SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I6X5C5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I6X5C5
Domain Number 1 Region: 3-72,109-291
Classification Level Classification E-value
Superfamily Inosine monophosphate dehydrogenase (IMPDH) 3.82e-49
Family Inosine monophosphate dehydrogenase (IMPDH) 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I6X5C5
Sequence length 344
Comment (tr|I6X5C5|I6X5C5_MYCTU) Possible alanine rich oxidoreductase {ECO:0000313|EMBL:CCP45580.1} KW=Complete proteome; Reference proteome OX=83332 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv). GN=Rv2781c OC=Mycobacterium; Mycobacterium tuberculosis complex.
Sequence
MVLGFWDIAVPIVGAPMAGGPSTPALAAAVSNAGGLGFVAGGYLSADRLADDIAAARAAT
TGPIGANLFVPQPSVADWAQLEYYADELEEVAEYYHTEVGQPVYGDDDDWVRKLEVVADV
RPEVVSFTFGAPPPDVVQRLSALGLLVSITVTSVYEAGVAIAAGADSLVVQGPAAGGHRG
TFAPDMEPGTESLHQLLDRIGSAHDVPLVAAGGLGTAEDVAAVLRRGAIAAQVGTALLLA
DEAGTNAAHRAALKNPEFDATLVTRAFSGRYARGLANNFTRLLDHVAPLGYPEVHQMTKP
IRAAAVQADDPHGTNLWAGSAHRKTRPGPAADIIASLTPDVCSA
Download sequence
Identical sequences A0A045IJ09 A0A083W042 A0A0H3LDX5 A0A0H3MGE2 A0A197J2W0 A0A1R3Y272 A0A1S1BBK8 A5U6D4 F8M3N6 G0TF88 I6X5C5 L0TAM1 O33323
gi|494701214|ref|YP_007966696.1| rv2781c gi|375295403|ref|YP_005099670.1| gi|433627898|ref|YP_007261527.1| gi|433642967|ref|YP_007288726.1| gi|121638661|ref|YP_978885.1| gi|471338791|ref|YP_007611504.1| gi|392431611|ref|YP_006472655.1| gi|197738423|ref|YP_002159738.1| gi|479056745|ref|YP_007352551.1| gi|31793957|ref|NP_856450.1| gi|385992055|ref|YP_005910353.1| gi|339632792|ref|YP_004724434.1| gi|386005654|ref|YP_005923933.1| gi|15842319|ref|NP_337356.1| gi|224991153|ref|YP_002645842.1| gi|506927324|ref|YP_008007774.1| gi|433635841|ref|YP_007269468.1| gi|506927324|ref|YP_008007774.1| gi|148823969|ref|YP_001288723.1| 233413.Mb2804c 336982.TBFG_12794 410289.BCG_2799c 419947.MRA_2805 478434.TBMG_01193 561275.JTY_2793 83331.MT2851 83332.Rv2781c gi|392387413|ref|YP_005309042.1| gi|383308539|ref|YP_005361350.1| gi|340627783|ref|YP_004746235.1| NP_217297.1.84033 WP_003899478.1.100000 WP_003899478.1.100021 WP_003899478.1.100069 WP_003899478.1.100087 WP_003899478.1.10015 WP_003899478.1.100208 WP_003899478.1.100216 WP_003899478.1.10022 WP_003899478.1.100255 WP_003899478.1.100260 WP_003899478.1.100270 WP_003899478.1.100279 WP_003899478.1.100286 WP_003899478.1.100308 WP_003899478.1.100309 WP_003899478.1.100318 WP_003899478.1.100337 WP_003899478.1.100338 WP_003899478.1.10037 WP_003899478.1.100383 WP_003899478.1.100395 WP_003899478.1.100396 WP_003899478.1.1004 WP_003899478.1.100401 WP_003899478.1.100459 WP_003899478.1.100460 WP_003899478.1.100552 WP_003899478.1.100581 WP_003899478.1.100600 WP_003899478.1.100625 WP_003899478.1.10064 WP_003899478.1.100666 WP_003899478.1.100671 WP_003899478.1.100677 WP_003899478.1.100682 WP_003899478.1.100697 WP_003899478.1.100703 WP_003899478.1.100716 WP_003899478.1.100722 WP_003899478.1.100754 WP_003899478.1.100757 WP_003899478.1.100772 WP_003899478.1.1008 WP_003899478.1.100812 WP_003899478.1.100845 WP_003899478.1.100866 WP_003899478.1.10088 WP_003899478.1.100889 WP_003899478.1.10090 WP_003899478.1.100910 WP_003899478.1.100915 WP_003899478.1.100918 WP_003899478.1.100935 WP_003899478.1.100984 WP_003899478.1.100992 WP_003899478.1.101 WP_003899478.1.101025 WP_003899478.1.101028 WP_003899478.1.10104 WP_003899478.1.101048 WP_003899478.1.101054 WP_003899478.1.101075 WP_003899478.1.101143 WP_003899478.1.101146 WP_003899478.1.10116 WP_003899478.1.10117 WP_003899478.1.101209 WP_003899478.1.10125 WP_003899478.1.101290 WP_003899478.1.101323 WP_003899478.1.101324 WP_003899478.1.101350 WP_003899478.1.101367 WP_003899478.1.101398 WP_003899478.1.101403 WP_003899478.1.101421 WP_003899478.1.10144 WP_003899478.1.101442 WP_003899478.1.10145 WP_003899478.1.101452 WP_003899478.1.101456 WP_003899478.1.101481 WP_003899478.1.101493 WP_003899478.1.101525 WP_003899478.1.101533 WP_003899478.1.101535 WP_003899478.1.101553 WP_003899478.1.101558 WP_003899478.1.10156 WP_003899478.1.101573 WP_003899478.1.101576 WP_003899478.1.10159 WP_003899478.1.101592 WP_003899478.1.101604 WP_003899478.1.101607 WP_003899478.1.101622 WP_003899478.1.101644 WP_003899478.1.101659 WP_003899478.1.101671 WP_003899478.1.101687 WP_003899478.1.101698 WP_003899478.1.10170 WP_003899478.1.101713 WP_003899478.1.101722 WP_003899478.1.101733 WP_003899478.1.101743 WP_003899478.1.101753 WP_003899478.1.101764 WP_003899478.1.101795 WP_003899478.1.101797 WP_003899478.1.101798 WP_003899478.1.101802 WP_003899478.1.101826 WP_003899478.1.101836 WP_003899478.1.101858 WP_003899478.1.101859 WP_003899478.1.101862 WP_003899478.1.101888 WP_003899478.1.101894 WP_003899478.1.101899 WP_003899478.1.1019 WP_003899478.1.101923 WP_003899478.1.101925 WP_003899478.1.10193 WP_003899478.1.101996 WP_003899478.1.102 WP_003899478.1.102008 WP_003899478.1.102017 WP_003899478.1.102053 WP_003899478.1.102063 WP_003899478.1.102099 WP_003899478.1.1021 WP_003899478.1.10211 WP_003899478.1.102119 WP_003899478.1.102121 WP_003899478.1.102143 WP_003899478.1.10224 WP_003899478.1.10253 WP_003899478.1.10262 WP_003899478.1.10272 WP_003899478.1.10277 WP_003899478.1.1033 WP_003899478.1.10350 WP_003899478.1.10362 WP_003899478.1.10366 WP_003899478.1.10376 WP_003899478.1.10396 WP_003899478.1.10410 WP_003899478.1.10414 WP_003899478.1.10421 WP_003899478.1.10430 WP_003899478.1.1044 WP_003899478.1.10440 WP_003899478.1.10471 WP_003899478.1.10472 WP_003899478.1.10489 WP_003899478.1.105 WP_003899478.1.10518 WP_003899478.1.10523 WP_003899478.1.10545 WP_003899478.1.1057 WP_003899478.1.10594 WP_003899478.1.10603 WP_003899478.1.10606 WP_003899478.1.10615 WP_003899478.1.10623 WP_003899478.1.10635 WP_003899478.1.10643 WP_003899478.1.10648 WP_003899478.1.10662 WP_003899478.1.10709 WP_003899478.1.10735 WP_003899478.1.10756 WP_003899478.1.1078 WP_003899478.1.10791 WP_003899478.1.10799 WP_003899478.1.10825 WP_003899478.1.10848 WP_003899478.1.10863 WP_003899478.1.10879 WP_003899478.1.10912 WP_003899478.1.10916 WP_003899478.1.10923 WP_003899478.1.10927 WP_003899478.1.1095 WP_003899478.1.10956 WP_003899478.1.10958 WP_003899478.1.10962 WP_003899478.1.10980 WP_003899478.1.10981 WP_003899478.1.10993 WP_003899478.1.1100 WP_003899478.1.11040 WP_003899478.1.11061 WP_003899478.1.11070 WP_003899478.1.11141 WP_003899478.1.11171 WP_003899478.1.11175 WP_003899478.1.11176 WP_003899478.1.11236 WP_003899478.1.11329 WP_003899478.1.1133 WP_003899478.1.11342 WP_003899478.1.11373 WP_003899478.1.11376 WP_003899478.1.11390 WP_003899478.1.11402 WP_003899478.1.11481 WP_003899478.1.11487 WP_003899478.1.11491 WP_003899478.1.11514 WP_003899478.1.11587 WP_003899478.1.11589 WP_003899478.1.11596 WP_003899478.1.11604 WP_003899478.1.11610 WP_003899478.1.11697 WP_003899478.1.11707 WP_003899478.1.11752 WP_003899478.1.11758 WP_003899478.1.11761 WP_003899478.1.11775 WP_003899478.1.11804 WP_003899478.1.11822 WP_003899478.1.11826 WP_003899478.1.11856 WP_003899478.1.11898 WP_003899478.1.11906 WP_003899478.1.11939 WP_003899478.1.11960 WP_003899478.1.11961 WP_003899478.1.11972 WP_003899478.1.11984 WP_003899478.1.120 WP_003899478.1.12001 WP_003899478.1.12049 WP_003899478.1.12052 WP_003899478.1.12100 WP_003899478.1.12116 WP_003899478.1.12130 WP_003899478.1.12133 WP_003899478.1.12161 WP_003899478.1.12165 WP_003899478.1.12184 WP_003899478.1.12187 WP_003899478.1.12190 WP_003899478.1.12216 WP_003899478.1.12265 WP_003899478.1.12275 WP_003899478.1.12293 WP_003899478.1.12294 WP_003899478.1.123 WP_003899478.1.1231 WP_003899478.1.12314 WP_003899478.1.12327 WP_003899478.1.12338 WP_003899478.1.1236 WP_003899478.1.12371 WP_003899478.1.12372 WP_003899478.1.12406 WP_003899478.1.1241 WP_003899478.1.12421 WP_003899478.1.12424 WP_003899478.1.12446 WP_003899478.1.12464 WP_003899478.1.12479 WP_003899478.1.12519 WP_003899478.1.12523 WP_003899478.1.12526 WP_003899478.1.1255 WP_003899478.1.12550 WP_003899478.1.12551 WP_003899478.1.12563 WP_003899478.1.12611 WP_003899478.1.12669 WP_003899478.1.12672 WP_003899478.1.12692 WP_003899478.1.12710 WP_003899478.1.12768 WP_003899478.1.1279 WP_003899478.1.12801 WP_003899478.1.12804 WP_003899478.1.12821 WP_003899478.1.12841 WP_003899478.1.12854 WP_003899478.1.12871 WP_003899478.1.12901 WP_003899478.1.12941 WP_003899478.1.12947 WP_003899478.1.12957 WP_003899478.1.12972 WP_003899478.1.13028 WP_003899478.1.13043 WP_003899478.1.13086 WP_003899478.1.13087 WP_003899478.1.13090 WP_003899478.1.13096 WP_003899478.1.13163 WP_003899478.1.13175 WP_003899478.1.13183 WP_003899478.1.132 WP_003899478.1.13249 WP_003899478.1.13282 WP_003899478.1.13284 WP_003899478.1.13296 WP_003899478.1.13298 WP_003899478.1.13302 WP_003899478.1.13306 WP_003899478.1.13312 WP_003899478.1.13313 WP_003899478.1.13321 WP_003899478.1.13345 WP_003899478.1.13358 WP_003899478.1.13370 WP_003899478.1.1338 WP_003899478.1.13420 WP_003899478.1.13433 WP_003899478.1.13435 WP_003899478.1.13438 WP_003899478.1.13461 WP_003899478.1.13466 WP_003899478.1.13489 WP_003899478.1.13526 WP_003899478.1.13551 WP_003899478.1.13561 WP_003899478.1.13564 WP_003899478.1.13579 WP_003899478.1.13647 WP_003899478.1.13687 WP_003899478.1.13697 WP_003899478.1.13719 WP_003899478.1.13763 WP_003899478.1.1377 WP_003899478.1.13774 WP_003899478.1.13786 WP_003899478.1.13793 WP_003899478.1.13794 WP_003899478.1.13817 WP_003899478.1.13834 WP_003899478.1.13866 WP_003899478.1.13880 WP_003899478.1.13909 WP_003899478.1.13910 WP_003899478.1.13919 WP_003899478.1.13952 WP_003899478.1.13953 WP_003899478.1.13962 WP_003899478.1.1398 WP_003899478.1.13988 WP_003899478.1.14027 WP_003899478.1.14046 WP_003899478.1.14115 WP_003899478.1.1415 WP_003899478.1.14152 WP_003899478.1.14158 WP_003899478.1.14162 WP_003899478.1.14175 WP_003899478.1.14178 WP_003899478.1.14195 WP_003899478.1.14208 WP_003899478.1.14266 WP_003899478.1.14273 WP_003899478.1.14303 WP_003899478.1.14306 WP_003899478.1.14307 WP_003899478.1.14310 WP_003899478.1.14341 WP_003899478.1.14382 WP_003899478.1.14416 WP_003899478.1.14428 WP_003899478.1.14441 WP_003899478.1.14469 WP_003899478.1.14477 