 WP_003899429.1.58288 WP_003899429.1.5830 WP_003899429.1.58303 WP_003899429.1.58311 WP_003899429.1.58330 WP_003899429.1.58359 WP_003899429.1.58386 WP_003899429.1.58393 WP_003899429.1.58431 WP_003899429.1.5844 WP_003899429.1.58457 WP_003899429.1.58488 WP_003899429.1.58518 WP_003899429.1.58559 WP_003899429.1.58567 WP_003899429.1.58573 WP_003899429.1.58602 WP_003899429.1.58612 WP_003899429.1.58619 WP_003899429.1.58630 WP_003899429.1.5865 WP_003899429.1.58690 WP_003899429.1.58702 WP_003899429.1.58743 WP_003899429.1.58754 WP_003899429.1.5879 WP_003899429.1.5881 WP_003899429.1.58824 WP_003899429.1.58848 WP_003899429.1.58857 WP_003899429.1.58891 WP_003899429.1.58892 WP_003899429.1.5890 WP_003899429.1.58904 WP_003899429.1.58921 WP_003899429.1.58930 WP_003899429.1.58953 WP_003899429.1.58961 WP_003899429.1.5898 WP_003899429.1.59025 WP_003899429.1.59029 WP_003899429.1.59037 WP_003899429.1.59044 WP_003899429.1.59085 WP_003899429.1.59088 WP_003899429.1.59112 WP_003899429.1.59130 WP_003899429.1.5914 WP_003899429.1.59147 WP_003899429.1.59166 WP_003899429.1.59205 WP_003899429.1.59209 WP_003899429.1.59237 WP_003899429.1.59240 WP_003899429.1.59253 WP_003899429.1.59254 WP_003899429.1.59262 WP_003899429.1.59270 WP_003899429.1.5928 WP_003899429.1.59304 WP_003899429.1.59305 WP_003899429.1.59309 WP_003899429.1.59326 WP_003899429.1.59328 WP_003899429.1.59333 WP_003899429.1.59338 WP_003899429.1.59428 WP_003899429.1.59487 WP_003899429.1.59537 WP_003899429.1.59561 WP_003899429.1.59677 WP_003899429.1.59722 WP_003899429.1.59727 WP_003899429.1.59732 WP_003899429.1.59738 WP_003899429.1.59750 WP_003899429.1.59757 WP_003899429.1.59761 WP_003899429.1.59808 WP_003899429.1.59850 WP_003899429.1.59860 WP_003899429.1.59861 WP_003899429.1.5987 WP_003899429.1.59878 WP_003899429.1.59888 WP_003899429.1.59952 WP_003899429.1.5996 WP_003899429.1.59961 WP_003899429.1.59974 WP_003899429.1.6000 WP_003899429.1.6003 WP_003899429.1.60047 WP_003899429.1.60121 WP_003899429.1.60125 WP_003899429.1.60135 WP_003899429.1.60139 WP_003899429.1.60152 WP_003899429.1.60171 WP_003899429.1.60197 WP_003899429.1.6020 WP_003899429.1.60205 WP_003899429.1.60207 WP_003899429.1.60215 WP_003899429.1.60217 WP_003899429.1.60267 WP_003899429.1.60288 WP_003899429.1.60291 WP_003899429.1.60301 WP_003899429.1.60305 WP_003899429.1.60312 WP_003899429.1.60313 WP_003899429.1.60314 WP_003899429.1.60367 WP_003899429.1.60376 WP_003899429.1.60403 WP_003899429.1.60413 WP_003899429.1.60421 WP_003899429.1.60451 WP_003899429.1.60460 WP_003899429.1.60487 WP_003899429.1.60512 WP_003899429.1.60573 WP_003899429.1.60583 WP_003899429.1.60632 WP_003899429.1.60657 WP_003899429.1.60687 WP_003899429.1.60689 WP_003899429.1.60727 WP_003899429.1.60738 WP_003899429.1.60763 WP_003899429.1.6077 WP_003899429.1.60791 WP_003899429.1.60834 WP_003899429.1.60878 WP_003899429.1.60879 WP_003899429.1.60913 WP_003899429.1.60978 WP_003899429.1.61000 WP_003899429.1.61001 WP_003899429.1.61012 WP_003899429.1.61014 WP_003899429.1.61015 WP_003899429.1.61037 WP_003899429.1.61052 WP_003899429.1.61065 WP_003899429.1.61100 WP_003899429.1.61101 WP_003899429.1.61138 WP_003899429.1.61198 WP_003899429.1.61234 WP_003899429.1.61281 WP_003899429.1.61314 WP_003899429.1.61321 WP_003899429.1.61326 WP_003899429.1.61328 WP_003899429.1.61368 WP_003899429.1.61391 WP_003899429.1.61406 WP_003899429.1.61409 WP_003899429.1.61420 WP_003899429.1.61422 WP_003899429.1.61425 WP_003899429.1.61428 WP_003899429.1.61469 WP_003899429.1.61522 WP_003899429.1.61552 WP_003899429.1.61557 WP_003899429.1.61567 WP_003899429.1.61571 WP_003899429.1.61573 WP_003899429.1.61584 WP_003899429.1.61586 WP_003899429.1.6159 WP_003899429.1.61592 WP_003899429.1.6160 WP_003899429.1.61614 WP_003899429.1.6163 WP_003899429.1.61655 WP_003899429.1.61665 WP_003899429.1.61669 WP_003899429.1.61682 WP_003899429.1.61692 WP_003899429.1.61719 WP_003899429.1.61728 WP_003899429.1.61750 WP_003899429.1.61754 WP_003899429.1.61755 WP_003899429.1.61757 WP_003899429.1.6179 WP_003899429.1.61816 WP_003899429.1.61842 WP_003899429.1.61850 WP_003899429.1.61862 WP_003899429.1.61865 WP_003899429.1.61868 WP_003899429.1.61911 WP_003899429.1.61941 WP_003899429.1.61953 WP_003899429.1.61986 WP_003899429.1.61987 WP_003899429.1.61998 WP_003899429.1.62021 WP_003899429.1.62087 WP_003899429.1.62089 WP_003899429.1.62101 WP_003899429.1.62104 WP_003899429.1.6211 WP_003899429.1.62132 WP_003899429.1.62162 WP_003899429.1.62225 WP_003899429.1.62230 WP_003899429.1.62238 WP_003899429.1.62249 WP_003899429.1.62270 WP_003899429.1.62281 WP_003899429.1.62307 WP_003899429.1.6231 WP_003899429.1.62359 WP_003899429.1.62371 WP_003899429.1.62379 WP_003899429.1.62395 WP_003899429.1.62449 WP_003899429.1.62468 WP_003899429.1.6248 WP_003899429.1.62508 WP_003899429.1.62565 WP_003899429.1.62594 WP_003899429.1.62606 WP_003899429.1.62616 WP_003899429.1.62666 WP_003899429.1.62687 WP_003899429.1.62715 WP_003899429.1.62730 WP_003899429.1.62738 WP_003899429.1.62761 WP_003899429.1.62766 WP_003899429.1.62813 WP_003899429.1.62839 WP_003899429.1.62841 WP_003899429.1.62909 WP_003899429.1.62936 WP_003899429.1.6294 WP_003899429.1.6295 WP_003899429.1.62962 WP_003899429.1.63007 WP_003899429.1.63019 WP_003899429.1.63032 WP_003899429.1.63037 WP_003899429.1.63064 WP_003899429.1.63066 WP_003899429.1.63072 WP_003899429.1.6308 WP_003899429.1.63081 WP_003899429.1.63096 WP_003899429.1.63106 WP_003899429.1.63144 WP_003899429.1.63160 WP_003899429.1.63161 WP_003899429.1.63175 WP_003899429.1.63194 WP_003899429.1.63222 WP_003899429.1.6328 WP_003899429.1.63291 WP_003899429.1.63312 WP_003899429.1.63317 WP_003899429.1.63331 WP_003899429.1.63373 WP_003899429.1.63384 WP_003899429.1.63403 WP_003899429.1.63424 WP_003899429.1.63428 WP_003899429.1.6345 WP_003899429.1.63464 WP_003899429.1.63483 WP_003899429.1.63502 WP_003899429.1.63504 WP_003899429.1.63522 WP_003899429.1.63530 WP_003899429.1.63564 WP_003899429.1.63567 WP_003899429.1.63600 WP_003899429.1.63623 WP_003899429.1.63624 WP_003899429.1.63625 WP_003899429.1.63627 WP_003899429.1.63654 WP_003899429.1.63662 