WP_003899478.1.14504 WP_003899478.1.14514 WP_003899478.1.1452 WP_003899478.1.14527 WP_003899478.1.1454 WP_003899478.1.14544 WP_003899478.1.14551 WP_003899478.1.14561 WP_003899478.1.14573 WP_003899478.1.1462 WP_003899478.1.14658 WP_003899478.1.14667 WP_003899478.1.14668 WP_003899478.1.14675 WP_003899478.1.14694 WP_003899478.1.14695 WP_003899478.1.14709 WP_003899478.1.14766 WP_003899478.1.14783 WP_003899478.1.14865 WP_003899478.1.14872 WP_003899478.1.14905 WP_003899478.1.14926 WP_003899478.1.14951 WP_003899478.1.14955 WP_003899478.1.15003 WP_003899478.1.15028 WP_003899478.1.15040 WP_003899478.1.15052 WP_003899478.1.15065 WP_003899478.1.15072 WP_003899478.1.15089 WP_003899478.1.1509 WP_003899478.1.15126 WP_003899478.1.15131 WP_003899478.1.15168 WP_003899478.1.15172 WP_003899478.1.15187 WP_003899478.1.15210 WP_003899478.1.15216 WP_003899478.1.15217 WP_003899478.1.1523 WP_003899478.1.15232 WP_003899478.1.15240 WP_003899478.1.15253 WP_003899478.1.15267 WP_003899478.1.1527 WP_003899478.1.15292 WP_003899478.1.15299 WP_003899478.1.15322 WP_003899478.1.1534 WP_003899478.1.15345 WP_003899478.1.15365 WP_003899478.1.15372 WP_003899478.1.15386 WP_003899478.1.15387 WP_003899478.1.15442 WP_003899478.1.15447 WP_003899478.1.15449 WP_003899478.1.15477 WP_003899478.1.15481 WP_003899478.1.15492 WP_003899478.1.15511 WP_003899478.1.15512 WP_003899478.1.15558 WP_003899478.1.15559 WP_003899478.1.15566 WP_003899478.1.15599 WP_003899478.1.1560 WP_003899478.1.15611 WP_003899478.1.1563 WP_003899478.1.15633 WP_003899478.1.15643 WP_003899478.1.15688 WP_003899478.1.15755 WP_003899478.1.15763 WP_003899478.1.15774 WP_003899478.1.1578 WP_003899478.1.15780 WP_003899478.1.15827 WP_003899478.1.15834 WP_003899478.1.15842 WP_003899478.1.15853 WP_003899478.1.15870 WP_003899478.1.15877 WP_003899478.1.15893 WP_003899478.1.15896 WP_003899478.1.15926 WP_003899478.1.15946 WP_003899478.1.15958 WP_003899478.1.15973 WP_003899478.1.15987 WP_003899478.1.15993 WP_003899478.1.16009 WP_003899478.1.16025 WP_003899478.1.16043 WP_003899478.1.16055 WP_003899478.1.16066 WP_003899478.1.16069 WP_003899478.1.16077 WP_003899478.1.16106 WP_003899478.1.16108 WP_003899478.1.16110 WP_003899478.1.16136 WP_003899478.1.16139 WP_003899478.1.16141 WP_003899478.1.16143 WP_003899478.1.1630 WP_003899478.1.16318 WP_003899478.1.1632 WP_003899478.1.16327 WP_003899478.1.16334 WP_003899478.1.16341 WP_003899478.1.16345 WP_003899478.1.16374 WP_003899478.1.16384 WP_003899478.1.16386 WP_003899478.1.164 WP_003899478.1.1642 WP_003899478.1.16421 WP_003899478.1.16424 WP_003899478.1.16426 WP_003899478.1.16431 WP_003899478.1.1644 WP_003899478.1.16442 WP_003899478.1.16448 WP_003899478.1.16451 WP_003899478.1.16476 WP_003899478.1.16480 WP_003899478.1.1652 WP_003899478.1.16549 WP_003899478.1.16560 WP_003899478.1.16598 WP_003899478.1.16609 WP_003899478.1.16619 WP_003899478.1.16620 WP_003899478.1.16622 WP_003899478.1.16637 WP_003899478.1.1669 WP_003899478.1.16707 WP_003899478.1.16724 WP_003899478.1.16731 WP_003899478.1.16743 WP_003899478.1.1683 WP_003899478.1.16837 WP_003899478.1.16852 WP_003899478.1.16937 WP_003899478.1.16940 WP_003899478.1.16950 WP_003899478.1.16959 WP_003899478.1.16968 WP_003899478.1.1697 WP_003899478.1.16973 WP_003899478.1.16977 WP_003899478.1.16987 WP_003899478.1.17006 WP_003899478.1.17010 WP_003899478.1.17015 WP_003899478.1.17019 WP_003899478.1.17039 WP_003899478.1.17052 WP_003899478.1.17057 WP_003899478.1.17062 WP_003899478.1.1707 WP_003899478.1.17094 WP_003899478.1.17130 WP_003899478.1.17138 WP_003899478.1.17147 WP_003899478.1.17167 WP_003899478.1.17224 WP_003899478.1.17251 WP_003899478.1.17288 WP_003899478.1.17304 WP_003899478.1.17314 WP_003899478.1.17345 WP_003899478.1.17381 WP_003899478.1.17391 WP_003899478.1.17412 WP_003899478.1.1743 WP_003899478.1.17440 WP_003899478.1.17477 WP_003899478.1.17483 WP_003899478.1.17505 WP_003899478.1.17527 WP_003899478.1.17535 WP_003899478.1.17540 WP_003899478.1.17553 WP_003899478.1.17558 WP_003899478.1.17599 WP_003899478.1.17635 WP_003899478.1.17655 WP_003899478.1.17679 WP_003899478.1.1768 WP_003899478.1.17687 WP_003899478.1.17700 WP_003899478.1.17710 WP_003899478.1.17713 WP_003899478.1.17722 WP_003899478.1.17746 WP_003899478.1.17788 WP_003899478.1.17798 WP_003899478.1.17803 WP_003899478.1.17816 WP_003899478.1.17821 WP_003899478.1.17830 WP_003899478.1.17868 WP_003899478.1.1792 WP_003899478.1.17923 WP_003899478.1.1795 WP_003899478.1.17955 WP_003899478.1.17973 WP_003899478.1.18009 WP_003899478.1.18013 WP_003899478.1.18065 WP_003899478.1.18070 WP_003899478.1.18116 WP_003899478.1.18120 WP_003899478.1.18126 WP_003899478.1.1817 WP_003899478.1.18170 WP_003899478.1.18206 WP_003899478.1.18216 WP_003899478.1.18240 WP_003899478.1.18297 WP_003899478.1.18306 WP_003899478.1.18364 WP_003899478.1.18399 WP_003899478.1.18411 WP_003899478.1.18444 WP_003899478.1.18448 WP_003899478.1.18467 WP_003899478.1.18476 WP_003899478.1.18522 WP_003899478.1.18580 WP_003899478.1.18582 WP_003899478.1.18587 WP_003899478.1.186 WP_003899478.1.18601 WP_003899478.1.18639 WP_003899478.1.18646 WP_003899478.1.18647 WP_003899478.1.1868 WP_003899478.1.18694 WP_003899478.1.18710 WP_003899478.1.18751 WP_003899478.1.18804 WP_003899478.1.18816 WP_003899478.1.18823 WP_003899478.1.18827 WP_003899478.1.18838 WP_003899478.1.18849 WP_003899478.1.18856 WP_003899478.1.18945 WP_003899478.1.1898 WP_003899478.1.19005 WP_003899478.1.19056 WP_003899478.1.19063 WP_003899478.1.19066 WP_003899478.1.19071 WP_003899478.1.19085 WP_003899478.1.19094 WP_003899478.1.19144 WP_003899478.1.19159 WP_003899478.1.19193 WP_003899478.1.19231 WP_003899478.1.19243 WP_003899478.1.19264 WP_003899478.1.19295 WP_003899478.1.19307 WP_003899478.1.19326 WP_003899478.1.1933 WP_003899478.1.19364 WP_003899478.1.19382 WP_003899478.1.19400 WP_003899478.1.19426 WP_003899478.1.19429 WP_003899478.1.19480 WP_003899478.1.19512 WP_003899478.1.19553 WP_003899478.1.19562 WP_003899478.1.19564 WP_003899478.1.19568 WP_003899478.1.19572 WP_003899478.1.19595 WP_003899478.1.19596 WP_003899478.1.19600 WP_003899478.1.19630 WP_003899478.1.1967 WP_003899478.1.19694 WP_003899478.1.1970 WP_003899478.1.19707 WP_003899478.1.19742 WP_003899478.1.19785 WP_003899478.1.19820 WP_003899478.1.19874 WP_003899478.1.19890 WP_003899478.1.19922 WP_003899478.1.19936 WP_003899478.1.19946 WP_003899478.1.19949 WP_003899478.1.19960 WP_003899478.1.19964 WP_003899478.1.20007 WP_003899478.1.20016 WP_003899478.1.20028 WP_003899478.1.2003 WP_003899478.1.20037 WP_003899478.1.20039 WP_003899478.1.20082 WP_003899478.1.20085 WP_003899478.1.20097 WP_003899478.1.20116 WP_003899478.1.20130 WP_003899478.1.20140 WP_003899478.1.20141 WP_003899478.1.20142 WP_003899478.1.20158 WP_003899478.1.20239 WP_003899478.1.20243 WP_003899478.1.20259 WP_003899478.1.20262 WP_003899478.1.20268 WP_003899478.1.20272 WP_003899478.1.20273 WP_003899478.1.20280 WP_003899478.1.20294 WP_003899478.1.20300 WP_003899478.1.20309 WP_003899478.1.20322 WP_003899478.1.2037 WP_003899478.1.20372 WP_003899478.1.20381 WP_003899478.1.204 WP_003899478.1.20427 WP_003899478.1.20432 WP_003899478.1.20457 WP_003899478.1.20459 WP_003899478.1.20460 WP_003899478.1.20542 WP_003899478.1.20578 WP_003899478.1.20608 WP_003899478.1.20624 WP_003899478.1.20628 WP_003899478.1.2066 WP_003899478.1.20707 WP_003899478.1.20722 WP_003899478.1.20729 WP_003899478.1.20742 WP_003899478.1.20751 WP_003899478.1.20776 WP_003899478.1.20843 WP_003899478.1.20850 WP_003899478.1.2086 WP_003899478.1.20868 WP_003899478.1.20876 WP_003899478.1.20897 WP_003899478.1.20898 WP_003899478.1.2090 WP_003899478.1.20911 WP_003899478.1.20916 WP_003899478.1.20921 WP_003899478.1.20926 WP_003899478.1.20927 WP_003899478.1.20951 WP_003899478.1.20970 WP_003899478.1.2104 WP_003899478.1.21070 WP_003899478.1.21127 WP_003899478.1.21135 WP_003899478.1.21173 WP_003899478.1.21187 WP_003899478.1.212 WP_003899478.1.2120 WP_003899478.1.21218 WP_003899478.1.21219 WP_003899478.1.2123 WP_003899478.1.21231 WP_003899478.1.21234 WP_003899478.1.2126 WP_003899478.1.21292 WP_003899478.1.21307 WP_003899478.1.2131 WP_003899478.1.21311 WP_003899478.1.21321 WP_003899478.1.21365 WP_003899478.1.2137 WP_003899478.1.21392 WP_003899478.1.21397 WP_003899478.1.21403 WP_003899478.1.21415 WP_003899478.1.21418 WP_003899478.1.21434 WP_003899478.1.21468 WP_003899478.1.21498 WP_003899478.1.21509 WP_003899478.1.21560 WP_003899478.1.21565 WP_003899478.1.21586 WP_003899478.1.21591 WP_003899478.1.21594 WP_003899478.1.21602 WP_003899478.1.21615 WP_003899478.1.21638 WP_003899478.1.21639 WP_003899478.1.21655 WP_003899478.1.21658 WP_003899478.1.2168 WP_003899478.1.2174 WP_003899478.1.21741 WP_003899478.1.21742 WP_003899478.1.21777 WP_003899478.1.21786 WP_003899478.1.21795 WP_003899478.1.218 WP_003899478.1.21826 WP_003899478.1.21829 WP_003899478.1.21840 WP_003899478.1.21843 WP_003899478.1.21872 WP_003899478.1.21873 WP_003899478.1.2188 WP_003899478.1.21882 WP_003899478.1.21906 WP_003899478.1.21912 WP_003899478.1.2194 WP_003899478.1.21941 WP_003899478.1.21956 WP_003899478.1.21958 WP_003899478.1.21971 WP_003899478.1.21973 WP_003899478.1.21983 WP_003899478.1.22013 WP_003899478.1.22025 WP_003899478.1.22036 WP_003899478.1.22075 WP_003899478.1.22092 WP_003899478.1.2212 WP_003899478.1.22127 WP_003899478.1.22140 WP_003899478.1.22233 WP_003899478.1.22255 WP_003899478.1.22277 WP_003899478.1.22305 WP_003899478.1.22348 WP_003899478.1.22356 WP_003899478.1.22366 WP_003899478.1.2238 WP_003899478.1.22437 WP_003899478.1.22438 WP_003899478.1.22445 WP_003899478.1.22490 WP_003899478.1.22511 WP_003899478.1.22524 WP_003899478.1.2253 WP_003899478.1.22585 WP_003899478.1.22589 WP_003899478.1.22606 WP_003899478.1.22608 WP_003899478.1.22609 WP_003899478.1.22618 WP_003899478.1.2262 WP_003899478.1.22624 WP_003899478.1.22629 WP_003899478.1.22664 WP_003899478.1.22665 WP_003899478.1.22670 WP_003899478.1.22674 WP_003899478.1.22680 WP_003899478.1.22725 WP_003899478.1.22728 WP_003899478.1.22733 WP_003899478.1.22737 WP_003899478.1.2275 WP_003899478.1.22754 WP_003899478.1.22797 WP_003899478.1.22800 WP_003899478.1.22804 WP_003899478.1.22829 WP_003899478.1.22840 WP_003899478.1.22844 WP_003899478.1.22963 WP_003899478.1.22970 WP_003899478.1.22996 WP_003899478.1.22997 WP_003899478.1.22999 WP_003899478.1.23015 WP_003899478.1.23032 WP_003899478.1.231 WP_003899478.1.23101 WP_003899478.1.23140 WP_003899478.1.23153 WP_003899478.1.23171 WP_003899478.1.23199 WP_003899478.1.2320 WP_003899478.1.23204 WP_003899478.1.23216 WP_003899478.1.23229 WP_003899478.1.23233 WP_003899478.1.2326 WP_003899478.1.23261 WP_003899478.1.23289 WP_003899478.1.2329 WP_003899478.1.23308 WP_003899478.1.23316 WP_003899478.1.23321 WP_003899478.1.23325 WP_003899478.1.2339 WP_003899478.1.23406 WP_003899478.1.23445 WP_003899478.1.23447 WP_003899478.1.23452 WP_003899478.1.23461 WP_003899478.1.2349 WP_003899478.1.23496 WP_003899478.1.23497 WP_003899478.1.23506 WP_003899478.1.23530 WP_003899478.1.23539 WP_003899478.1.23546 WP_003899478.1.23551 WP_003899478.1.23573 WP_003899478.1.23588 WP_003899478.1.23628 WP_003899478.1.23677 WP_003899478.1.23683 WP_003899478.1.23692 WP_003899478.1.23694 WP_003899478.1.23699 WP_003899478.1.2371 WP_003899478.1.23807 WP_003899478.1.23825 WP_003899478.1.23832 WP_003899478.1.2384 WP_003899478.1.23843 WP_003899478.1.23863 WP_003899478.1.23894 WP_003899478.1.23993 WP_003899478.1.2400 WP_003899478.1.24007 WP_003899478.1.24046 WP_003899478.1.24057 WP_003899478.1.24062 WP_003899478.1.24113 WP_003899478.1.24119 WP_003899478.1.24128 WP_003899478.1.24176 WP_003899478.1.24190 WP_003899478.1.24202 WP_003899478.1.24244 WP_003899478.1.24261 WP_003899478.1.24284 WP_003899478.1.24294 WP_003899478.1.24357 WP_003899478.1.24396 WP_003899478.1.24414 WP_003899478.1.24423 WP_003899478.1.2443 WP_003899478.1.24446 WP_003899478.1.24461 WP_003899478.1.24500 WP_003899478.1.24507 WP_003899478.1.24509 WP_003899478.1.24529 WP_003899478.1.24553 WP_003899478.1.24599 WP_003899478.1.24629 WP_003899478.1.24638 WP_003899478.1.24767 WP_003899478.1.24824 WP_003899478.1.24831 WP_003899478.1.24840 WP_003899478.1.24848 WP_003899478.1.24857 WP_003899478.1.2487 WP_003899478.1.24893 WP_003899478.1.24907 WP_003899478.1.24933 WP_003899478.1.24956 WP_003899478.1.24958 WP_003899478.1.24985 WP_003899478.1.2499 WP_003899478.1.25004 WP_003899478.1.2505 WP_003899478.1.25051 WP_003899478.1.2507 WP_003899478.1.25096 WP_003899478.1.25103 WP_003899478.1.25129 WP_003899478.1.25171 WP_003899478.1.25184 WP_003899478.1.25247 WP_003899478.1.25252 WP_003899478.1.25278 WP_003899478.1.25283 WP_003899478.1.25309 WP_003899478.1.25313 WP_003899478.1.25338 WP_003899478.1.25342 WP_003899478.1.25343 WP_003899478.1.25367 WP_003899478.1.25393 WP_003899478.1.25406 WP_003899478.1.25435 WP_003899478.1.25437 WP_003899478.1.25445 WP_003899478.1.25455 WP_003899478.1.25473 WP_003899478.1.25504 WP_003899478.1.25513 WP_003899478.1.25542 WP_003899478.1.25579 WP_003899478.1.25594 WP_003899478.1.25606 WP_003899478.1.25645 WP_003899478.1.2566 WP_003899478.1.25673 WP_003899478.1.25674 WP_003899478.1.25693 WP_003899478.1.25699 WP_003899478.1.25727 WP_003899478.1.25736 WP_003899478.1.25738 WP_003899478.1.25756 WP_003899478.1.25759 WP_003899478.1.2580 WP_003899478.1.25813 WP_003899478.1.25853 WP_003899478.1.25854 WP_003899478.1.25874 WP_003899478.1.25885 WP_003899478.1.25892 WP_003899478.1.25906 WP_003899478.1.25914 WP_003899478.1.25916 WP_003899478.1.2594 WP_003899478.1.25954 WP_003899478.1.25965 WP_003899478.1.25972 WP_003899478.1.26017 WP_003899478.1.26032 WP_003899478.1.26038 WP_003899478.1.26072 WP_003899478.1.26098 WP_003899478.1.26109 WP_003899478.1.26118 WP_003899478.1.26126 WP_003899478.1.2614 WP_003899478.1.26168 WP_003899478.1.26182 WP_003899478.1.26190 WP_003899478.1.2620 WP_003899478.1.26234 WP_003899478.1.26243 WP_003899478.1.26265 WP_003899478.1.26292 WP_003899478.1.26310 WP_003899478.1.26328 WP_003899478.1.26349 WP_003899478.1.26366 WP_003899478.1.26374 WP_003899478.1.26412 WP_003899478.1.26454 WP_003899478.1.26464 WP_003899478.1.2653 WP_003899478.1.26560 WP_003899478.1.26571 WP_003899478.1.2659 WP_003899478.1.26597 WP_003899478.1.26603 WP_003899478.1.26629 WP_003899478.1.26702 WP_003899478.1.26707 WP_003899478.1.26710 WP_003899478.1.26719 WP_003899478.1.26737 WP_003899478.1.26738 WP_003899478.1.26745 WP_003899478.1.26756 WP_003899478.1.2676 WP_003899478.1.2677 WP_003899478.1.26779 WP_003899478.1.26780 WP_003899478.1.26798 WP_003899478.1.26854 WP_003899478.1.26868 WP_003899478.1.26876 WP_003899478.1.26888 WP_003899478.1.26914 WP_003899478.1.26945 WP_003899478.1.26959 WP_003899478.1.26969 WP_003899478.1.26984 WP_003899478.1.26992 WP_003899478.1.27004 WP_003899478.1.27017 WP_003899478.1.27045 WP_003899478.1.27074 WP_003899478.1.27075 WP_003899478.1.27130 WP_003899478.1.27139 WP_003899478.1.27152 WP_003899478.1.27162 WP_003899478.1.27164 WP_003899478.1.27193 WP_003899478.1.27235 WP_003899478.1.27254 WP_003899478.1.27278 WP_003899478.1.27343 WP_003899478.1.27352 WP_003899478.1.27369 WP_003899478.1.27391 WP_003899478.1.27398 WP_003899478.1.27410 WP_003899478.1.27411 WP_003899478.1.27449 WP_003899478.1.27460 WP_003899478.1.2749 WP_003899478.1.27492 WP_003899478.1.27528 WP_003899478.1.27541 WP_003899478.1.27576 WP_003899478.1.27582 WP_003899478.1.27596 WP_003899478.1.27607 WP_003899478.1.2766 WP_003899478.1.277 WP_003899478.1.27724 WP_003899478.1.27730 WP_003899478.1.27736 WP_003899478.1.27743 WP_003899478.1.27750 WP_003899478.1.27771 WP_003899478.1.27779 WP_003899478.1.27795 WP_003899478.1.27803 WP_003899478.1.27819 WP_003899478.1.27835 WP_003899478.1.27915 WP_003899478.1.27935 WP_003899478.1.27962 WP_003899478.1.28053 WP_003899478.1.28092 WP_003899478.1.28106 WP_003899478.1.28131 WP_003899478.1.28142 WP_003899478.1.28159 WP_003899478.1.2816 WP_003899478.1.28161 WP_003899478.1.28192 WP_003899478.1.28202 WP_003899478.1.28241 WP_003899478.1.28251 WP_003899478.1.28255 WP_003899478.1.28276 WP_003899478.1.28293 WP_003899478.1.28331 WP_003899478.1.28367 WP_003899478.1.28378 WP_003899478.1.28391 WP_003899478.1.2842 WP_003899478.1.28448 WP_003899478.1.2847 WP_003899478.1.28471 WP_003899478.1.28473 WP_003899478.1.28493 WP_003899478.1.28497 WP_003899478.1.28530 WP_003899478.1.28545 WP_003899478.1.28561 WP_003899478.1.28567 WP_003899478.1.28585 WP_003899478.1.286 WP_003899478.1.28610 WP_003899478.1.28617 WP_003899478.1.28642 WP_003899478.1.28671 WP_003899478.1.28682 WP_003899478.1.28698 WP_003899478.1.28703 WP_003899478.1.28739 WP_003899478.1.28758 WP_003899478.1.28781 WP_003899478.1.28787 WP_003899478.1.28839 WP_003899478.1.28847 WP_003899478.1.28850 WP_003899478.1.28851 WP_003899478.1.28865 WP_003899478.1.28897 WP_003899478.1.28914 WP_003899478.1.28935 WP_003899478.1.28936 WP_003899478.1.28939 WP_003899478.1.28943 WP_003899478.1.28952 WP_003899478.1.28975 WP_003899478.1.2899 WP_003899478.1.28993 WP_003899478.1.29000 WP_003899478.1.2901 WP_003899478.1.29028 WP_003899478.1.29033 WP_003899478.1.29058 WP_003899478.1.29078 WP_003899478.1.29102 WP_003899478.1.29115 WP_003899478.1.2916 WP_003899478.1.29217 WP_003899478.1.29223 WP_003899478.1.29234 WP_003899478.1.29264 WP_003899478.1.29306 WP_003899478.1.29339 WP_003899478.1.29348 WP_003899478.1.29367 WP_003899478.1.2938 WP_003899478.1.29399 WP_003899478.1.29426 WP_003899478.1.2944 WP_003899478.1.29449 WP_003899478.1.29450 WP_003899478.1.29452 WP_003899478.1.2949 WP_003899478.1.29510 WP_003899478.1.29515 WP_003899478.1.29525 WP_003899478.1.29559 WP_003899478.1.2959 WP_003899478.1.29592 WP_003899478.1.29599 WP_003899478.1.29611 WP_003899478.1.29632 WP_003899478.1.29649 WP_003899478.1.2965 WP_003899478.1.29659 WP_003899478.1.2969 WP_003899478.1.29696 WP_003899478.1.29698 WP_003899478.1.29718 WP_003899478.1.29742 WP_003899478.1.29745 WP_003899478.1.29747 WP_003899478.1.29769 WP_003899478.1.29825 WP_003899478.1.29830 WP_003899478.1.29847 WP_003899478.1.29861 WP_003899478.1.29869 WP_003899478.1.29883 WP_003899478.1.29890 WP_003899478.1.29931 WP_003899478.1.29960 WP_003899478.1.30014 WP_003899478.1.3004 WP_003899478.1.30040 WP_003899478.1.30043 WP_003899478.1.30074 WP_003899478.1.30097 WP_003899478.1.30101 WP_003899478.1.30106 WP_003899478.1.30114 WP_003899478.1.30126 WP_003899478.1.30131 WP_003899478.1.30138 WP_003899478.1.30139 WP_003899478.1.30145 WP_003899478.1.30211 WP_003899478.1.30224 WP_003899478.1.30235 WP_003899478.1.30237 WP_003899478.1.3027 WP_003899478.1.30279 WP_003899478.1.30282 WP_003899478.1.30288 WP_003899478.1.30291 WP_003899478.1.30363 WP_003899478.1.30374 WP_003899478.1.30404 WP_003899478.1.30433 WP_003899478.1.30438 WP_003899478.1.30462 WP_003899478.1.30464 WP_003899478.1.30500 WP_003899478.1.30574 WP_003899478.1.30628 WP_003899478.1.30641 WP_003899478.1.30642 WP_003899478.1.30661 WP_003899478.1.30669 WP_003899478.1.30683 WP_003899478.1.30709 WP_003899478.1.30713 WP_003899478.1.30716 WP_003899478.1.30719 WP_003899478.1.30730 WP_003899478.1.30732 WP_003899478.1.30736 WP_003899478.1.30745 WP_003899478.1.30760 WP_003899478.1.30791 WP_003899478.1.308 WP_003899478.1.30807 WP_003899478.1.30818 WP_003899478.1.30824 WP_003899478.1.30848 WP_003899478.1.30877 WP_003899478.1.30888 WP_003899478.1.30901 WP_003899478.1.30903 WP_003899478.1.30912 WP_003899478.1.30913 WP_003899478.1.30914 WP_003899478.1.30919 WP_003899478.1.30977 WP_003899478.1.31002 WP_003899478.1.3101 WP_003899478.1.31034 WP_003899478.1.31047 WP_003899478.1.31074 WP_003899478.1.31102 WP_003899478.1.31127 WP_003899478.1.31184 WP_003899478.1.31199 WP_003899478.1.31226 WP_003899478.1.31230 WP_003899478.1.31233 WP_003899478.1.31263 WP_003899478.1.31264 WP_003899478.1.31270 WP_003899478.1.31287 WP_003899478.1.31290 WP_003899478.1.31304 WP_003899478.1.31346 WP_003899478.1.31348 WP_003899478.1.31354 WP_003899478.1.31390 WP_003899478.1.31414 WP_003899478.1.31417 WP_003899478.1.3143 WP_003899478.1.31458 WP_003899478.1.31483 WP_003899478.1.3149 WP_003899478.1.31537 WP_003899478.1.31548 WP_003899478.1.31569 WP_003899478.1.31573 WP_003899478.1.316 WP_003899478.1.31629 WP_003899478.1.31666 WP_003899478.1.31693 WP_003899478.1.31703 WP_003899478.1.31744 WP_003899478.1.31770 WP_003899478.1.31783 