WP_003899429.1.63711 WP_003899429.1.63734 WP_003899429.1.63807 WP_003899429.1.63819 WP_003899429.1.63844 WP_003899429.1.63888 WP_003899429.1.63913 WP_003899429.1.63915 WP_003899429.1.63918 WP_003899429.1.63961 WP_003899429.1.63970 WP_003899429.1.64000 WP_003899429.1.64027 WP_003899429.1.64058 WP_003899429.1.64065 WP_003899429.1.6407 WP_003899429.1.64082 WP_003899429.1.64091 WP_003899429.1.64102 WP_003899429.1.64104 WP_003899429.1.64169 WP_003899429.1.64219 WP_003899429.1.6422 WP_003899429.1.64222 WP_003899429.1.64228 WP_003899429.1.64235 WP_003899429.1.64249 WP_003899429.1.6427 WP_003899429.1.64278 WP_003899429.1.64287 WP_003899429.1.64414 WP_003899429.1.64419 WP_003899429.1.6443 WP_003899429.1.64463 WP_003899429.1.64480 WP_003899429.1.64497 WP_003899429.1.64506 WP_003899429.1.64511 WP_003899429.1.64513 WP_003899429.1.64515 WP_003899429.1.64522 WP_003899429.1.64526 WP_003899429.1.64543 WP_003899429.1.6456 WP_003899429.1.64567 WP_003899429.1.64588 WP_003899429.1.64589 WP_003899429.1.64594 WP_003899429.1.64595 WP_003899429.1.64608 WP_003899429.1.64619 WP_003899429.1.64629 WP_003899429.1.6464 WP_003899429.1.64664 WP_003899429.1.64669 WP_003899429.1.64672 WP_003899429.1.64680 WP_003899429.1.64682 WP_003899429.1.64727 WP_003899429.1.64729 WP_003899429.1.64776 WP_003899429.1.64832 WP_003899429.1.6486 WP_003899429.1.64870 WP_003899429.1.64898 WP_003899429.1.64922 WP_003899429.1.64924 WP_003899429.1.6493 WP_003899429.1.64941 WP_003899429.1.64973 WP_003899429.1.65001 WP_003899429.1.65026 WP_003899429.1.65053 WP_003899429.1.65070 WP_003899429.1.65079 WP_003899429.1.65102 WP_003899429.1.65157 WP_003899429.1.65181 WP_003899429.1.65212 WP_003899429.1.65229 WP_003899429.1.6523 WP_003899429.1.65253 WP_003899429.1.65289 WP_003899429.1.65291 WP_003899429.1.65315 WP_003899429.1.65329 WP_003899429.1.65359 WP_003899429.1.6536 WP_003899429.1.65374 WP_003899429.1.65386 WP_003899429.1.65414 WP_003899429.1.65416 WP_003899429.1.65433 WP_003899429.1.65455 WP_003899429.1.65467 WP_003899429.1.65488 WP_003899429.1.65529 WP_003899429.1.65539 WP_003899429.1.65583 WP_003899429.1.65612 WP_003899429.1.65623 WP_003899429.1.65635 WP_003899429.1.65637 WP_003899429.1.65648 WP_003899429.1.65683 WP_003899429.1.65686 WP_003899429.1.65688 WP_003899429.1.65707 WP_003899429.1.65733 WP_003899429.1.65746 WP_003899429.1.65747 WP_003899429.1.65759 WP_003899429.1.65816 WP_003899429.1.65830 WP_003899429.1.65858 WP_003899429.1.65862 WP_003899429.1.65869 WP_003899429.1.65893 WP_003899429.1.65929 WP_003899429.1.65932 WP_003899429.1.65958 WP_003899429.1.65974 WP_003899429.1.66004 WP_003899429.1.6606 WP_003899429.1.66089 WP_003899429.1.66149 WP_003899429.1.66151 WP_003899429.1.66276 WP_003899429.1.66293 WP_003899429.1.66297 WP_003899429.1.66323 WP_003899429.1.66325 WP_003899429.1.6633 WP_003899429.1.66334 WP_003899429.1.66355 WP_003899429.1.66367 WP_003899429.1.66394 WP_003899429.1.66396 WP_003899429.1.66451 WP_003899429.1.66455 WP_003899429.1.66457 WP_003899429.1.66464 WP_003899429.1.66466 WP_003899429.1.66487 WP_003899429.1.66504 WP_003899429.1.66544 WP_003899429.1.66558 WP_003899429.1.66580 WP_003899429.1.66582 WP_003899429.1.66612 WP_003899429.1.66617 WP_003899429.1.66635 WP_003899429.1.66656 WP_003899429.1.66663 WP_003899429.1.66675 WP_003899429.1.66715 WP_003899429.1.66718 WP_003899429.1.66762 WP_003899429.1.66776 WP_003899429.1.66808 WP_003899429.1.66817 WP_003899429.1.66819 WP_003899429.1.66826 WP_003899429.1.66830 WP_003899429.1.66842 WP_003899429.1.66868 WP_003899429.1.66878 WP_003899429.1.66880 WP_003899429.1.66893 WP_003899429.1.66961 WP_003899429.1.67005 WP_003899429.1.6704 WP_003899429.1.67044 WP_003899429.1.67061 WP_003899429.1.67089 WP_003899429.1.67098 WP_003899429.1.67146 WP_003899429.1.67197 WP_003899429.1.67198 WP_003899429.1.6720 WP_003899429.1.67207 WP_003899429.1.67218 WP_003899429.1.67220 WP_003899429.1.67225 WP_003899429.1.67231 WP_003899429.1.6724 WP_003899429.1.67257 WP_003899429.1.67298 WP_003899429.1.67307 WP_003899429.1.67324 WP_003899429.1.67332 WP_003899429.1.67346 WP_003899429.1.67360 WP_003899429.1.67381 WP_003899429.1.67396 WP_003899429.1.67417 WP_003899429.1.67422 WP_003899429.1.67453 WP_003899429.1.67459 WP_003899429.1.6746 WP_003899429.1.67473 WP_003899429.1.67482 WP_003899429.1.67496 WP_003899429.1.67499 WP_003899429.1.67523 WP_003899429.1.67536 WP_003899429.1.67575 WP_003899429.1.67587 WP_003899429.1.67598 WP_003899429.1.67600 WP_003899429.1.67602 WP_003899429.1.67630 WP_003899429.1.67679 WP_003899429.1.67692 WP_003899429.1.67744 WP_003899429.1.6775 WP_003899429.1.6777 WP_003899429.1.67809 WP_003899429.1.67816 WP_003899429.1.67844 WP_003899429.1.67848 WP_003899429.1.67870 WP_003899429.1.67888 WP_003899429.1.67915 WP_003899429.1.67945 WP_003899429.1.67949 WP_003899429.1.67980 WP_003899429.1.67982 WP_003899429.1.68022 WP_003899429.1.68029 WP_003899429.1.68037 WP_003899429.1.68038 WP_003899429.1.68045 WP_003899429.1.68057 WP_003899429.1.68083 WP_003899429.1.68088 WP_003899429.1.68106 WP_003899429.1.68110 WP_003899429.1.68153 WP_003899429.1.68169 WP_003899429.1.68193 WP_003899429.1.68212 WP_003899429.1.68227 WP_003899429.1.68243 WP_003899429.1.6825 WP_003899429.1.68297 WP_003899429.1.68309 WP_003899429.1.68325 WP_003899429.1.68329 WP_003899429.1.68340 WP_003899429.1.68384 WP_003899429.1.68388 WP_003899429.1.68429 WP_003899429.1.6843 WP_003899429.1.68433 WP_003899429.1.68444 WP_003899429.1.68465 WP_003899429.1.68518 WP_003899429.1.68569 WP_003899429.1.68576 WP_003899429.1.68580 WP_003899429.1.68586 WP_003899429.1.68623 WP_003899429.1.68637 WP_003899429.1.68646 WP_003899429.1.68667 WP_003899429.1.68669 WP_003899429.1.68672 WP_003899429.1.68684 WP_003899429.1.68704 WP_003899429.1.68708 WP_003899429.1.6872 WP_003899429.1.68730 WP_003899429.1.68734 WP_003899429.1.68748 WP_003899429.1.68754 WP_003899429.1.6876 WP_003899429.1.68761 WP_003899429.1.68763 WP_003899429.1.68766 WP_003899429.1.68774 WP_003899429.1.68796 WP_003899429.1.68824 WP_003899429.1.68832 WP_003899429.1.68833 WP_003899429.1.68841 