WP_003899478.1.318 WP_003899478.1.3184 WP_003899478.1.31840 WP_003899478.1.31911 WP_003899478.1.31930 WP_003899478.1.31932 WP_003899478.1.31955 WP_003899478.1.31985 WP_003899478.1.31991 WP_003899478.1.31995 WP_003899478.1.32004 WP_003899478.1.32039 WP_003899478.1.3204 WP_003899478.1.32045 WP_003899478.1.32071 WP_003899478.1.32098 WP_003899478.1.32132 WP_003899478.1.32157 WP_003899478.1.32164 WP_003899478.1.32179 WP_003899478.1.32198 WP_003899478.1.32297 WP_003899478.1.32317 WP_003899478.1.32383 WP_003899478.1.32403 WP_003899478.1.32416 WP_003899478.1.32433 WP_003899478.1.32461 WP_003899478.1.32482 WP_003899478.1.32503 WP_003899478.1.32556 WP_003899478.1.32562 WP_003899478.1.32569 WP_003899478.1.32592 WP_003899478.1.32620 WP_003899478.1.32647 WP_003899478.1.32653 WP_003899478.1.32654 WP_003899478.1.3268 WP_003899478.1.32695 WP_003899478.1.32706 WP_003899478.1.32716 WP_003899478.1.32738 WP_003899478.1.32780 WP_003899478.1.32781 WP_003899478.1.32793 WP_003899478.1.32799 WP_003899478.1.32822 WP_003899478.1.32833 WP_003899478.1.32862 WP_003899478.1.32880 WP_003899478.1.32897 WP_003899478.1.32909 WP_003899478.1.32935 WP_003899478.1.32974 WP_003899478.1.33007 WP_003899478.1.3302 WP_003899478.1.33035 WP_003899478.1.33044 WP_003899478.1.33054 WP_003899478.1.33082 WP_003899478.1.33141 WP_003899478.1.33148 WP_003899478.1.33155 WP_003899478.1.33168 WP_003899478.1.3321 WP_003899478.1.33215 WP_003899478.1.3325 WP_003899478.1.3327 WP_003899478.1.33278 WP_003899478.1.33288 WP_003899478.1.33305 WP_003899478.1.3331 WP_003899478.1.33319 WP_003899478.1.3333 WP_003899478.1.33393 WP_003899478.1.33403 WP_003899478.1.33452 WP_003899478.1.33467 WP_003899478.1.33477 WP_003899478.1.3349 WP_003899478.1.33519 WP_003899478.1.33542 WP_003899478.1.33601 WP_003899478.1.33602 WP_003899478.1.33633 WP_003899478.1.33646 WP_003899478.1.33673 WP_003899478.1.3369 WP_003899478.1.33705 WP_003899478.1.33762 WP_003899478.1.33783 WP_003899478.1.33789 WP_003899478.1.3383 WP_003899478.1.33832 WP_003899478.1.33848 WP_003899478.1.3387 WP_003899478.1.33886 WP_003899478.1.33895 WP_003899478.1.33906 WP_003899478.1.33912 WP_003899478.1.33954 WP_003899478.1.3399 WP_003899478.1.34042 WP_003899478.1.3405 WP_003899478.1.34055 WP_003899478.1.34056 WP_003899478.1.34065 WP_003899478.1.34090 WP_003899478.1.34109 WP_003899478.1.34111 WP_003899478.1.34131 WP_003899478.1.34152 WP_003899478.1.34153 WP_003899478.1.34163 WP_003899478.1.34181 WP_003899478.1.34197 WP_003899478.1.34198 WP_003899478.1.34215 WP_003899478.1.34255 WP_003899478.1.34260 WP_003899478.1.343 WP_003899478.1.34347 WP_003899478.1.34358 WP_003899478.1.34392 WP_003899478.1.34428 WP_003899478.1.3443 WP_003899478.1.34435 WP_003899478.1.34446 WP_003899478.1.34499 WP_003899478.1.34505 WP_003899478.1.34516 WP_003899478.1.34529 WP_003899478.1.34551 WP_003899478.1.34563 WP_003899478.1.34576 WP_003899478.1.34581 WP_003899478.1.34588 WP_003899478.1.34596 WP_003899478.1.34599 WP_003899478.1.34673 WP_003899478.1.34724 WP_003899478.1.34740 WP_003899478.1.34755 WP_003899478.1.34777 WP_003899478.1.34783 WP_003899478.1.34841 WP_003899478.1.34908 WP_003899478.1.34919 WP_003899478.1.3492 WP_003899478.1.34933 WP_003899478.1.34945 WP_003899478.1.34946 WP_003899478.1.34954 WP_003899478.1.34960 WP_003899478.1.34961 WP_003899478.1.34963 WP_003899478.1.34965 WP_003899478.1.34968 WP_003899478.1.35023 WP_003899478.1.35069 WP_003899478.1.35072 WP_003899478.1.35100 WP_003899478.1.35146 WP_003899478.1.35156 WP_003899478.1.35160 WP_003899478.1.35162 WP_003899478.1.35173 WP_003899478.1.35176 WP_003899478.1.3520 WP_003899478.1.35213 WP_003899478.1.35221 WP_003899478.1.35246 WP_003899478.1.35278 WP_003899478.1.35301 WP_003899478.1.35311 WP_003899478.1.35312 WP_003899478.1.35317 WP_003899478.1.35319 WP_003899478.1.35347 WP_003899478.1.35363 WP_003899478.1.35382 WP_003899478.1.35385 WP_003899478.1.35396 WP_003899478.1.35397 WP_003899478.1.35426 WP_003899478.1.35439 WP_003899478.1.35455 WP_003899478.1.3548 WP_003899478.1.35484 WP_003899478.1.35492 WP_003899478.1.3553 WP_003899478.1.35553 WP_003899478.1.35555 WP_003899478.1.35561 WP_003899478.1.35602 WP_003899478.1.35635 WP_003899478.1.35657 WP_003899478.1.35687 WP_003899478.1.35689 WP_003899478.1.35707 WP_003899478.1.35754 WP_003899478.1.35767 WP_003899478.1.35770 WP_003899478.1.35771 WP_003899478.1.35780 WP_003899478.1.35805 WP_003899478.1.35811 WP_003899478.1.35821 WP_003899478.1.3584 WP_003899478.1.35848 WP_003899478.1.35864 WP_003899478.1.35874 WP_003899478.1.35876 WP_003899478.1.35897 WP_003899478.1.35899 WP_003899478.1.35923 WP_003899478.1.3593 WP_003899478.1.35954 WP_003899478.1.36005 WP_003899478.1.36014 WP_003899478.1.36023 WP_003899478.1.36051 WP_003899478.1.36053 WP_003899478.1.36075 WP_003899478.1.36089 WP_003899478.1.36097 WP_003899478.1.36098 WP_003899478.1.36116 WP_003899478.1.36145 WP_003899478.1.36156 WP_003899478.1.36205 WP_003899478.1.36228 WP_003899478.1.36246 WP_003899478.1.36252 WP_003899478.1.36260 WP_003899478.1.36270 WP_003899478.1.36271 WP_003899478.1.36303 WP_003899478.1.36309 WP_003899478.1.36315 WP_003899478.1.36319 WP_003899478.1.36321 WP_003899478.1.36326 WP_003899478.1.3634 WP_003899478.1.36356 WP_003899478.1.36357 WP_003899478.1.3636 WP_003899478.1.36385 WP_003899478.1.36399 WP_003899478.1.36436 WP_003899478.1.36465 WP_003899478.1.36469 WP_003899478.1.36473 WP_003899478.1.36485 WP_003899478.1.36508 WP_003899478.1.36540 WP_003899478.1.36561 WP_003899478.1.36571 WP_003899478.1.36573 WP_003899478.1.36578 WP_003899478.1.36585 WP_003899478.1.36597 WP_003899478.1.36614 WP_003899478.1.36657 WP_003899478.1.36674 WP_003899478.1.36720 WP_003899478.1.36727 WP_003899478.1.36733 WP_003899478.1.36810 WP_003899478.1.36844 WP_003899478.1.36851 WP_003899478.1.36862 WP_003899478.1.36893 WP_003899478.1.36901 WP_003899478.1.36921 WP_003899478.1.36935 WP_003899478.1.36941 WP_003899478.1.3695 WP_003899478.1.36951 WP_003899478.1.3700 WP_003899478.1.37004 WP_003899478.1.37012 WP_003899478.1.37071 WP_003899478.1.37131 WP_003899478.1.37157 WP_003899478.1.37175 WP_003899478.1.37188 WP_003899478.1.37213 WP_003899478.1.37229 WP_003899478.1.3724 WP_003899478.1.37277 WP_003899478.1.37305 WP_003899478.1.37330 WP_003899478.1.37389 WP_003899478.1.37400 WP_003899478.1.37440 WP_003899478.1.37459 WP_003899478.1.37468 WP_003899478.1.37475 WP_003899478.1.37484 WP_003899478.1.37601 WP_003899478.1.37612 WP_003899478.1.37632 WP_003899478.1.37643 WP_003899478.1.37655 WP_003899478.1.37660 WP_003899478.1.37674 WP_003899478.1.37700 WP_003899478.1.37701 WP_003899478.1.37709 WP_003899478.1.37721 WP_003899478.1.37722 WP_003899478.1.37747 WP_003899478.1.37765 WP_003899478.1.37772 WP_003899478.1.37804 WP_003899478.1.37809 WP_003899478.1.37859 WP_003899478.1.37877 WP_003899478.1.37912 WP_003899478.1.37913 WP_003899478.1.37943 WP_003899478.1.37950 WP_003899478.1.37973 WP_003899478.1.37975 WP_003899478.1.37983 WP_003899478.1.38 WP_003899478.1.38002 WP_003899478.1.3802 WP_003899478.1.38039 WP_003899478.1.38040 WP_003899478.1.38067 WP_003899478.1.38068 WP_003899478.1.38135 WP_003899478.1.38138 WP_003899478.1.38144 WP_003899478.1.38158 WP_003899478.1.38159 WP_003899478.1.38210 WP_003899478.1.38233 WP_003899478.1.38240 WP_003899478.1.38299 WP_003899478.1.38332 WP_003899478.1.38380 WP_003899478.1.38384 WP_003899478.1.38398 WP_003899478.1.38402 WP_003899478.1.38418 WP_003899478.1.38421 WP_003899478.1.38466 WP_003899478.1.38483 WP_003899478.1.3849 WP_003899478.1.385 WP_003899478.1.38530 WP_003899478.1.38535 WP_003899478.1.38539 WP_003899478.1.38594 WP_003899478.1.38601 WP_003899478.1.38611 WP_003899478.1.38639 WP_003899478.1.38646 WP_003899478.1.38648 WP_003899478.1.38654 WP_003899478.1.38659 WP_003899478.1.38660 WP_003899478.1.38666 WP_003899478.1.38671 WP_003899478.1.38672 WP_003899478.1.38750 WP_003899478.1.38772 WP_003899478.1.38812 WP_003899478.1.38821 WP_003899478.1.38844 WP_003899478.1.38863 WP_003899478.1.38865 WP_003899478.1.38873 WP_003899478.1.3889 WP_003899478.1.38894 WP_003899478.1.38909 WP_003899478.1.38939 WP_003899478.1.38974 WP_003899478.1.38975 WP_003899478.1.38991 WP_003899478.1.39025 WP_003899478.1.39070 WP_003899478.1.39072 WP_003899478.1.39095 WP_003899478.1.39106 WP_003899478.1.39165 WP_003899478.1.39174 WP_003899478.1.39176 WP_003899478.1.39178 WP_003899478.1.39190 WP_003899478.1.39201 WP_003899478.1.39207 WP_003899478.1.39211 WP_003899478.1.39236 WP_003899478.1.39239 WP_003899478.1.39252 WP_003899478.1.39288 WP_003899478.1.39295 WP_003899478.1.39306 WP_003899478.1.39359 WP_003899478.1.39364 WP_003899478.1.39400 WP_003899478.1.39447 WP_003899478.1.3945 WP_003899478.1.39450 WP_003899478.1.39455 WP_003899478.1.3949 WP_003899478.1.39592 WP_003899478.1.39593 WP_003899478.1.396 WP_003899478.1.3960 WP_003899478.1.39616 WP_003899478.1.39654 WP_003899478.1.39657 WP_003899478.1.39661 WP_003899478.1.39674 WP_003899478.1.39678 WP_003899478.1.3968 WP_003899478.1.39694 WP_003899478.1.3971 WP_003899478.1.39728 WP_003899478.1.39739 WP_003899478.1.39748 WP_003899478.1.39751 WP_003899478.1.39759 WP_003899478.1.39801 WP_003899478.1.39804 WP_003899478.1.39848 WP_003899478.1.39877 WP_003899478.1.39925 WP_003899478.1.3994 WP_003899478.1.39959 WP_003899478.1.3996 WP_003899478.1.39960 WP_003899478.1.3997 WP_003899478.1.39980 WP_003899478.1.40000 WP_003899478.1.40028 WP_003899478.1.40029 WP_003899478.1.4003 WP_003899478.1.40094 WP_003899478.1.40096 WP_003899478.1.40150 WP_003899478.1.40156 WP_003899478.1.40174 WP_003899478.1.40186 WP_003899478.1.40276 WP_003899478.1.40277 WP_003899478.1.40323 WP_003899478.1.40336 WP_003899478.1.40353 WP_003899478.1.4036 WP_003899478.1.40372 WP_003899478.1.40402 WP_003899478.1.40413 WP_003899478.1.40451 WP_003899478.1.40455 WP_003899478.1.40523 WP_003899478.1.40543 WP_003899478.1.40641 WP_003899478.1.40646 WP_003899478.1.40651 WP_003899478.1.40653 WP_003899478.1.40705 WP_003899478.1.40723 WP_003899478.1.40731 WP_003899478.1.40735 WP_003899478.1.40799 WP_003899478.1.40852 WP_003899478.1.40876 WP_003899478.1.40881 WP_003899478.1.40922 