WP_003899429.1.68859 WP_003899429.1.68876 WP_003899429.1.68906 WP_003899429.1.68916 WP_003899429.1.68923 WP_003899429.1.68945 WP_003899429.1.6896 WP_003899429.1.68981 WP_003899429.1.68984 WP_003899429.1.68997 WP_003899429.1.69076 WP_003899429.1.69079 WP_003899429.1.6908 WP_003899429.1.69082 WP_003899429.1.69178 WP_003899429.1.69208 WP_003899429.1.69231 WP_003899429.1.69256 WP_003899429.1.69311 WP_003899429.1.69315 WP_003899429.1.69322 WP_003899429.1.69342 WP_003899429.1.6936 WP_003899429.1.69369 WP_003899429.1.69374 WP_003899429.1.69398 WP_003899429.1.69401 WP_003899429.1.69426 WP_003899429.1.69427 WP_003899429.1.69429 WP_003899429.1.6949 WP_003899429.1.6951 WP_003899429.1.69511 WP_003899429.1.69526 WP_003899429.1.69528 WP_003899429.1.69547 WP_003899429.1.69573 WP_003899429.1.69581 WP_003899429.1.6960 WP_003899429.1.69617 WP_003899429.1.69634 WP_003899429.1.69647 WP_003899429.1.69659 WP_003899429.1.69673 WP_003899429.1.69682 WP_003899429.1.69684 WP_003899429.1.69686 WP_003899429.1.69707 WP_003899429.1.69709 WP_003899429.1.69723 WP_003899429.1.69736 WP_003899429.1.69778 WP_003899429.1.69800 WP_003899429.1.69802 WP_003899429.1.69845 WP_003899429.1.69870 WP_003899429.1.69873 WP_003899429.1.69898 WP_003899429.1.69913 WP_003899429.1.69931 WP_003899429.1.69938 WP_003899429.1.69955 WP_003899429.1.69957 WP_003899429.1.69981 WP_003899429.1.69990 WP_003899429.1.70 WP_003899429.1.70000 WP_003899429.1.70017 WP_003899429.1.70032 WP_003899429.1.70055 WP_003899429.1.70062 WP_003899429.1.70072 WP_003899429.1.70131 WP_003899429.1.70132 WP_003899429.1.7022 WP_003899429.1.70227 WP_003899429.1.70255 WP_003899429.1.70271 WP_003899429.1.70274 WP_003899429.1.7029 WP_003899429.1.70325 WP_003899429.1.70328 WP_003899429.1.70356 WP_003899429.1.70368 WP_003899429.1.70369 WP_003899429.1.70418 WP_003899429.1.70422 WP_003899429.1.70435 WP_003899429.1.70444 WP_003899429.1.70463 WP_003899429.1.70471 WP_003899429.1.70480 WP_003899429.1.70494 WP_003899429.1.70498 WP_003899429.1.70525 WP_003899429.1.70573 WP_003899429.1.70577 WP_003899429.1.70610 WP_003899429.1.70615 WP_003899429.1.70618 WP_003899429.1.70622 WP_003899429.1.70626 WP_003899429.1.70668 WP_003899429.1.70699 WP_003899429.1.70704 WP_003899429.1.70729 WP_003899429.1.70757 WP_003899429.1.70782 WP_003899429.1.70796 WP_003899429.1.70830 WP_003899429.1.70834 WP_003899429.1.7084 WP_003899429.1.70840 WP_003899429.1.70864 WP_003899429.1.70871 WP_003899429.1.70915 WP_003899429.1.70958 WP_003899429.1.70964 WP_003899429.1.70976 WP_003899429.1.71015 WP_003899429.1.71063 WP_003899429.1.71076 WP_003899429.1.71083 WP_003899429.1.7111 WP_003899429.1.71118 WP_003899429.1.7113 WP_003899429.1.71187 WP_003899429.1.71191 WP_003899429.1.71255 WP_003899429.1.71258 WP_003899429.1.71259 WP_003899429.1.71289 WP_003899429.1.71326 WP_003899429.1.71329 WP_003899429.1.71331 WP_003899429.1.71344 WP_003899429.1.71390 WP_003899429.1.71414 WP_003899429.1.71457 WP_003899429.1.71464 WP_003899429.1.71490 WP_003899429.1.71492 WP_003899429.1.71509 WP_003899429.1.71516 WP_003899429.1.71517 WP_003899429.1.71527 WP_003899429.1.71532 WP_003899429.1.71545 WP_003899429.1.71546 WP_003899429.1.71569 WP_003899429.1.71604 WP_003899429.1.71630 WP_003899429.1.71638 WP_003899429.1.71654 WP_003899429.1.71664 WP_003899429.1.71665 WP_003899429.1.71683 WP_003899429.1.71701 WP_003899429.1.71718 WP_003899429.1.71731 WP_003899429.1.71778 WP_003899429.1.71781 WP_003899429.1.71803 WP_003899429.1.71847 WP_003899429.1.7185 WP_003899429.1.71851 WP_003899429.1.71871 WP_003899429.1.71909 WP_003899429.1.71957 WP_003899429.1.71970 WP_003899429.1.72047 WP_003899429.1.72061 WP_003899429.1.72062 WP_003899429.1.72072 WP_003899429.1.72111 WP_003899429.1.72122 WP_003899429.1.72143 WP_003899429.1.72168 WP_003899429.1.72179 WP_003899429.1.72209 WP_003899429.1.72227 WP_003899429.1.7224 WP_003899429.1.72268 WP_003899429.1.72332 WP_003899429.1.72380 WP_003899429.1.72401 WP_003899429.1.72405 WP_003899429.1.72420 WP_003899429.1.72441 WP_003899429.1.72451 WP_003899429.1.72452 WP_003899429.1.72457 WP_003899429.1.72459 WP_003899429.1.72460 WP_003899429.1.72466 WP_003899429.1.72487 WP_003899429.1.72488 WP_003899429.1.72492 WP_003899429.1.72506 WP_003899429.1.72543 WP_003899429.1.7256 WP_003899429.1.72576 WP_003899429.1.72578 WP_003899429.1.72585 WP_003899429.1.72591 WP_003899429.1.72592 WP_003899429.1.72640 WP_003899429.1.72661 WP_003899429.1.72739 WP_003899429.1.72744 WP_003899429.1.72755 WP_003899429.1.72759 WP_003899429.1.72784 WP_003899429.1.72826 WP_003899429.1.72831 WP_003899429.1.72852 WP_003899429.1.72853 WP_003899429.1.72879 WP_003899429.1.72880 WP_003899429.1.72938 WP_003899429.1.72954 WP_003899429.1.72957 WP_003899429.1.72959 WP_003899429.1.72982 WP_003899429.1.72988 WP_003899429.1.72993 WP_003899429.1.73006 WP_003899429.1.73013 WP_003899429.1.73025 WP_003899429.1.73028 WP_003899429.1.73042 WP_003899429.1.73045 WP_003899429.1.73092 WP_003899429.1.73118 WP_003899429.1.7312 WP_003899429.1.73127 WP_003899429.1.73134 WP_003899429.1.73154 WP_003899429.1.73163 WP_003899429.1.73182 WP_003899429.1.73205 WP_003899429.1.7321 WP_003899429.1.73310 WP_003899429.1.73365 WP_003899429.1.73391 WP_003899429.1.73404 WP_003899429.1.73424 WP_003899429.1.73436 WP_003899429.1.73445 WP_003899429.1.73453 WP_003899429.1.73465 WP_003899429.1.73466 WP_003899429.1.73470 WP_003899429.1.73478 WP_003899429.1.73482 WP_003899429.1.73507 WP_003899429.1.73532 WP_003899429.1.73550 WP_003899429.1.73564 WP_003899429.1.73623 WP_003899429.1.73629 WP_003899429.1.73644 WP_003899429.1.7366 WP_003899429.1.73661 WP_003899429.1.7368 WP_003899429.1.73688 WP_003899429.1.73723 WP_003899429.1.73744 WP_003899429.1.73750 WP_003899429.1.73760 WP_003899429.1.73774 WP_003899429.1.7379 WP_003899429.1.73813 WP_003899429.1.73840 WP_003899429.1.73876 WP_003899429.1.7389 WP_003899429.1.74016 WP_003899429.1.74039 WP_003899429.1.74083 WP_003899429.1.74101 WP_003899429.1.74107 WP_003899429.1.74129 WP_003899429.1.74144 WP_003899429.1.7417 WP_003899429.1.74190 WP_003899429.1.74210 WP_003899429.1.7423 