WP_003899478.1.40948 WP_003899478.1.4095 WP_003899478.1.40956 WP_003899478.1.40957 WP_003899478.1.4097 WP_003899478.1.410 WP_003899478.1.41000 WP_003899478.1.41055 WP_003899478.1.41108 WP_003899478.1.41123 WP_003899478.1.41177 WP_003899478.1.41202 WP_003899478.1.41219 WP_003899478.1.41231 WP_003899478.1.41249 WP_003899478.1.4127 WP_003899478.1.41296 WP_003899478.1.41355 WP_003899478.1.41376 WP_003899478.1.41430 WP_003899478.1.41447 WP_003899478.1.41469 WP_003899478.1.41504 WP_003899478.1.41553 WP_003899478.1.41564 WP_003899478.1.41583 WP_003899478.1.41616 WP_003899478.1.41632 WP_003899478.1.41635 WP_003899478.1.41648 WP_003899478.1.41660 WP_003899478.1.41685 WP_003899478.1.41695 WP_003899478.1.41704 WP_003899478.1.4171 WP_003899478.1.41719 WP_003899478.1.41733 WP_003899478.1.41744 WP_003899478.1.41774 WP_003899478.1.41791 WP_003899478.1.41803 WP_003899478.1.41820 WP_003899478.1.41828 WP_003899478.1.41829 WP_003899478.1.41860 WP_003899478.1.41912 WP_003899478.1.41921 WP_003899478.1.41933 WP_003899478.1.41944 WP_003899478.1.42043 WP_003899478.1.42075 WP_003899478.1.42094 WP_003899478.1.4212 WP_003899478.1.42122 WP_003899478.1.42134 WP_003899478.1.42183 WP_003899478.1.42188 WP_003899478.1.42201 WP_003899478.1.42202 WP_003899478.1.42208 WP_003899478.1.42247 WP_003899478.1.42255 WP_003899478.1.42273 WP_003899478.1.42278 WP_003899478.1.42304 WP_003899478.1.42309 WP_003899478.1.42370 WP_003899478.1.42385 WP_003899478.1.42400 WP_003899478.1.42409 WP_003899478.1.42414 WP_003899478.1.42417 WP_003899478.1.42430 WP_003899478.1.42461 WP_003899478.1.42465 WP_003899478.1.42467 WP_003899478.1.42473 WP_003899478.1.42474 WP_003899478.1.4248 WP_003899478.1.42494 WP_003899478.1.42519 WP_003899478.1.42524 WP_003899478.1.42534 WP_003899478.1.4255 WP_003899478.1.42562 WP_003899478.1.42568 WP_003899478.1.42570 WP_003899478.1.42618 WP_003899478.1.42660 WP_003899478.1.42695 WP_003899478.1.42704 WP_003899478.1.42705 WP_003899478.1.42722 WP_003899478.1.42777 WP_003899478.1.42782 WP_003899478.1.42835 WP_003899478.1.42839 WP_003899478.1.42842 WP_003899478.1.42916 WP_003899478.1.42971 WP_003899478.1.43005 WP_003899478.1.43009 WP_003899478.1.43053 WP_003899478.1.43082 WP_003899478.1.43087 WP_003899478.1.43098 WP_003899478.1.43208 WP_003899478.1.43236 WP_003899478.1.43246 WP_003899478.1.43255 WP_003899478.1.43266 WP_003899478.1.43269 WP_003899478.1.43273 WP_003899478.1.43296 WP_003899478.1.43306 WP_003899478.1.4335 WP_003899478.1.43368 WP_003899478.1.43395 WP_003899478.1.43457 WP_003899478.1.43462 WP_003899478.1.43475 WP_003899478.1.43478 WP_003899478.1.43484 WP_003899478.1.43557 WP_003899478.1.43578 WP_003899478.1.43588 WP_003899478.1.43643 WP_003899478.1.43664 WP_003899478.1.43684 WP_003899478.1.43706 WP_003899478.1.43716 WP_003899478.1.4377 WP_003899478.1.43781 WP_003899478.1.43794 WP_003899478.1.43815 WP_003899478.1.43846 WP_003899478.1.43861 WP_003899478.1.43863 WP_003899478.1.43866 WP_003899478.1.43872 WP_003899478.1.43885 WP_003899478.1.4390 WP_003899478.1.43902 WP_003899478.1.43921 WP_003899478.1.43937 WP_003899478.1.43960 WP_003899478.1.43965 WP_003899478.1.4399 WP_003899478.1.43993 WP_003899478.1.43996 WP_003899478.1.44 WP_003899478.1.44001 WP_003899478.1.44008 WP_003899478.1.44016 WP_003899478.1.44033 WP_003899478.1.44037 WP_003899478.1.44041 WP_003899478.1.44070 WP_003899478.1.44071 WP_003899478.1.44076 WP_003899478.1.44104 WP_003899478.1.44124 WP_003899478.1.44169 WP_003899478.1.44219 WP_003899478.1.44237 WP_003899478.1.44277 WP_003899478.1.44279 WP_003899478.1.44336 WP_003899478.1.44355 WP_003899478.1.44358 WP_003899478.1.4438 WP_003899478.1.44392 WP_003899478.1.4441 WP_003899478.1.44415 WP_003899478.1.44464 WP_003899478.1.44466 WP_003899478.1.44489 WP_003899478.1.44492 WP_003899478.1.44494 WP_003899478.1.44500 WP_003899478.1.44519 WP_003899478.1.44526 WP_003899478.1.44532 WP_003899478.1.44534 WP_003899478.1.44562 WP_003899478.1.44589 WP_003899478.1.44597 WP_003899478.1.44600 WP_003899478.1.44602 WP_003899478.1.44615 WP_003899478.1.4464 WP_003899478.1.44651 WP_003899478.1.44659 WP_003899478.1.44665 WP_003899478.1.44694 WP_003899478.1.44700 WP_003899478.1.44713 WP_003899478.1.44735 WP_003899478.1.44740 WP_003899478.1.44757 WP_003899478.1.4476 WP_003899478.1.44761 WP_003899478.1.44767 WP_003899478.1.44776 WP_003899478.1.44779 WP_003899478.1.44786 WP_003899478.1.44808 WP_003899478.1.44864 WP_003899478.1.44901 WP_003899478.1.44908 WP_003899478.1.44913 WP_003899478.1.4492 WP_003899478.1.44939 WP_003899478.1.44979 WP_003899478.1.44981 WP_003899478.1.45002 WP_003899478.1.45011 WP_003899478.1.4504 WP_003899478.1.45062 WP_003899478.1.45066 WP_003899478.1.45113 WP_003899478.1.45129 WP_003899478.1.45135 WP_003899478.1.45147 WP_003899478.1.45168 WP_003899478.1.4517 WP_003899478.1.45181 WP_003899478.1.45185 WP_003899478.1.45192 WP_003899478.1.45200 WP_003899478.1.45205 WP_003899478.1.45249 WP_003899478.1.4526 WP_003899478.1.45286 WP_003899478.1.45326 WP_003899478.1.45374 WP_003899478.1.45390 WP_003899478.1.454 WP_003899478.1.45407 WP_003899478.1.45451 WP_003899478.1.45453 WP_003899478.1.45460 WP_003899478.1.45463 WP_003899478.1.45470 WP_003899478.1.45474 WP_003899478.1.45491 WP_003899478.1.45510 WP_003899478.1.45563 WP_003899478.1.45584 WP_003899478.1.45590 WP_003899478.1.45619 WP_003899478.1.45626 WP_003899478.1.45631 WP_003899478.1.45666 WP_003899478.1.45697 WP_003899478.1.4571 WP_003899478.1.45731 WP_003899478.1.45743 WP_003899478.1.45765 WP_003899478.1.45776 WP_003899478.1.45783 WP_003899478.1.45805 WP_003899478.1.45815 WP_003899478.1.45849 WP_003899478.1.45867 WP_003899478.1.45884 WP_003899478.1.4590 WP_003899478.1.45923 WP_003899478.1.45926 WP_003899478.1.45963 WP_003899478.1.45989 WP_003899478.1.45992 WP_003899478.1.46025 WP_003899478.1.46083 WP_003899478.1.46090 WP_003899478.1.46092 WP_003899478.1.46100 WP_003899478.1.46101 WP_003899478.1.46103 WP_003899478.1.46107 WP_003899478.1.46127 WP_003899478.1.46128 WP_003899478.1.46129 WP_003899478.1.46141 WP_003899478.1.46150 WP_003899478.1.46201 WP_003899478.1.46226 WP_003899478.1.46253 WP_003899478.1.46268 WP_003899478.1.46285 WP_003899478.1.46300 WP_003899478.1.46313 WP_003899478.1.46336 WP_003899478.1.46365 WP_003899478.1.46370 WP_003899478.1.46402 WP_003899478.1.46411 WP_003899478.1.4644 WP_003899478.1.46442 WP_003899478.1.46453 WP_003899478.1.46463 WP_003899478.1.46478 WP_003899478.1.46492 WP_003899478.1.46521 WP_003899478.1.4653 WP_003899478.1.46532 WP_003899478.1.46539 WP_003899478.1.46568 WP_003899478.1.46585 WP_003899478.1.46609 WP_003899478.1.46625 WP_003899478.1.46642 WP_003899478.1.46647 WP_003899478.1.46674 WP_003899478.1.46724 WP_003899478.1.46758 WP_003899478.1.46773 WP_003899478.1.46777 WP_003899478.1.46786 WP_003899478.1.46792 WP_003899478.1.46847 WP_003899478.1.46851 WP_003899478.1.4687 WP_003899478.1.46897 WP_003899478.1.46936 WP_003899478.1.46980 WP_003899478.1.47011 WP_003899478.1.47012 WP_003899478.1.47066 WP_003899478.1.47077 WP_003899478.1.47083 WP_003899478.1.47106 WP_003899478.1.47142 WP_003899478.1.47147 WP_003899478.1.47166 WP_003899478.1.47178 WP_003899478.1.47179 WP_003899478.1.47194 WP_003899478.1.47207 WP_003899478.1.47210 WP_003899478.1.47261 WP_003899478.1.47262 WP_003899478.1.47402 WP_003899478.1.47423 WP_003899478.1.47467 WP_003899478.1.47502 WP_003899478.1.4751 WP_003899478.1.47511 WP_003899478.1.47537 WP_003899478.1.47540 WP_003899478.1.47568 WP_003899478.1.47572 WP_003899478.1.47588 WP_003899478.1.47636 WP_003899478.1.4764 WP_003899478.1.47679 WP_003899478.1.47681 WP_003899478.1.47690 WP_003899478.1.4771 WP_003899478.1.47717 WP_003899478.1.47743 WP_003899478.1.47754 WP_003899478.1.47773 WP_003899478.1.47776 WP_003899478.1.47780 WP_003899478.1.47805 WP_003899478.1.47832 WP_003899478.1.47847 WP_003899478.1.47858 WP_003899478.1.47861 WP_003899478.1.47868 WP_003899478.1.47893 WP_003899478.1.47899 WP_003899478.1.479 WP_003899478.1.47912 WP_003899478.1.47913 WP_003899478.1.47926 WP_003899478.1.4794 WP_003899478.1.47943 WP_003899478.1.47944 WP_003899478.1.47959 WP_003899478.1.47974 WP_003899478.1.47993 WP_003899478.1.48004 WP_003899478.1.48039 WP_003899478.1.48050 WP_003899478.1.48084 WP_003899478.1.48097 WP_003899478.1.48101 WP_003899478.1.48109 WP_003899478.1.4813 WP_003899478.1.48130 WP_003899478.1.48135 WP_003899478.1.48152 WP_003899478.1.48155 WP_003899478.1.48170 WP_003899478.1.48177 WP_003899478.1.48185 WP_003899478.1.48204 WP_003899478.1.48219 WP_003899478.1.48240 WP_003899478.1.48256 WP_003899478.1.48264 WP_003899478.1.48287 WP_003899478.1.48330 WP_003899478.1.48333 WP_003899478.1.48348 WP_003899478.1.48354 WP_003899478.1.48372 WP_003899478.1.48383 WP_003899478.1.48388 WP_003899478.1.48419 WP_003899478.1.48423 WP_003899478.1.48443 WP_003899478.1.48450 WP_003899478.1.48462 WP_003899478.1.48543 WP_003899478.1.48550 WP_003899478.1.48605 WP_003899478.1.48618 WP_003899478.1.4863 WP_003899478.1.48648 WP_003899478.1.48658 WP_003899478.1.48666 WP_003899478.1.48687 WP_003899478.1.48779 WP_003899478.1.4878 WP_003899478.1.48798 WP_003899478.1.48802 WP_003899478.1.48826 WP_003899478.1.48831 WP_003899478.1.48843 WP_003899478.1.48857 WP_003899478.1.4890 WP_003899478.1.48946 WP_003899478.1.48979 WP_003899478.1.49017 WP_003899478.1.49048 WP_003899478.1.49059 WP_003899478.1.4906 WP_003899478.1.4907 WP_003899478.1.49103 WP_003899478.1.49110 WP_003899478.1.49111 WP_003899478.1.49112 WP_003899478.1.4919 WP_003899478.1.49251 WP_003899478.1.49254 WP_003899478.1.49263 WP_003899478.1.49291 WP_003899478.1.49296 WP_003899478.1.49335 WP_003899478.1.49337 WP_003899478.1.49419 WP_003899478.1.49426 WP_003899478.1.49437 WP_003899478.1.49439 WP_003899478.1.49474 WP_003899478.1.49506 WP_003899478.1.49516 WP_003899478.1.49523 WP_003899478.1.49526 WP_003899478.1.49532 WP_003899478.1.49588 WP_003899478.1.4959 WP_003899478.1.49678 WP_003899478.1.49687 WP_003899478.1.49699 WP_003899478.1.49709 WP_003899478.1.4971 WP_003899478.1.4972 WP_003899478.1.49736 WP_003899478.1.49746 WP_003899478.1.49764 WP_003899478.1.49773 WP_003899478.1.49814 WP_003899478.1.49815 WP_003899478.1.49816 WP_003899478.1.49857 WP_003899478.1.49878 WP_003899478.1.49944 WP_003899478.1.4999 WP_003899478.1.49990 WP_003899478.1.50068 WP_003899478.1.50077 WP_003899478.1.5008 WP_003899478.1.50081 WP_003899478.1.50122 WP_003899478.1.50126 WP_003899478.1.50149 WP_003899478.1.50162 WP_003899478.1.5018 WP_003899478.1.50194 WP_003899478.1.50235 WP_003899478.1.50249 WP_003899478.1.50265 WP_003899478.1.50271 WP_003899478.1.50324 WP_003899478.1.50347 WP_003899478.1.50372 WP_003899478.1.50398 WP_003899478.1.50466 WP_003899478.1.50472 WP_003899478.1.5048 WP_003899478.1.50498 WP_003899478.1.5050 WP_003899478.1.50540 WP_003899478.1.50554 WP_003899478.1.50557 WP_003899478.1.50601 WP_003899478.1.50610 WP_003899478.1.50632 WP_003899478.1.50633 WP_003899478.1.50642 WP_003899478.1.50655 WP_003899478.1.50659 WP_003899478.1.50683 WP_003899478.1.50689 WP_003899478.1.50692 WP_003899478.1.50714 WP_003899478.1.50729 WP_003899478.1.50756 WP_003899478.1.50784 WP_003899478.1.50794 WP_003899478.1.50860 WP_003899478.1.50868 WP_003899478.1.50877 WP_003899478.1.5096 WP_003899478.1.50981 WP_003899478.1.50987 WP_003899478.1.51003 WP_003899478.1.51009 WP_003899478.1.51037 WP_003899478.1.51082 WP_003899478.1.51101 WP_003899478.1.51149 WP_003899478.1.51156 WP_003899478.1.51157 WP_003899478.1.51213 WP_003899478.1.51232 WP_003899478.1.51239 WP_003899478.1.51247 WP_003899478.1.51266 WP_003899478.1.51291 WP_003899478.1.51294 WP_003899478.1.51301 WP_003899478.1.51329 WP_003899478.1.51391 WP_003899478.1.51422 WP_003899478.1.51445 WP_003899478.1.51455 WP_003899478.1.51466 WP_003899478.1.51468 WP_003899478.1.51478 WP_003899478.1.51497 WP_003899478.1.51520 WP_003899478.1.51593 WP_003899478.1.51628 WP_003899478.1.5164 WP_003899478.1.51647 WP_003899478.1.51660 WP_003899478.1.51696 WP_003899478.1.51721 WP_003899478.1.51788 WP_003899478.1.51795 WP_003899478.1.51801 WP_003899478.1.51817 WP_003899478.1.51819 WP_003899478.1.51923 WP_003899478.1.51942 WP_003899478.1.51948 WP_003899478.1.51963 WP_003899478.1.51969 WP_003899478.1.52000 WP_003899478.1.52001 WP_003899478.1.52003 WP_003899478.1.52006 WP_003899478.1.52036 WP_003899478.1.52038 WP_003899478.1.52046 WP_003899478.1.52059 WP_003899478.1.52069 WP_003899478.1.52082 WP_003899478.1.52102 WP_003899478.1.52106 WP_003899478.1.52166 WP_003899478.1.52168 WP_003899478.1.52173 WP_003899478.1.52178 WP_003899478.1.52216 WP_003899478.1.52238 WP_003899478.1.52241 WP_003899478.1.52280 WP_003899478.1.52314 WP_003899478.1.52385 WP_003899478.1.52390 WP_003899478.1.524 WP_003899478.1.52460 WP_003899478.1.52485 WP_003899478.1.52486 WP_003899478.1.52495 WP_003899478.1.52504 WP_003899478.1.52522 WP_003899478.1.52531 WP_003899478.1.52545 WP_003899478.1.52553 WP_003899478.1.52563 WP_003899478.1.52564 WP_003899478.1.52574 WP_003899478.1.52641 WP_003899478.1.52673 WP_003899478.1.52674 WP_003899478.1.52708 WP_003899478.1.52713 WP_003899478.1.52761 WP_003899478.1.52778 WP_003899478.1.52791 WP_003899478.1.52797 WP_003899478.1.52818 WP_003899478.1.52872 WP_003899478.1.52873 WP_003899478.1.52891 WP_003899478.1.52892 WP_003899478.1.52909 WP_003899478.1.52970 WP_003899478.1.52998 WP_003899478.1.53053 WP_003899478.1.53056 WP_003899478.1.5306 WP_003899478.1.53088 WP_003899478.1.5309 WP_003899478.1.531 WP_003899478.1.53117 WP_003899478.1.53118 WP_003899478.1.53142 WP_003899478.1.53143 WP_003899478.1.53157 WP_003899478.1.53167 WP_003899478.1.53200 WP_003899478.1.53204 WP_003899478.1.53213 WP_003899478.1.53217 WP_003899478.1.53226 WP_003899478.1.53229 WP_003899478.1.53230 WP_003899478.1.53237 WP_003899478.1.53254 WP_003899478.1.53257 WP_003899478.1.5327 WP_003899478.1.53276 WP_003899478.1.53278 WP_003899478.1.53302 WP_003899478.1.5334 WP_003899478.1.5335 WP_003899478.1.53353 WP_003899478.1.53381 WP_003899478.1.53413 WP_003899478.1.53458 WP_003899478.1.53460 WP_003899478.1.53517 WP_003899478.1.53522 WP_003899478.1.53525 WP_003899478.1.53526 WP_003899478.1.53553 WP_003899478.1.53606 WP_003899478.1.53609 WP_003899478.1.53628 WP_003899478.1.53667 WP_003899478.1.53679 WP_003899478.1.53715 WP_003899478.1.53730 WP_003899478.1.53742 WP_003899478.1.53743 WP_003899478.1.53754 WP_003899478.1.53775 WP_003899478.1.53787 WP_003899478.1.53803 WP_003899478.1.53818 WP_003899478.1.53822 WP_003899478.1.53853 WP_003899478.1.53865 WP_003899478.1.53888 WP_003899478.1.53900 WP_003899478.1.53912 WP_003899478.1.53914 WP_003899478.1.53952 WP_003899478.1.53973 WP_003899478.1.5398 WP_003899478.1.5408 WP_003899478.1.54089 WP_003899478.1.54099 WP_003899478.1.54112 WP_003899478.1.54125 WP_003899478.1.54141 WP_003899478.1.54162 WP_003899478.1.54179 WP_003899478.1.54206 WP_003899478.1.54218 WP_003899478.1.54225 WP_003899478.1.54227 WP_003899478.1.54232 WP_003899478.1.54241 WP_003899478.1.54245 WP_003899478.1.54247 WP_003899478.1.54260 WP_003899478.1.54275 WP_003899478.1.54280 WP_003899478.1.5429 WP_003899478.1.54294 WP_003899478.1.54347 WP_003899478.1.54351 WP_003899478.1.54370 WP_003899478.1.54428 WP_003899478.1.54494 WP_003899478.1.54502 WP_003899478.1.54514 WP_003899478.1.54519 WP_003899478.1.5452 WP_003899478.1.54531 WP_003899478.1.54537 WP_003899478.1.54553 WP_003899478.1.54575 WP_003899478.1.54633 WP_003899478.1.54705 WP_003899478.1.54730 WP_003899478.1.54732 WP_003899478.1.5475 WP_003899478.1.54807 WP_003899478.1.54836 WP_003899478.1.54838 WP_003899478.1.54860 WP_003899478.1.54888 WP_003899478.1.54905 WP_003899478.1.54909 WP_003899478.1.54937 WP_003899478.1.54944 WP_003899478.1.54945 WP_003899478.1.54953 WP_003899478.1.54964 WP_003899478.1.55015 WP_003899478.1.55022 WP_003899478.1.55023 WP_003899478.1.55051 WP_003899478.1.55072 WP_003899478.1.55088 WP_003899478.1.55106 WP_003899478.1.55126 WP_003899478.1.55128 WP_003899478.1.55140 WP_003899478.1.55150 WP_003899478.1.55210 WP_003899478.1.55227 WP_003899478.1.55248 WP_003899478.1.55257 WP_003899478.1.55258 WP_003899478.1.55267 WP_003899478.1.55279 WP_003899478.1.55307 WP_003899478.1.55326 WP_003899478.1.55328 WP_003899478.1.55345 WP_003899478.1.55396 WP_003899478.1.55398 WP_003899478.1.55441 WP_003899478.1.55459 WP_003899478.1.55501 WP_003899478.1.55504 WP_003899478.1.55626 WP_003899478.1.55641 WP_003899478.1.5569 WP_003899478.1.55723 WP_003899478.1.55735 WP_003899478.1.5574 WP_003899478.1.55772 WP_003899478.1.55802 WP_003899478.1.55807 WP_003899478.1.55819 WP_003899478.1.55821 WP_003899478.1.5583 WP_003899478.1.55849 WP_003899478.1.55856 WP_003899478.1.55882 WP_003899478.1.55883 WP_003899478.1.55902 WP_003899478.1.55908 WP_003899478.1.55909 WP_003899478.1.5591 WP_003899478.1.55961 WP_003899478.1.55977 WP_003899478.1.55983 WP_003899478.1.56028 WP_003899478.1.56057 WP_003899478.1.56060 WP_003899478.1.56107 WP_003899478.1.56132 WP_003899478.1.56163 WP_003899478.1.56167 WP_003899478.1.56178 WP_003899478.1.56287 WP_003899478.1.56292 WP_003899478.1.56327 WP_003899478.1.56341 WP_003899478.1.56359 WP_003899478.1.56365 WP_003899478.1.56394 WP_003899478.1.56443 WP_003899478.1.56500 WP_003899478.1.56517 WP_003899478.1.56534 WP_003899478.1.5656 WP_003899478.1.56577 WP_003899478.1.56593 WP_003899478.1.56625 WP_003899478.1.56637 WP_003899478.1.56670 WP_003899478.1.56697 WP_003899478.1.567 WP_003899478.1.56701 WP_003899478.1.56709 WP_003899478.1.56729 WP_003899478.1.56743 WP_003899478.1.56755 WP_003899478.1.56764 WP_003899478.1.56769 WP_003899478.1.56795 WP_003899478.1.5681 WP_003899478.1.56827 WP_003899478.1.56839 WP_003899478.1.56863 WP_003899478.1.56869 WP_003899478.1.56915 WP_003899478.1.56926 WP_003899478.1.56961 WP_003899478.1.56972 WP_003899478.1.57023 WP_003899478.1.57035 WP_003899478.1.57077 WP_003899478.1.57087 WP_003899478.1.57134 WP_003899478.1.57151 WP_003899478.1.57169 WP_003899478.1.57208 WP_003899478.1.57212 WP_003899478.1.57230 WP_003899478.1.5724 WP_003899478.1.5725 WP_003899478.1.5727 WP_003899478.1.57273 WP_003899478.1.57314 WP_003899478.1.57326 WP_003899478.1.57328 WP_003899478.1.57331 WP_003899478.1.57340 WP_003899478.1.57351 WP_003899478.1.57352 WP_003899478.1.57380 WP_003899478.1.57430 WP_003899478.1.5744 WP_003899478.1.57440 WP_003899478.1.5745 WP_003899478.1.57461 WP_003899478.1.57469 WP_003899478.1.57489 WP_003899478.1.575 WP_003899478.1.57509 WP_003899478.1.57519 WP_003899478.1.57525 WP_003899478.1.57551 WP_003899478.1.5758 WP_003899478.1.57596 WP_003899478.1.57604 WP_003899478.1.57616 WP_003899478.1.57617 WP_003899478.1.57619 WP_003899478.1.57627 WP_003899478.1.57642 WP_003899478.1.57658 WP_003899478.1.57667 WP_003899478.1.57675 WP_003899478.1.57689 WP_003899478.1.57708 WP_003899478.1.57794 WP_003899478.1.57821 WP_003899478.1.57825 WP_003899478.1.57843 WP_003899478.1.57906 WP_003899478.1.57924 WP_003899478.1.57926 WP_003899478.1.57930 WP_003899478.1.57957 WP_003899478.1.57960 WP_003899478.1.57964 WP_003899478.1.57991 WP_003899478.1.58000 WP_003899478.1.58086 WP_003899478.1.58101 WP_003899478.1.58103 WP_003899478.1.58108 WP_003899478.1.5811 WP_003899478.1.58121 WP_003899478.1.58145 WP_003899478.1.58164 WP_003899478.1.58174 WP_003899478.1.582 WP_003899478.1.58202 WP_003899478.1.58209 WP_003899478.1.58215 WP_003899478.1.5824 WP_003899478.1.58250 WP_003899478.1.58259 WP_003899478.1.58283 WP_003899478.1.58288 WP_003899478.1.5830 WP_003899478.1.58303 WP_003899478.1.58311 WP_003899478.1.58330 WP_003899478.1.58359 WP_003899478.1.58386 WP_003899478.1.58393 WP_003899478.1.58431 WP_003899478.1.5844 WP_003899478.1.58457 WP_003899478.1.58488 WP_003899478.1.58518 WP_003899478.1.58559 WP_003899478.1.58567 WP_003899478.1.58573 WP_003899478.1.58602 WP_003899478.1.58612 WP_003899478.1.58619 WP_003899478.1.58630 WP_003899478.1.5865 WP_003899478.1.58671 WP_003899478.1.58690 WP_003899478.1.58702 WP_003899478.1.58743 WP_003899478.1.58754 WP_003899478.1.5879 WP_003899478.1.5881 WP_003899478.1.58824 WP_003899478.1.58848 WP_003899478.1.58857 WP_003899478.1.58891 WP_003899478.1.58892 WP_003899478.1.5890 WP_003899478.1.58904 WP_003899478.1.58921 WP_003899478.1.58930 WP_003899478.1.58939 WP_003899478.1.58941 WP_003899478.1.58953 WP_003899478.1.58961 WP_003899478.1.5898 WP_003899478.1.59025 