WP_003899429.1.74259 WP_003899429.1.74262 WP_003899429.1.74269 WP_003899429.1.74282 WP_003899429.1.74291 WP_003899429.1.74296 WP_003899429.1.74304 WP_003899429.1.7432 WP_003899429.1.74347 WP_003899429.1.7436 WP_003899429.1.74378 WP_003899429.1.74382 WP_003899429.1.74395 WP_003899429.1.74400 WP_003899429.1.74432 WP_003899429.1.74442 WP_003899429.1.74487 WP_003899429.1.74499 WP_003899429.1.74504 WP_003899429.1.74511 WP_003899429.1.74523 WP_003899429.1.74525 WP_003899429.1.74551 WP_003899429.1.74555 WP_003899429.1.74628 WP_003899429.1.74641 WP_003899429.1.74653 WP_003899429.1.74660 WP_003899429.1.74683 WP_003899429.1.7469 WP_003899429.1.74725 WP_003899429.1.74760 WP_003899429.1.74809 WP_003899429.1.74820 WP_003899429.1.74870 WP_003899429.1.74881 WP_003899429.1.74888 WP_003899429.1.74952 WP_003899429.1.7496 WP_003899429.1.74988 WP_003899429.1.75043 WP_003899429.1.75055 WP_003899429.1.75078 WP_003899429.1.75081 WP_003899429.1.75120 WP_003899429.1.75163 WP_003899429.1.75188 WP_003899429.1.75200 WP_003899429.1.75202 WP_003899429.1.75234 WP_003899429.1.75239 WP_003899429.1.75263 WP_003899429.1.75342 WP_003899429.1.7535 WP_003899429.1.75376 WP_003899429.1.75391 WP_003899429.1.75395 WP_003899429.1.75441 WP_003899429.1.75510 WP_003899429.1.75581 WP_003899429.1.75598 WP_003899429.1.75635 WP_003899429.1.75665 WP_003899429.1.75671 WP_003899429.1.75741 WP_003899429.1.75749 WP_003899429.1.75772 WP_003899429.1.75774 WP_003899429.1.75833 WP_003899429.1.7585 WP_003899429.1.75864 WP_003899429.1.75868 WP_003899429.1.75878 WP_003899429.1.75927 WP_003899429.1.75946 WP_003899429.1.75968 WP_003899429.1.75974 WP_003899429.1.76016 WP_003899429.1.76032 WP_003899429.1.76037 WP_003899429.1.7604 WP_003899429.1.76045 WP_003899429.1.76052 WP_003899429.1.76058 WP_003899429.1.76064 WP_003899429.1.76110 WP_003899429.1.76126 WP_003899429.1.76133 WP_003899429.1.76138 WP_003899429.1.76157 WP_003899429.1.76172 WP_003899429.1.76177 WP_003899429.1.76183 WP_003899429.1.76209 WP_003899429.1.76272 WP_003899429.1.76277 WP_003899429.1.76281 WP_003899429.1.76291 WP_003899429.1.76297 WP_003899429.1.76360 WP_003899429.1.76379 WP_003899429.1.76403 WP_003899429.1.76413 WP_003899429.1.76414 WP_003899429.1.76427 WP_003899429.1.76436 WP_003899429.1.76442 WP_003899429.1.76443 WP_003899429.1.76456 WP_003899429.1.76616 WP_003899429.1.76625 WP_003899429.1.76629 WP_003899429.1.76635 WP_003899429.1.76638 WP_003899429.1.76640 WP_003899429.1.76644 WP_003899429.1.76677 WP_003899429.1.76678 WP_003899429.1.76679 WP_003899429.1.76734 WP_003899429.1.76744 WP_003899429.1.76750 WP_003899429.1.76754 WP_003899429.1.76757 WP_003899429.1.76781 WP_003899429.1.76818 WP_003899429.1.76824 WP_003899429.1.76835 WP_003899429.1.76873 WP_003899429.1.76888 WP_003899429.1.76900 WP_003899429.1.7691 WP_003899429.1.76947 WP_003899429.1.76954 WP_003899429.1.76955 WP_003899429.1.76963 WP_003899429.1.770 WP_003899429.1.77000 WP_003899429.1.77008 WP_003899429.1.77021 WP_003899429.1.77056 WP_003899429.1.77065 WP_003899429.1.77075 WP_003899429.1.77107 WP_003899429.1.77115 WP_003899429.1.77118 WP_003899429.1.77125 WP_003899429.1.77141 WP_003899429.1.77142 WP_003899429.1.77250 WP_003899429.1.77260 WP_003899429.1.77266 WP_003899429.1.77285 WP_003899429.1.77312 WP_003899429.1.77348 WP_003899429.1.77351 WP_003899429.1.77352 WP_003899429.1.77361 WP_003899429.1.774 WP_003899429.1.77404 WP_003899429.1.77425 WP_003899429.1.77463 WP_003899429.1.77474 WP_003899429.1.7748 WP_003899429.1.77484 WP_003899429.1.77491 WP_003899429.1.77499 WP_003899429.1.77510 WP_003899429.1.77530 WP_003899429.1.77554 WP_003899429.1.77559 WP_003899429.1.77599 WP_003899429.1.7762 WP_003899429.1.77627 WP_003899429.1.77649 WP_003899429.1.77654 WP_003899429.1.7766 WP_003899429.1.77667 WP_003899429.1.77704 WP_003899429.1.77706 WP_003899429.1.77774 WP_003899429.1.7778 WP_003899429.1.77790 WP_003899429.1.77809 WP_003899429.1.77820 WP_003899429.1.77843 WP_003899429.1.77855 WP_003899429.1.77865 WP_003899429.1.77868 WP_003899429.1.77890 WP_003899429.1.77909 WP_003899429.1.77911 WP_003899429.1.77931 WP_003899429.1.77984 WP_003899429.1.78020 WP_003899429.1.78024 WP_003899429.1.78075 WP_003899429.1.78086 WP_003899429.1.7809 WP_003899429.1.78098 WP_003899429.1.78105 WP_003899429.1.78113 WP_003899429.1.78136 WP_003899429.1.78162 WP_003899429.1.7817 WP_003899429.1.78200 WP_003899429.1.78216 WP_003899429.1.78236 WP_003899429.1.78238 WP_003899429.1.78322 WP_003899429.1.78338 WP_003899429.1.7836 WP_003899429.1.78386 WP_003899429.1.78435 WP_003899429.1.7844 WP_003899429.1.78459 WP_003899429.1.78488 WP_003899429.1.7849 WP_003899429.1.78499 WP_003899429.1.785 WP_003899429.1.78516 WP_003899429.1.78524 WP_003899429.1.78526 WP_003899429.1.78538 WP_003899429.1.78545 WP_003899429.1.78547 WP_003899429.1.78574 WP_003899429.1.78580 WP_003899429.1.7860 WP_003899429.1.78620 WP_003899429.1.78646 WP_003899429.1.78648 WP_003899429.1.78649 WP_003899429.1.78655 WP_003899429.1.78657 WP_003899429.1.78659 WP_003899429.1.7869 WP_003899429.1.78692 WP_003899429.1.78760 WP_003899429.1.78766 WP_003899429.1.78776 WP_003899429.1.78778 WP_003899429.1.78784 WP_003899429.1.78788 WP_003899429.1.78790 WP_003899429.1.78860 WP_003899429.1.7887 WP_003899429.1.78884 WP_003899429.1.78932 WP_003899429.1.78969 WP_003899429.1.78977 WP_003899429.1.78980 WP_003899429.1.79005 WP_003899429.1.79016 WP_003899429.1.79033 WP_003899429.1.79064 WP_003899429.1.79066 WP_003899429.1.79068 WP_003899429.1.79095 WP_003899429.1.79112 WP_003899429.1.79122 WP_003899429.1.79145 WP_003899429.1.79152 WP_003899429.1.79163 WP_003899429.1.79182 WP_003899429.1.79213 WP_003899429.1.79218 WP_003899429.1.79268 WP_003899429.1.79278 WP_003899429.1.79290 WP_003899429.1.79319 WP_003899429.1.79325 WP_003899429.1.79326 WP_003899429.1.7933 WP_003899429.1.79330 WP_003899429.1.79339 WP_003899429.1.79394 WP_003899429.1.79399 WP_003899429.1.79413 WP_003899429.1.79422 WP_003899429.1.79445 WP_003899429.1.79447 WP_003899429.1.79455 WP_003899429.1.79471 WP_003899429.1.79480 WP_003899429.1.79482 WP_003899429.1.79488 