WP_003899478.1.59029 WP_003899478.1.59037 WP_003899478.1.59044 WP_003899478.1.59088 WP_003899478.1.59112 WP_003899478.1.59130 WP_003899478.1.5914 WP_003899478.1.59147 WP_003899478.1.59166 WP_003899478.1.59205 WP_003899478.1.59237 WP_003899478.1.59240 WP_003899478.1.59253 WP_003899478.1.59254 WP_003899478.1.59270 WP_003899478.1.5928 WP_003899478.1.59304 WP_003899478.1.59305 WP_003899478.1.59309 WP_003899478.1.59316 WP_003899478.1.59328 WP_003899478.1.59338 WP_003899478.1.59388 WP_003899478.1.59487 WP_003899478.1.59537 WP_003899478.1.59561 WP_003899478.1.59677 WP_003899478.1.59722 WP_003899478.1.59727 WP_003899478.1.59732 WP_003899478.1.59738 WP_003899478.1.59750 WP_003899478.1.59757 WP_003899478.1.59808 WP_003899478.1.59850 WP_003899478.1.59856 WP_003899478.1.59860 WP_003899478.1.59861 WP_003899478.1.5987 WP_003899478.1.59878 WP_003899478.1.59888 WP_003899478.1.5996 WP_003899478.1.59961 WP_003899478.1.59974 WP_003899478.1.6000 WP_003899478.1.60007 WP_003899478.1.60016 WP_003899478.1.6003 WP_003899478.1.60047 WP_003899478.1.6007 WP_003899478.1.60121 WP_003899478.1.60125 WP_003899478.1.60135 WP_003899478.1.60139 WP_003899478.1.60152 WP_003899478.1.60171 WP_003899478.1.60197 WP_003899478.1.6020 WP_003899478.1.60205 WP_003899478.1.60207 WP_003899478.1.60215 WP_003899478.1.60217 WP_003899478.1.60267 WP_003899478.1.60288 WP_003899478.1.60301 WP_003899478.1.60305 WP_003899478.1.60312 WP_003899478.1.60313 WP_003899478.1.60314 WP_003899478.1.60367 WP_003899478.1.60376 WP_003899478.1.60403 WP_003899478.1.60421 WP_003899478.1.60451 WP_003899478.1.60460 WP_003899478.1.60479 WP_003899478.1.60512 WP_003899478.1.60573 WP_003899478.1.60583 WP_003899478.1.60632 WP_003899478.1.60657 WP_003899478.1.60687 WP_003899478.1.60689 WP_003899478.1.60727 WP_003899478.1.60738 WP_003899478.1.60763 WP_003899478.1.6077 WP_003899478.1.60791 WP_003899478.1.60834 WP_003899478.1.60870 WP_003899478.1.60878 WP_003899478.1.60879 WP_003899478.1.60913 WP_003899478.1.60978 WP_003899478.1.61000 WP_003899478.1.61001 WP_003899478.1.61012 WP_003899478.1.61015 WP_003899478.1.61037 WP_003899478.1.61052 WP_003899478.1.61065 WP_003899478.1.61100 WP_003899478.1.61101 WP_003899478.1.61138 WP_003899478.1.61142 WP_003899478.1.61198 WP_003899478.1.612 WP_003899478.1.61234 WP_003899478.1.61256 WP_003899478.1.61281 WP_003899478.1.61314 WP_003899478.1.61321 WP_003899478.1.61326 WP_003899478.1.61328 WP_003899478.1.61368 WP_003899478.1.61391 WP_003899478.1.61406 WP_003899478.1.61409 WP_003899478.1.61420 WP_003899478.1.61422 WP_003899478.1.61425 WP_003899478.1.61428 WP_003899478.1.61469 WP_003899478.1.61494 WP_003899478.1.61522 WP_003899478.1.61552 WP_003899478.1.61557 WP_003899478.1.61567 WP_003899478.1.61571 WP_003899478.1.61573 WP_003899478.1.61584 WP_003899478.1.61586 WP_003899478.1.6159 WP_003899478.1.61592 WP_003899478.1.6160 WP_003899478.1.61614 WP_003899478.1.6163 WP_003899478.1.61655 WP_003899478.1.61665 WP_003899478.1.61669 WP_003899478.1.61682 WP_003899478.1.61692 WP_003899478.1.61719 WP_003899478.1.61728 WP_003899478.1.61750 WP_003899478.1.61754 WP_003899478.1.61755 WP_003899478.1.61757 WP_003899478.1.61778 WP_003899478.1.6179 WP_003899478.1.61793 WP_003899478.1.61816 WP_003899478.1.61842 WP_003899478.1.61850 WP_003899478.1.61862 WP_003899478.1.61865 WP_003899478.1.61868 WP_003899478.1.61911 WP_003899478.1.61925 WP_003899478.1.61941 WP_003899478.1.61953 WP_003899478.1.61979 WP_003899478.1.61986 WP_003899478.1.61987 WP_003899478.1.61998 WP_003899478.1.62021 WP_003899478.1.62087 WP_003899478.1.62089 WP_003899478.1.62101 WP_003899478.1.62104 WP_003899478.1.6211 WP_003899478.1.62132 WP_003899478.1.62162 WP_003899478.1.62225 WP_003899478.1.62230 WP_003899478.1.62249 WP_003899478.1.62270 WP_003899478.1.62281 WP_003899478.1.62307 WP_003899478.1.6231 WP_003899478.1.62359 WP_003899478.1.62360 WP_003899478.1.62371 WP_003899478.1.62379 WP_003899478.1.62408 WP_003899478.1.62449 WP_003899478.1.62468 WP_003899478.1.6248 WP_003899478.1.62508 WP_003899478.1.62565 WP_003899478.1.62594 WP_003899478.1.62606 WP_003899478.1.62616 WP_003899478.1.62666 WP_003899478.1.62687 WP_003899478.1.62715 WP_003899478.1.62730 WP_003899478.1.62738 WP_003899478.1.62761 WP_003899478.1.62766 WP_003899478.1.62786 WP_003899478.1.62813 WP_003899478.1.62839 WP_003899478.1.62841 WP_003899478.1.62909 WP_003899478.1.62936 WP_003899478.1.6294 WP_003899478.1.6295 WP_003899478.1.62962 WP_003899478.1.63007 WP_003899478.1.63019 WP_003899478.1.63032 WP_003899478.1.63037 WP_003899478.1.63064 WP_003899478.1.63066 WP_003899478.1.63072 WP_003899478.1.6308 WP_003899478.1.63081 WP_003899478.1.63106 WP_003899478.1.6314 WP_003899478.1.63144 WP_003899478.1.63154 WP_003899478.1.63160 WP_003899478.1.63161 WP_003899478.1.63166 WP_003899478.1.63175 WP_003899478.1.63194 WP_003899478.1.6322 WP_003899478.1.63222 WP_003899478.1.63247 WP_003899478.1.63291 WP_003899478.1.63312 WP_003899478.1.63317 WP_003899478.1.63331 WP_003899478.1.63384 WP_003899478.1.63403 WP_003899478.1.63424 WP_003899478.1.63428 WP_003899478.1.6345 WP_003899478.1.63464 WP_003899478.1.63483 WP_003899478.1.63502 WP_003899478.1.63504 WP_003899478.1.63522 WP_003899478.1.63530 WP_003899478.1.63538 WP_003899478.1.63567 WP_003899478.1.63596 WP_003899478.1.63600 WP_003899478.1.63623 WP_003899478.1.63624 WP_003899478.1.63625 WP_003899478.1.63627 WP_003899478.1.63654 WP_003899478.1.63662 WP_003899478.1.63711 WP_003899478.1.63734 WP_003899478.1.63807 WP_003899478.1.63819 WP_003899478.1.63844 WP_003899478.1.63888 WP_003899478.1.63913 WP_003899478.1.63915 WP_003899478.1.63918 WP_003899478.1.63961 WP_003899478.1.63970 WP_003899478.1.64000 WP_003899478.1.64027 WP_003899478.1.64058 WP_003899478.1.6407 WP_003899478.1.64082 WP_003899478.1.64091 WP_003899478.1.64102 WP_003899478.1.64104 WP_003899478.1.64119 WP_003899478.1.64169 WP_003899478.1.64219 WP_003899478.1.6422 WP_003899478.1.64222 WP_003899478.1.64223 WP_003899478.1.64235 WP_003899478.1.64249 WP_003899478.1.6427 WP_003899478.1.64278 WP_003899478.1.64287 WP_003899478.1.64414 WP_003899478.1.64419 WP_003899478.1.6443 WP_003899478.1.64463 WP_003899478.1.64480 WP_003899478.1.64497 WP_003899478.1.64506 WP_003899478.1.64511 WP_003899478.1.64513 WP_003899478.1.64514 WP_003899478.1.64515 WP_003899478.1.64522 WP_003899478.1.64526 WP_003899478.1.64543 WP_003899478.1.6456 WP_003899478.1.64567 WP_003899478.1.64588 WP_003899478.1.64589 WP_003899478.1.64594 WP_003899478.1.64595 WP_003899478.1.64608 WP_003899478.1.64629 WP_003899478.1.64664 WP_003899478.1.64669 WP_003899478.1.64672 WP_003899478.1.64680 WP_003899478.1.64682 WP_003899478.1.64727 WP_003899478.1.64774 WP_003899478.1.64776 WP_003899478.1.64802 WP_003899478.1.64832 WP_003899478.1.6486 WP_003899478.1.64870 WP_003899478.1.64898 WP_003899478.1.64922 WP_003899478.1.64924 WP_003899478.1.6493 WP_003899478.1.64937 WP_003899478.1.64941 WP_003899478.1.64966 WP_003899478.1.65001 WP_003899478.1.65026 WP_003899478.1.65053 WP_003899478.1.65070 WP_003899478.1.65079 WP_003899478.1.65102 WP_003899478.1.65157 WP_003899478.1.65229 WP_003899478.1.6523 WP_003899478.1.65253 WP_003899478.1.65289 WP_003899478.1.65315 WP_003899478.1.65329 WP_003899478.1.65359 WP_003899478.1.6536 WP_003899478.1.65374 WP_003899478.1.65414 WP_003899478.1.65416 WP_003899478.1.65433 WP_003899478.1.65455 WP_003899478.1.65467 WP_003899478.1.65488 WP_003899478.1.65529 WP_003899478.1.65539 WP_003899478.1.65583 WP_003899478.1.65612 WP_003899478.1.65623 WP_003899478.1.65635 WP_003899478.1.65637 WP_003899478.1.65648 WP_003899478.1.65683 WP_003899478.1.65686 WP_003899478.1.65688 WP_003899478.1.65707 WP_003899478.1.65733 WP_003899478.1.65746 WP_003899478.1.65747 WP_003899478.1.65759 WP_003899478.1.65816 WP_003899478.1.65830 WP_003899478.1.65858 WP_003899478.1.65862 WP_003899478.1.65869 WP_003899478.1.65893 WP_003899478.1.65929 WP_003899478.1.65932 WP_003899478.1.65958 WP_003899478.1.65974 WP_003899478.1.66004 WP_003899478.1.66013 WP_003899478.1.6606 WP_003899478.1.66089 WP_003899478.1.66149 WP_003899478.1.66229 WP_003899478.1.66276 WP_003899478.1.66293 WP_003899478.1.66297 WP_003899478.1.66323 WP_003899478.1.6633 WP_003899478.1.66334 WP_003899478.1.66355 WP_003899478.1.66367 WP_003899478.1.66394 WP_003899478.1.66396 WP_003899478.1.66451 WP_003899478.1.66455 WP_003899478.1.66457 WP_003899478.1.66460 WP_003899478.1.66464 WP_003899478.1.66466 WP_003899478.1.66487 WP_003899478.1.66504 WP_003899478.1.66544 WP_003899478.1.66580 WP_003899478.1.66582 WP_003899478.1.66612 WP_003899478.1.66615 WP_003899478.1.66617 WP_003899478.1.66635 WP_003899478.1.66656 WP_003899478.1.66663 WP_003899478.1.66675 WP_003899478.1.66715 WP_003899478.1.66718 WP_003899478.1.66762 WP_003899478.1.66776 WP_003899478.1.66808 WP_003899478.1.66817 WP_003899478.1.66819 WP_003899478.1.66826 WP_003899478.1.66830 WP_003899478.1.66842 WP_003899478.1.66878 WP_003899478.1.66880 WP_003899478.1.66961 WP_003899478.1.67005 WP_003899478.1.6704 WP_003899478.1.67044 WP_003899478.1.67061 WP_003899478.1.67098 WP_003899478.1.67146 WP_003899478.1.67170 WP_003899478.1.67197 WP_003899478.1.67198 WP_003899478.1.6720 WP_003899478.1.67207 WP_003899478.1.67218 WP_003899478.1.67220 WP_003899478.1.67225 WP_003899478.1.67231 WP_003899478.1.6724 WP_003899478.1.67257 WP_003899478.1.67298 WP_003899478.1.67307 WP_003899478.1.67324 WP_003899478.1.67346 WP_003899478.1.67354 WP_003899478.1.67360 WP_003899478.1.67381 WP_003899478.1.67396 WP_003899478.1.67417 WP_003899478.1.67422 WP_003899478.1.67453 WP_003899478.1.67459 WP_003899478.1.6746 WP_003899478.1.67473 WP_003899478.1.67481 WP_003899478.1.67482 WP_003899478.1.67496 WP_003899478.1.67499 WP_003899478.1.67516 WP_003899478.1.67523 WP_003899478.1.67536 WP_003899478.1.67575 WP_003899478.1.67587 WP_003899478.1.67598 WP_003899478.1.67600 WP_003899478.1.67602 WP_003899478.1.67630 WP_003899478.1.67679 WP_003899478.1.67692 WP_003899478.1.67744 WP_003899478.1.6775 WP_003899478.1.67750 WP_003899478.1.6777 WP_003899478.1.67809 WP_003899478.1.67816 WP_003899478.1.67844 WP_003899478.1.67848 WP_003899478.1.67870 