WP_003899429.1.79500 WP_003899429.1.79502 WP_003899429.1.79508 WP_003899429.1.79514 WP_003899429.1.79561 WP_003899429.1.79565 WP_003899429.1.79578 WP_003899429.1.79588 WP_003899429.1.79598 WP_003899429.1.79615 WP_003899429.1.79684 WP_003899429.1.79698 WP_003899429.1.797 WP_003899429.1.79744 WP_003899429.1.79784 WP_003899429.1.79806 WP_003899429.1.79819 WP_003899429.1.79826 WP_003899429.1.79828 WP_003899429.1.79851 WP_003899429.1.79853 WP_003899429.1.79863 WP_003899429.1.79881 WP_003899429.1.79885 WP_003899429.1.79898 WP_003899429.1.7990 WP_003899429.1.79900 WP_003899429.1.79913 WP_003899429.1.79918 WP_003899429.1.79947 WP_003899429.1.79948 WP_003899429.1.7995 WP_003899429.1.7997 WP_003899429.1.80022 WP_003899429.1.80030 WP_003899429.1.80054 WP_003899429.1.80084 WP_003899429.1.80099 WP_003899429.1.80129 WP_003899429.1.80177 WP_003899429.1.80234 WP_003899429.1.8026 WP_003899429.1.80275 WP_003899429.1.8029 WP_003899429.1.80299 WP_003899429.1.80304 WP_003899429.1.80326 WP_003899429.1.8037 WP_003899429.1.80370 WP_003899429.1.80387 WP_003899429.1.8044 WP_003899429.1.80451 WP_003899429.1.80458 WP_003899429.1.80461 WP_003899429.1.80490 WP_003899429.1.80503 WP_003899429.1.80507 WP_003899429.1.80552 WP_003899429.1.80576 WP_003899429.1.80588 WP_003899429.1.80599 WP_003899429.1.8060 WP_003899429.1.80624 WP_003899429.1.80636 WP_003899429.1.80673 WP_003899429.1.80711 WP_003899429.1.80714 WP_003899429.1.80743 WP_003899429.1.80784 WP_003899429.1.80815 WP_003899429.1.80853 WP_003899429.1.80918 WP_003899429.1.8093 WP_003899429.1.80967 WP_003899429.1.8097 WP_003899429.1.80988 WP_003899429.1.81007 WP_003899429.1.81013 WP_003899429.1.8105 WP_003899429.1.81059 WP_003899429.1.81063 WP_003899429.1.81066 WP_003899429.1.81075 WP_003899429.1.81091 WP_003899429.1.81119 WP_003899429.1.81125 WP_003899429.1.81136 WP_003899429.1.8114 WP_003899429.1.81189 WP_003899429.1.81192 WP_003899429.1.812 WP_003899429.1.81230 WP_003899429.1.81249 WP_003899429.1.81250 WP_003899429.1.81264 WP_003899429.1.8128 WP_003899429.1.81287 WP_003899429.1.81297 WP_003899429.1.8138 WP_003899429.1.81407 WP_003899429.1.8143 WP_003899429.1.81439 WP_003899429.1.81465 WP_003899429.1.81529 WP_003899429.1.81538 WP_003899429.1.81541 WP_003899429.1.81560 WP_003899429.1.81561 WP_003899429.1.81567 WP_003899429.1.81583 WP_003899429.1.81686 WP_003899429.1.81712 WP_003899429.1.81720 WP_003899429.1.81731 WP_003899429.1.81774 WP_003899429.1.81788 WP_003899429.1.81820 WP_003899429.1.81850 WP_003899429.1.81883 WP_003899429.1.81891 WP_003899429.1.81911 WP_003899429.1.81918 WP_003899429.1.82011 WP_003899429.1.82048 WP_003899429.1.82069 WP_003899429.1.82071 WP_003899429.1.82108 WP_003899429.1.82136 WP_003899429.1.82142 WP_003899429.1.8215 WP_003899429.1.82158 WP_003899429.1.82209 WP_003899429.1.82210 WP_003899429.1.82228 WP_003899429.1.82236 WP_003899429.1.82251 WP_003899429.1.82271 WP_003899429.1.82305 WP_003899429.1.82307 WP_003899429.1.82317 WP_003899429.1.8232 WP_003899429.1.82346 WP_003899429.1.82374 WP_003899429.1.82385 WP_003899429.1.82429 WP_003899429.1.82460 WP_003899429.1.82483 WP_003899429.1.82494 WP_003899429.1.82531 WP_003899429.1.82546 WP_003899429.1.82547 WP_003899429.1.82549 WP_003899429.1.82577 WP_003899429.1.82592 WP_003899429.1.82597 WP_003899429.1.82598 WP_003899429.1.82625 WP_003899429.1.82642 WP_003899429.1.82651 WP_003899429.1.82653 WP_003899429.1.82681 WP_003899429.1.82685 WP_003899429.1.8271 WP_003899429.1.82712 WP_003899429.1.8273 WP_003899429.1.82743 WP_003899429.1.82757 WP_003899429.1.82774 WP_003899429.1.82803 WP_003899429.1.82860 WP_003899429.1.82871 WP_003899429.1.82892 WP_003899429.1.82935 WP_003899429.1.82957 WP_003899429.1.82981 WP_003899429.1.82983 WP_003899429.1.83004 WP_003899429.1.83009 WP_003899429.1.83044 WP_003899429.1.83065 WP_003899429.1.83074 WP_003899429.1.83146 WP_003899429.1.83149 WP_003899429.1.83159 WP_003899429.1.8317 WP_003899429.1.83173 WP_003899429.1.83181 WP_003899429.1.83182 WP_003899429.1.83191 WP_003899429.1.83197 WP_003899429.1.83212 WP_003899429.1.8326 WP_003899429.1.83262 WP_003899429.1.83273 WP_003899429.1.83309 WP_003899429.1.83332 WP_003899429.1.83334 WP_003899429.1.83341 WP_003899429.1.83349 WP_003899429.1.8335 WP_003899429.1.83353 WP_003899429.1.83367 WP_003899429.1.83380 WP_003899429.1.83381 WP_003899429.1.83389 WP_003899429.1.83408 WP_003899429.1.83409 WP_003899429.1.83435 WP_003899429.1.83470 WP_003899429.1.83524 WP_003899429.1.83526 WP_003899429.1.8358 WP_003899429.1.83589 WP_003899429.1.83601 WP_003899429.1.83611 WP_003899429.1.83638 WP_003899429.1.83656 WP_003899429.1.83667 WP_003899429.1.83689 WP_003899429.1.83692 WP_003899429.1.83705 WP_003899429.1.83766 WP_003899429.1.83793 WP_003899429.1.83794 WP_003899429.1.83802 WP_003899429.1.83805 WP_003899429.1.83839 WP_003899429.1.83842 WP_003899429.1.83850 WP_003899429.1.83861 WP_003899429.1.83884 WP_003899429.1.83920 WP_003899429.1.83929 WP_003899429.1.83930 WP_003899429.1.83975 WP_003899429.1.83991 WP_003899429.1.8400 WP_003899429.1.84027 WP_003899429.1.8404 WP_003899429.1.84057 WP_003899429.1.84070 WP_003899429.1.8409 WP_003899429.1.84112 WP_003899429.1.84146 WP_003899429.1.8415 WP_003899429.1.84176 WP_003899429.1.84192 WP_003899429.1.84228 WP_003899429.1.8424 WP_003899429.1.84244 WP_003899429.1.84259 WP_003899429.1.8426 WP_003899429.1.84277 WP_003899429.1.84287 WP_003899429.1.8434 WP_003899429.1.84388 WP_003899429.1.84409 WP_003899429.1.84438 WP_003899429.1.84460 WP_003899429.1.84488 WP_003899429.1.84504 WP_003899429.1.84525 WP_003899429.1.84620 WP_003899429.1.84623 WP_003899429.1.84641 WP_003899429.1.84655 WP_003899429.1.84666 WP_003899429.1.84670 WP_003899429.1.84739 WP_003899429.1.84748 WP_003899429.1.84766 WP_003899429.1.84772 WP_003899429.1.84774 WP_003899429.1.848 WP_003899429.1.84812 WP_003899429.1.84836 WP_003899429.1.84839 WP_003899429.1.84846 WP_003899429.1.84873 WP_003899429.1.84938 WP_003899429.1.84968 WP_003899429.1.84973 WP_003899429.1.84981 WP_003899429.1.84985 WP_003899429.1.8503 WP_003899429.1.85038 WP_003899429.1.85043 WP_003899429.1.8505 WP_003899429.1.85074 WP_003899429.1.8509 WP_003899429.1.8512 WP_003899429.1.85148 WP_003899429.1.8518 WP_003899429.1.8522 WP_003899429.1.85242 WP_003899429.1.85276 WP_003899429.1.85281 WP_003899429.1.85284 WP_003899429.1.85314 WP_003899429.1.85319 WP_003899429.1.85330 WP_003899429.1.85341 WP_003899429.1.8535 WP_003899429.1.85363 WP_003899429.1.85371 WP_003899429.1.85377 WP_003899429.1.85387 WP_003899429.1.85399 WP_003899429.1.85458 WP_003899429.1.8546 WP_003899429.1.85478 WP_003899429.1.85480 WP_003899429.1.85488 WP_003899429.1.85495 WP_003899429.1.85551 WP_003899429.1.85557 WP_003899429.1.85577 WP_003899429.1.85599 WP_003899429.1.85610 WP_003899429.1.8563 WP_003899429.1.85648 WP_003899429.1.85679 WP_003899429.1.85704 WP_003899429.1.85717 WP_003899429.1.85727 WP_003899429.1.85737 WP_003899429.1.85763 WP_003899429.1.85808 WP_003899429.1.85819 WP_003899429.1.85820 WP_003899429.1.85823 WP_003899429.1.85832 WP_003899429.1.8586 WP_003899429.1.85872 WP_003899429.1.85894 WP_003899429.1.85909 WP_003899429.1.85913 WP_003899429.1.85953 WP_003899429.1.85986 WP_003899429.1.86000 WP_003899429.1.86025 WP_003899429.1.86032 WP_003899429.1.86048 WP_003899429.1.86052 WP_003899429.1.86067 WP_003899429.1.86103 WP_003899429.1.86122 WP_003899429.1.86124 WP_003899429.1.86160 WP_003899429.1.86164 WP_003899429.1.86168 WP_003899429.1.86190 WP_003899429.1.86204 WP_003899429.1.86208 WP_003899429.1.86235 WP_003899429.1.86249 WP_003899429.1.86260 WP_003899429.1.86290 WP_003899429.1.863 WP_003899429.1.86327 WP_003899429.1.86334 WP_003899429.1.86337 WP_003899429.1.86368 WP_003899429.1.86377 WP_003899429.1.86425 WP_003899429.1.86459 WP_003899429.1.8649 WP_003899429.1.86499 WP_003899429.1.86520 WP_003899429.1.86561 WP_003899429.1.86568 WP_003899429.1.86575 WP_003899429.1.86584 WP_003899429.1.86605 WP_003899429.1.86626 WP_003899429.1.86648 WP_003899429.1.86684 WP_003899429.1.86696 WP_003899429.1.86705 WP_003899429.1.86718 WP_003899429.1.86725 WP_003899429.1.86757 WP_003899429.1.86766 WP_003899429.1.86801 WP_003899429.1.86814 WP_003899429.1.86820 WP_003899429.1.86825 WP_003899429.1.86834 WP_003899429.1.8685 WP_003899429.1.86851 WP_003899429.1.86855 WP_003899429.1.86867 WP_003899429.1.86877 WP_003899429.1.86883 WP_003899429.1.8689 WP_003899429.1.86892 WP_003899429.1.86933 WP_003899429.1.86941 WP_003899429.1.86950 WP_003899429.1.86962 WP_003899429.1.86963 WP_003899429.1.86979 WP_003899429.1.8700 WP_003899429.1.87002 WP_003899429.1.87031 WP_003899429.1.87116 WP_003899429.1.87117 WP_003899429.1.8714 WP_003899429.1.87178 WP_003899429.1.87191 WP_003899429.1.87201 WP_003899429.1.87209 WP_003899429.1.87240 WP_003899429.1.87266 WP_003899429.1.87273 WP_003899429.1.87275 WP_003899429.1.8733 WP_003899429.1.87345 WP_003899429.1.8737 WP_003899429.1.87401 WP_003899429.1.87409 WP_003899429.1.87444 WP_003899429.1.87446 WP_003899429.1.87459 WP_003899429.1.87472 WP_003899429.1.87489 WP_003899429.1.87494 WP_003899429.1.87496 WP_003899429.1.87582 WP_003899429.1.87588 WP_003899429.1.87617 WP_003899429.1.87619 WP_003899429.1.87620 WP_003899429.1.87634 WP_003899429.1.87643 WP_003899429.1.8765 WP_003899429.1.87650 WP_003899429.1.87654 WP_003899429.1.87658 WP_003899429.1.87665 WP_003899429.1.87676 WP_003899429.1.87677 WP_003899429.1.87684 WP_003899429.1.87692 WP_003899429.1.87707 WP_003899429.1.87732 WP_003899429.1.87784 WP_003899429.1.87796 WP_003899429.1.87809 WP_003899429.1.87817 WP_003899429.1.87827 WP_003899429.1.87831 WP_003899429.1.87835 WP_003899429.1.87837 WP_003899429.1.87866 WP_003899429.1.8789 WP_003899429.1.87911 WP_003899429.1.87924 WP_003899429.1.87951 WP_003899429.1.87956 WP_003899429.1.87991 WP_003899429.1.88 WP_003899429.1.88002 WP_003899429.1.88037 WP_003899429.1.88039 WP_003899429.1.88072 WP_003899429.1.88077 WP_003899429.1.88121 WP_003899429.1.88191 WP_003899429.1.88205 WP_003899429.1.88217 WP_003899429.1.88219 WP_003899429.1.88245 WP_003899429.1.88253 WP_003899429.1.88294 WP_003899429.1.88315 WP_003899429.1.88316 WP_003899429.1.88320 WP_003899429.1.88338 WP_003899429.1.8840 WP_003899429.1.88437 WP_003899429.1.88453 WP_003899429.1.88469 WP_003899429.1.88489 WP_003899429.1.88507 WP_003899429.1.88530 WP_003899429.1.88537 WP_003899429.1.88541 WP_003899429.1.88592 WP_003899429.1.88616 WP_003899429.1.88618 WP_003899429.1.8862 WP_003899429.1.88625 WP_003899429.1.88632 WP_003899429.1.88634 WP_003899429.1.88649 WP_003899429.1.8870 WP_003899429.1.88737 WP_003899429.1.88756 WP_003899429.1.888 WP_003899429.1.88824 WP_003899429.1.88886 WP_003899429.1.88965 WP_003899429.1.88985 WP_003899429.1.8902 WP_003899429.1.89025 WP_003899429.1.89041 WP_003899429.1.89046 WP_003899429.1.89082 WP_003899429.1.89162 WP_003899429.1.89168 WP_003899429.1.8917 WP_003899429.1.89205 WP_003899429.1.89207 WP_003899429.1.89225 WP_003899429.1.8925 WP_003899429.1.89277 WP_003899429.1.89286 WP_003899429.1.89293 WP_003899429.1.89320 WP_003899429.1.8935 WP_003899429.1.89371 WP_003899429.1.89378 WP_003899429.1.89392 WP_003899429.1.89406 WP_003899429.1.89451 WP_003899429.1.89453 WP_003899429.1.89473 WP_003899429.1.89475 WP_003899429.1.89483 WP_003899429.1.895 WP_003899429.1.89513 WP_003899429.1.89517 WP_003899429.1.89522 WP_003899429.1.8954 WP_003899429.1.89543 WP_003899429.1.8957 WP_003899429.1.89572 WP_003899429.1.89589 WP_003899429.1.89607 WP_003899429.1.89613 WP_003899429.1.89625 WP_003899429.1.89648 WP_003899429.1.8967 WP_003899429.1.89670 WP_003899429.1.89676 WP_003899429.1.89729 WP_003899429.1.89739 WP_003899429.1.89762 WP_003899429.1.8977 WP_003899429.1.89808 WP_003899429.1.8982 WP_003899429.1.89829 WP_003899429.1.89831 WP_003899429.1.89844 WP_003899429.1.89849 WP_003899429.1.8989 WP_003899429.1.89901 WP_003899429.1.89903 WP_003899429.1.89909 WP_003899429.1.89922 WP_003899429.1.89926 WP_003899429.1.89963 WP_003899429.1.89971 WP_003899429.1.8998 WP_003899429.1.89987 WP_003899429.1.900 WP_003899429.1.90048 WP_003899429.1.9007 WP_003899429.1.90080 WP_003899429.1.90130 WP_003899429.1.90134 WP_003899429.1.90137 WP_003899429.1.90157 WP_003899429.1.90184 WP_003899429.1.90199 WP_003899429.1.90231 WP_003899429.1.90245 WP_003899429.1.90308 WP_003899429.1.90322 WP_003899429.1.90328 WP_003899429.1.90372 WP_003899429.1.90481 WP_003899429.1.90499 WP_003899429.1.9050 WP_003899429.1.90527 WP_003899429.1.90550 WP_003899429.1.90560 WP_003899429.1.90612 WP_003899429.1.90640 WP_003899429.1.90672 WP_003899429.1.90687 WP_003899429.1.90691 WP_003899429.1.90711 WP_003899429.1.90722 WP_003899429.1.90744 WP_003899429.1.9075 WP_003899429.1.90756 WP_003899429.1.90767 WP_003899429.1.90771 WP_003899429.1.90785 WP_003899429.1.90788 WP_003899429.1.90800 WP_003899429.1.90810 WP_003899429.1.90816 WP_003899429.1.90819 WP_003899429.1.9082 WP_003899429.1.90831 WP_003899429.1.90884 WP_003899429.1.90899 WP_003899429.1.90906 WP_003899429.1.90958 WP_003899429.1.90976 WP_003899429.1.90977 WP_003899429.1.90987 WP_003899429.1.9102 WP_003899429.1.91026 WP_003899429.1.91032 WP_003899429.1.91053 WP_003899429.1.91082 WP_003899429.1.91106 WP_003899429.1.91112 WP_003899429.1.91144 WP_003899429.1.91151 WP_003899429.1.91157 WP_003899429.1.91169 WP_003899429.1.91192 WP_003899429.1.91201 WP_003899429.1.91207 WP_003899429.1.91208 WP_003899429.1.91211 WP_003899429.1.91214 WP_003899429.1.91230 WP_003899429.1.91244 WP_003899429.1.91251 WP_003899429.1.91260 WP_003899429.1.91284 WP_003899429.1.91294 WP_003899429.1.91303 WP_003899429.1.91322 WP_003899429.1.91386 WP_003899429.1.9139 WP_003899429.1.91398 WP_003899429.1.91430 WP_003899429.1.91436 WP_003899429.1.91483 WP_003899429.1.91496 WP_003899429.1.91507 WP_003899429.1.91576 WP_003899429.1.91589 WP_003899429.1.91694 WP_003899429.1.91695 WP_003899429.1.91716 WP_003899429.1.91717 WP_003899429.1.91728 WP_003899429.1.91743 WP_003899429.1.91759 WP_003899429.1.91784 WP_003899429.1.91785 WP_003899429.1.91786 WP_003899429.1.91802 WP_003899429.1.91822 WP_003899429.1.91828 WP_003899429.1.9189 WP_003899429.1.91896 WP_003899429.1.9190 WP_003899429.1.91915 WP_003899429.1.91931 WP_003899429.1.91937 WP_003899429.1.91944 WP_003899429.1.91957 WP_003899429.1.91976 WP_003899429.1.92083 WP_003899429.1.92127 WP_003899429.1.92144 WP_003899429.1.92150 WP_003899429.1.92153 WP_003899429.1.92190 WP_003899429.1.92192 WP_003899429.1.92200 WP_003899429.1.92220 WP_003899429.1.92221 WP_003899429.1.92222 WP_003899429.1.92273 WP_003899429.1.92289 WP_003899429.1.9229 WP_003899429.1.92294 WP_003899429.1.92300 WP_003899429.1.92317 WP_003899429.1.92334 WP_003899429.1.92338 WP_003899429.1.92345 WP_003899429.1.92356 WP_003899429.1.92364 WP_003899429.1.92380 WP_003899429.1.92428 WP_003899429.1.92447 WP_003899429.1.92456 WP_003899429.1.92467 WP_003899429.1.92471 WP_003899429.1.92490 WP_003899429.1.92508 WP_003899429.1.9251 WP_003899429.1.92511 WP_003899429.1.92523 WP_003899429.1.92527 WP_003899429.1.92536 WP_003899429.1.92592 WP_003899429.1.92597 WP_003899429.1.92603 WP_003899429.1.92606 WP_003899429.1.92610 WP_003899429.1.92613 WP_003899429.1.9263 WP_003899429.1.9265 WP_003899429.1.92650 WP_003899429.1.92660 WP_003899429.1.92677 WP_003899429.1.92685 WP_003899429.1.92689 WP_003899429.1.92690 WP_003899429.1.92714 WP_003899429.1.92736 WP_003899429.1.9274 WP_003899429.1.92752 WP_003899429.1.92760 WP_003899429.1.92777 WP_003899429.1.92803 WP_003899429.1.92833 WP_003899429.1.92856 WP_003899429.1.92881 WP_003899429.1.92892 WP_003899429.1.92907 WP_003899429.1.92908 WP_003899429.1.9291 WP_003899429.1.92917 WP_003899429.1.92996 WP_003899429.1.93006 WP_003899429.1.93009 WP_003899429.1.93015 WP_003899429.1.93043 WP_003899429.1.9307 WP_003899429.1.93083 WP_003899429.1.93097 WP_003899429.1.93137 WP_003899429.1.93192 WP_003899429.1.93199 WP_003899429.1.93203 WP_003899429.1.93212 WP_003899429.1.93234 WP_003899429.1.93245 WP_003899429.1.93257 WP_003899429.1.93265 WP_003899429.1.93297 WP_003899429.1.93320 WP_003899429.1.93328 WP_003899429.1.93337 WP_003899429.1.93343 WP_003899429.1.93349 WP_003899429.1.93363 WP_003899429.1.93377 WP_003899429.1.9338 WP_003899429.1.93407 WP_003899429.1.93417 WP_003899429.1.93419 WP_003899429.1.93426 WP_003899429.1.9344 WP_003899429.1.93443 WP_003899429.1.93447 WP_003899429.1.93470 WP_003899429.1.93483 WP_003899429.1.93487 WP_003899429.1.93495 WP_003899429.1.93499 WP_003899429.1.93516 WP_003899429.1.93536 WP_003899429.1.93544 WP_003899429.1.93555 WP_003899429.1.93560 WP_003899429.1.93564 WP_003899429.1.9357 WP_003899429.1.93573 WP_003899429.1.93576 WP_003899429.1.93588 WP_003899429.1.9363 WP_003899429.1.93645 WP_003899429.1.93649 WP_003899429.1.93659 WP_003899429.1.93677 WP_003899429.1.9368 WP_003899429.1.93689 WP_003899429.1.93693 WP_003899429.1.93698 WP_003899429.1.93706 WP_003899429.1.9371 WP_003899429.1.93792 WP_003899429.1.93823 WP_003899429.1.93871 WP_003899429.1.9388 WP_003899429.1.93894 WP_003899429.1.93903 WP_003899429.1.93907 WP_003899429.1.93913 WP_003899429.1.93946 WP_003899429.1.93950 WP_003899429.1.93953 WP_003899429.1.93954 WP_003899429.1.93988 WP_003899429.1.9407 WP_003899429.1.94143 WP_003899429.1.94154 WP_003899429.1.94204 WP_003899429.1.94205 WP_003899429.1.94226 WP_003899429.1.94231 WP_003899429.1.94256 WP_003899429.1.94261 WP_003899429.1.94281 WP_003899429.1.94292 WP_003899429.1.94297 WP_003899429.1.9431 WP_003899429.1.94326 WP_003899429.1.94339 WP_003899429.1.94392 WP_003899429.1.94416 WP_003899429.1.94421 WP_003899429.1.94456 WP_003899429.1.94480 WP_003899429.1.94495 WP_003899429.1.94511 WP_003899429.1.94512 WP_003899429.1.94528 WP_003899429.1.94564 WP_003899429.1.946 WP_003899429.1.94623 WP_003899429.1.94629 WP_003899429.1.9465 WP_003899429.1.94673 WP_003899429.1.94714 WP_003899429.1.94730 WP_003899429.1.94736 WP_003899429.1.94776 WP_003899429.1.9478 WP_003899429.1.94834 WP_003899429.1.94852 WP_003899429.1.94872 WP_003899429.1.9488 WP_003899429.1.94902 WP_003899429.1.94916 WP_003899429.1.94979 WP_003899429.1.94994 WP_003899429.1.94996 WP_003899429.1.94998 WP_003899429.1.95007 WP_003899429.1.95010 WP_003899429.1.95015 WP_003899429.1.95034 WP_003899429.1.95068 WP_003899429.1.95081 WP_003899429.1.95082 WP_003899429.1.9509 WP_003899429.1.95096 WP_003899429.1.95112 WP_003899429.1.95138 WP_003899429.1.95179 WP_003899429.1.95188 WP_003899429.1.95190 WP_003899429.1.95234 WP_003899429.1.95241 WP_003899429.1.95245 WP_003899429.1.95257 WP_003899429.1.95279 WP_003899429.1.9531 WP_003899429.1.95335 WP_003899429.1.95344 WP_003899429.1.9535 WP_003899429.1.95370 WP_003899429.1.95392 WP_003899429.1.95416 WP_003899429.1.95454 WP_003899429.1.95455 WP_003899429.1.95491 WP_003899429.1.95497 WP_003899429.1.95508 WP_003899429.1.95509 WP_003899429.1.95529 WP_003899429.1.95556 WP_003899429.1.95557 WP_003899429.1.95565 WP_003899429.1.95578 WP_003899429.1.95580 WP_003899429.1.95585 WP_003899429.1.95643 WP_003899429.1.95679 WP_003899429.1.95685 WP_003899429.1.957 WP_003899429.1.95724 WP_003899429.1.95727 WP_003899429.1.95730 WP_003899429.1.95735 WP_003899429.1.95758 WP_003899429.1.95772 WP_003899429.1.95797 WP_003899429.1.95839 WP_003899429.1.9585 WP_003899429.1.9590 WP_003899429.1.95902 WP_003899429.1.95924 WP_003899429.1.95926 WP_003899429.1.95953 WP_003899429.1.95958 WP_003899429.1.95964 WP_003899429.1.95973 WP_003899429.1.96006 WP_003899429.1.9602 WP_003899429.1.96036 WP_003899429.1.96062 WP_003899429.1.96065 WP_003899429.1.96098 WP_003899429.1.96146 WP_003899429.1.96171 WP_003899429.1.96182 WP_003899429.1.96230 WP_003899429.1.96242 WP_003899429.1.96245 WP_003899429.1.96254 WP_003899429.1.96259 WP_003899429.1.96286 WP_003899429.1.96313 WP_003899429.1.96318 WP_003899429.1.96345 WP_003899429.1.96360 WP_003899429.1.96373 WP_003899429.1.96456 WP_003899429.1.96486 WP_003899429.1.96569 WP_003899429.1.96573 WP_003899429.1.96576 WP_003899429.1.96611 WP_003899429.1.96621 WP_003899429.1.9667 WP_003899429.1.96681 WP_003899429.1.96726 WP_003899429.1.96733 WP_003899429.1.96742 WP_003899429.1.96754 WP_003899429.1.9678 WP_003899429.1.9685 WP_003899429.1.97008 WP_003899429.1.97009 WP_003899429.1.97056 WP_003899429.1.97084 WP_003899429.1.97087 WP_003899429.1.97094 WP_003899429.1.97096 WP_003899429.1.97099 WP_003899429.1.97108 WP_003899429.1.97113 WP_003899429.1.97122 WP_003899429.1.97129 WP_003899429.1.97136 WP_003899429.1.9716 WP_003899429.1.97176 WP_003899429.1.97222 WP_003899429.1.97237 WP_003899429.1.97242 WP_003899429.1.97270 WP_003899429.1.97283 WP_003899429.1.97296 WP_003899429.1.97321 WP_003899429.1.97325 WP_003899429.1.97366 WP_003899429.1.97376 WP_003899429.1.97380 WP_003899429.1.97462 WP_003899429.1.97517 WP_003899429.1.97519 WP_003899429.1.97535 WP_003899429.1.97540 WP_003899429.1.97545 WP_003899429.1.97550 WP_003899429.1.97577 WP_003899429.1.97584 WP_003899429.1.9759 WP_003899429.1.97591 WP_003899429.1.97609 WP_003899429.1.97618 WP_003899429.1.9763 WP_003899429.1.97669 WP_003899429.1.97673 WP_003899429.1.97700 WP_003899429.1.97701 WP_003899429.1.9773 WP_003899429.1.97730 WP_003899429.1.97740 WP_003899429.1.97751 WP_003899429.1.97754 WP_003899429.1.97797 WP_003899429.1.9782 WP_003899429.1.9784 WP_003899429.1.97888 WP_003899429.1.9790 WP_003899429.1.9795 WP_003899429.1.97951 WP_003899429.1.97958 WP_003899429.1.97966 WP_003899429.1.97977 WP_003899429.1.97979 WP_003899429.1.97995 WP_003899429.1.98018 WP_003899429.1.98034 WP_003899429.1.98052 WP_003899429.1.98071 WP_003899429.1.98072 WP_003899429.1.98113 WP_003899429.1.98114 WP_003899429.1.98128 WP_003899429.1.98188 WP_003899429.1.98189 WP_003899429.1.98213 WP_003899429.1.98225 WP_003899429.1.98291 WP_003899429.1.98335 WP_003899429.1.98350 WP_003899429.1.98395 WP_003899429.1.98412 WP_003899429.1.98441 WP_003899429.1.98443 WP_003899429.1.98462 WP_003899429.1.9848 WP_003899429.1.98482 WP_003899429.1.98486 WP_003899429.1.98488 WP_003899429.1.98503 WP_003899429.1.98516 WP_003899429.1.98536 WP_003899429.1.98541 WP_003899429.1.98566 WP_003899429.1.98576 WP_003899429.1.98590 WP_003899429.1.98594 WP_003899429.1.98599 WP_003899429.1.98629 WP_003899429.1.98645 WP_003899429.1.98646 WP_003899429.1.98649 WP_003899429.1.98656 WP_003899429.1.9867 WP_003899429.1.98674 WP_003899429.1.98697 WP_003899429.1.98701 WP_003899429.1.98739 WP_003899429.1.98749 WP_003899429.1.98765 WP_003899429.1.98770 WP_003899429.1.98777 WP_003899429.1.98778 WP_003899429.1.98802 WP_003899429.1.98838 WP_003899429.1.98906 WP_003899429.1.98935 WP_003899429.1.98948 WP_003899429.1.98953 WP_003899429.1.98984 WP_003899429.1.99000 WP_003899429.1.99023 WP_003899429.1.99030 WP_003899429.1.99055 WP_003899429.1.99062 WP_003899429.1.99086 WP_003899429.1.99115 WP_003899429.1.99161 WP_003899429.1.99176 WP_003899429.1.99211 WP_003899429.1.99216 WP_003899429.1.99222 WP_003899429.1.99251 WP_003899429.1.99294 WP_003899429.1.99312 WP_003899429.1.99315 WP_003899429.1.99316 WP_003899429.1.99328 WP_003899429.1.99365 WP_003899429.1.99368 WP_003899429.1.99396 WP_003899429.1.99402 WP_003899429.1.99419 WP_003899429.1.99438 WP_003899429.1.99460 WP_003899429.1.99468 WP_003899429.1.99473 WP_003899429.1.99513 WP_003899429.1.99529 WP_003899429.1.99548 WP_003899429.1.99572 WP_003899429.1.99575 WP_003899429.1.99578 WP_003899429.1.99605 WP_003899429.1.99609 WP_003899429.1.99617 WP_003899429.1.99635 WP_003899429.1.99650 WP_003899429.1.99672 WP_003899429.1.99701 WP_003899429.1.99711 WP_003899429.1.99716 WP_003899429.1.99740 WP_003899429.1.99745 WP_003899429.1.99749 WP_003899429.1.9976 WP_003899429.1.99798 WP_003899429.1.99817 WP_003899429.1.99847 WP_003899429.1.99852 WP_003899429.1.99886 WP_003899429.1.99897 WP_003899429.1.99899 WP_003899429.1.99915 WP_003899429.1.99991 336982.TBFG_12698 419947.MRA_2711 478434.TBMG_01290 83331.MT2757 83332.Rv2683 gi|383308450|ref|YP_005361261.1| gi|253798235|ref|YP_003031236.1| gi|506927221|ref|YP_008007671.1| gi|494693150|ref|YP_007958693.1| gi|385999463|ref|YP_005917762.1| IPRv2683PALZ Rv2683 gi|15609820|ref|NP_217199.1| gi|479056646|ref|YP_007352452.1| gi|197738335|ref|YP_002159650.1| gi|15842221|ref|NP_337258.1| gi|375295502|ref|YP_005099769.1| gi|506927221|ref|YP_008007671.1| gi|148823873|ref|YP_001288627.1| gi|494697054|ref|YP_007962557.1| gi|392387315|ref|YP_005308944.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]