WP_003899478.1.67888 WP_003899478.1.67915 WP_003899478.1.67945 WP_003899478.1.67949 WP_003899478.1.67980 WP_003899478.1.67982 WP_003899478.1.68022 WP_003899478.1.68029 WP_003899478.1.68037 WP_003899478.1.68038 WP_003899478.1.68045 WP_003899478.1.68057 WP_003899478.1.68083 WP_003899478.1.68088 WP_003899478.1.68106 WP_003899478.1.68110 WP_003899478.1.68153 WP_003899478.1.68164 WP_003899478.1.68169 WP_003899478.1.68193 WP_003899478.1.68212 WP_003899478.1.68227 WP_003899478.1.68243 WP_003899478.1.6825 WP_003899478.1.68297 WP_003899478.1.68309 WP_003899478.1.68325 WP_003899478.1.68329 WP_003899478.1.68340 WP_003899478.1.68384 WP_003899478.1.68388 WP_003899478.1.68429 WP_003899478.1.68433 WP_003899478.1.68444 WP_003899478.1.68465 WP_003899478.1.68484 WP_003899478.1.68518 WP_003899478.1.68569 WP_003899478.1.68576 WP_003899478.1.68580 WP_003899478.1.68586 WP_003899478.1.68623 WP_003899478.1.68624 WP_003899478.1.68637 WP_003899478.1.68646 WP_003899478.1.68667 WP_003899478.1.68669 WP_003899478.1.68672 WP_003899478.1.68684 WP_003899478.1.68704 WP_003899478.1.68708 WP_003899478.1.6872 WP_003899478.1.68730 WP_003899478.1.68734 WP_003899478.1.68748 WP_003899478.1.68754 WP_003899478.1.6876 WP_003899478.1.68761 WP_003899478.1.68763 WP_003899478.1.68766 WP_003899478.1.68774 WP_003899478.1.68796 WP_003899478.1.68824 WP_003899478.1.68832 WP_003899478.1.68833 WP_003899478.1.68841 WP_003899478.1.68859 WP_003899478.1.68876 WP_003899478.1.68906 WP_003899478.1.68916 WP_003899478.1.68923 WP_003899478.1.68945 WP_003899478.1.6896 WP_003899478.1.68981 WP_003899478.1.68984 WP_003899478.1.68997 WP_003899478.1.69008 WP_003899478.1.69076 WP_003899478.1.69079 WP_003899478.1.6908 WP_003899478.1.69082 WP_003899478.1.69178 WP_003899478.1.69181 WP_003899478.1.69208 WP_003899478.1.69231 WP_003899478.1.69256 WP_003899478.1.69311 WP_003899478.1.69315 WP_003899478.1.69322 WP_003899478.1.69342 WP_003899478.1.6935 WP_003899478.1.6936 WP_003899478.1.69369 WP_003899478.1.69374 WP_003899478.1.69398 WP_003899478.1.69401 WP_003899478.1.69426 WP_003899478.1.69427 WP_003899478.1.69429 WP_003899478.1.6949 WP_003899478.1.6951 WP_003899478.1.69511 WP_003899478.1.69526 WP_003899478.1.69528 WP_003899478.1.69547 WP_003899478.1.69573 WP_003899478.1.69581 WP_003899478.1.6960 WP_003899478.1.69617 WP_003899478.1.69634 WP_003899478.1.69647 WP_003899478.1.69659 WP_003899478.1.69673 WP_003899478.1.69682 WP_003899478.1.69684 WP_003899478.1.69686 WP_003899478.1.69707 WP_003899478.1.69709 WP_003899478.1.69723 WP_003899478.1.69736 WP_003899478.1.69778 WP_003899478.1.69802 WP_003899478.1.69845 WP_003899478.1.69870 WP_003899478.1.69873 WP_003899478.1.69898 WP_003899478.1.69913 WP_003899478.1.69925 WP_003899478.1.69931 WP_003899478.1.69938 WP_003899478.1.69955 WP_003899478.1.69957 WP_003899478.1.69981 WP_003899478.1.69990 WP_003899478.1.70 WP_003899478.1.70000 WP_003899478.1.70017 WP_003899478.1.70032 WP_003899478.1.70055 WP_003899478.1.70062 WP_003899478.1.70072 WP_003899478.1.70131 WP_003899478.1.70132 WP_003899478.1.7022 WP_003899478.1.70227 WP_003899478.1.70255 WP_003899478.1.70274 WP_003899478.1.7029 WP_003899478.1.70325 WP_003899478.1.70328 WP_003899478.1.70356 WP_003899478.1.70364 WP_003899478.1.70368 WP_003899478.1.70369 WP_003899478.1.70418 WP_003899478.1.70422 WP_003899478.1.70435 WP_003899478.1.70444 WP_003899478.1.70463 WP_003899478.1.70471 WP_003899478.1.70480 WP_003899478.1.70494 WP_003899478.1.70498 WP_003899478.1.70525 WP_003899478.1.70573 WP_003899478.1.70577 WP_003899478.1.70610 WP_003899478.1.70615 WP_003899478.1.70618 WP_003899478.1.70622 WP_003899478.1.70626 WP_003899478.1.70668 WP_003899478.1.70699 WP_003899478.1.70704 WP_003899478.1.70729 WP_003899478.1.70757 WP_003899478.1.70782 WP_003899478.1.70796 WP_003899478.1.70830 WP_003899478.1.70834 WP_003899478.1.7084 WP_003899478.1.70840 WP_003899478.1.70864 WP_003899478.1.70871 WP_003899478.1.70915 WP_003899478.1.70955 WP_003899478.1.70958 WP_003899478.1.70976 WP_003899478.1.71015 WP_003899478.1.71026 WP_003899478.1.71063 WP_003899478.1.71076 WP_003899478.1.71083 WP_003899478.1.7111 WP_003899478.1.71118 WP_003899478.1.71128 WP_003899478.1.7113 WP_003899478.1.71187 WP_003899478.1.71191 WP_003899478.1.71258 WP_003899478.1.71259 WP_003899478.1.71289 WP_003899478.1.71326 WP_003899478.1.71329 WP_003899478.1.71331 WP_003899478.1.71344 WP_003899478.1.71390 WP_003899478.1.71399 WP_003899478.1.71414 WP_003899478.1.71440 WP_003899478.1.71457 WP_003899478.1.7146 WP_003899478.1.71464 WP_003899478.1.71490 WP_003899478.1.71492 WP_003899478.1.71509 WP_003899478.1.71516 WP_003899478.1.71517 WP_003899478.1.71527 WP_003899478.1.71532 WP_003899478.1.71545 WP_003899478.1.71546 WP_003899478.1.71569 WP_003899478.1.71604 WP_003899478.1.71621 WP_003899478.1.71630 WP_003899478.1.71654 WP_003899478.1.71664 WP_003899478.1.71665 WP_003899478.1.71683 WP_003899478.1.71701 WP_003899478.1.71718 WP_003899478.1.71731 WP_003899478.1.71778 WP_003899478.1.71781 WP_003899478.1.71803 WP_003899478.1.71820 WP_003899478.1.71847 WP_003899478.1.71851 WP_003899478.1.71871 WP_003899478.1.71909 WP_003899478.1.71957 WP_003899478.1.71970 WP_003899478.1.72047 WP_003899478.1.72061 WP_003899478.1.72062 WP_003899478.1.72072 WP_003899478.1.72111 WP_003899478.1.72122 WP_003899478.1.72143 WP_003899478.1.7216 WP_003899478.1.72168 WP_003899478.1.72179 WP_003899478.1.72209 WP_003899478.1.72218 WP_003899478.1.72219 WP_003899478.1.72227 WP_003899478.1.7224 WP_003899478.1.72268 WP_003899478.1.72332 WP_003899478.1.72380 WP_003899478.1.72401 WP_003899478.1.72405 WP_003899478.1.72420 WP_003899478.1.72441 WP_003899478.1.72451 WP_003899478.1.72452 WP_003899478.1.72457 WP_003899478.1.72459 WP_003899478.1.72460 WP_003899478.1.72466 WP_003899478.1.72487 WP_003899478.1.72488 WP_003899478.1.72492 WP_003899478.1.72506 WP_003899478.1.72543 WP_003899478.1.7256 WP_003899478.1.72576 WP_003899478.1.72578 WP_003899478.1.72585 WP_003899478.1.72591 WP_003899478.1.72592 WP_003899478.1.72640 WP_003899478.1.7266 WP_003899478.1.72661 WP_003899478.1.72684 WP_003899478.1.72739 WP_003899478.1.72744 WP_003899478.1.72755 WP_003899478.1.72759 WP_003899478.1.72784 WP_003899478.1.72792 WP_003899478.1.72826 WP_003899478.1.72831 WP_003899478.1.72852 WP_003899478.1.72853 WP_003899478.1.72879 WP_003899478.1.72938 WP_003899478.1.72954 WP_003899478.1.72959 WP_003899478.1.72973 WP_003899478.1.7298 WP_003899478.1.72982 WP_003899478.1.72988 WP_003899478.1.72993 WP_003899478.1.73006 WP_003899478.1.73013 WP_003899478.1.73025 WP_003899478.1.73028 WP_003899478.1.73042 WP_003899478.1.73045 WP_003899478.1.73092 WP_003899478.1.73118 WP_003899478.1.7312 WP_003899478.1.73127 WP_003899478.1.73134 WP_003899478.1.73150 WP_003899478.1.73154 WP_003899478.1.73163 WP_003899478.1.73182 WP_003899478.1.73205 WP_003899478.1.7321 WP_003899478.1.73310 WP_003899478.1.73315 WP_003899478.1.73365 WP_003899478.1.73391 WP_003899478.1.73404 WP_003899478.1.73424 WP_003899478.1.73436 WP_003899478.1.73445 WP_003899478.1.73453 WP_003899478.1.73465 WP_003899478.1.73466 WP_003899478.1.73470 WP_003899478.1.73471 WP_003899478.1.73478 WP_003899478.1.73482 WP_003899478.1.73507 WP_003899478.1.73532 WP_003899478.1.73550 WP_003899478.1.73623 WP_003899478.1.73629 WP_003899478.1.73644 WP_003899478.1.7366 WP_003899478.1.73661 WP_003899478.1.7368 WP_003899478.1.73688 WP_003899478.1.73723 WP_003899478.1.73744 WP_003899478.1.73750 WP_003899478.1.73760 WP_003899478.1.73774 WP_003899478.1.7379 WP_003899478.1.73813 WP_003899478.1.73840 WP_003899478.1.73876 WP_003899478.1.7389 WP_003899478.1.73986 WP_003899478.1.74016 WP_003899478.1.74039 WP_003899478.1.74083 WP_003899478.1.74101 WP_003899478.1.74107 WP_003899478.1.74120 WP_003899478.1.74129 WP_003899478.1.74144 WP_003899478.1.7417 WP_003899478.1.74190 WP_003899478.1.74210 WP_003899478.1.7423 WP_003899478.1.74259 WP_003899478.1.74262 WP_003899478.1.74269 WP_003899478.1.74282 WP_003899478.1.74291 WP_003899478.1.74296 WP_003899478.1.74304 WP_003899478.1.7432 WP_003899478.1.74347 WP_003899478.1.7436 WP_003899478.1.74378 WP_003899478.1.74382 WP_003899478.1.74395 WP_003899478.1.74400 WP_003899478.1.74401 WP_003899478.1.74432 WP_003899478.1.74442 WP_003899478.1.74487 WP_003899478.1.74504 WP_003899478.1.74511 WP_003899478.1.74523 WP_003899478.1.74525 WP_003899478.1.74551 WP_003899478.1.74555 WP_003899478.1.74628 WP_003899478.1.74641 WP_003899478.1.74653 WP_003899478.1.74660 WP_003899478.1.74683 WP_003899478.1.7469 WP_003899478.1.74725 WP_003899478.1.74760 WP_003899478.1.74786 WP_003899478.1.74809 WP_003899478.1.74820 WP_003899478.1.74870 WP_003899478.1.74881 WP_003899478.1.74888 WP_003899478.1.74952 WP_003899478.1.7496 WP_003899478.1.74988 WP_003899478.1.75043 WP_003899478.1.75045 WP_003899478.1.75055 WP_003899478.1.75078 WP_003899478.1.75081 WP_003899478.1.75120 WP_003899478.1.75163 WP_003899478.1.75188 WP_003899478.1.75200 WP_003899478.1.75202 WP_003899478.1.75234 WP_003899478.1.75239 WP_003899478.1.75250 WP_003899478.1.75263 WP_003899478.1.75281 WP_003899478.1.75342 WP_003899478.1.7535 WP_003899478.1.75376 WP_003899478.1.75391 WP_003899478.1.75395 WP_003899478.1.75441 WP_003899478.1.75510 WP_003899478.1.75581 WP_003899478.1.75598 WP_003899478.1.75635 WP_003899478.1.75645 WP_003899478.1.75665 WP_003899478.1.75671 WP_003899478.1.75741 WP_003899478.1.75749 WP_003899478.1.75772 WP_003899478.1.75774 WP_003899478.1.75811 WP_003899478.1.75833 WP_003899478.1.7585 WP_003899478.1.75864 WP_003899478.1.75868 WP_003899478.1.75878 WP_003899478.1.75927 WP_003899478.1.75946 WP_003899478.1.75968 WP_003899478.1.75974 WP_003899478.1.76007 WP_003899478.1.76016 WP_003899478.1.76032 WP_003899478.1.76037 WP_003899478.1.7604 WP_003899478.1.76045 WP_003899478.1.76052 WP_003899478.1.76058 WP_003899478.1.76064 WP_003899478.1.76110 WP_003899478.1.76126 WP_003899478.1.76133 WP_003899478.1.76138 WP_003899478.1.76157 WP_003899478.1.76172 WP_003899478.1.76177 WP_003899478.1.76183 WP_003899478.1.76209 WP_003899478.1.76239 WP_003899478.1.76272 WP_003899478.1.76277 WP_003899478.1.76280 WP_003899478.1.76281 WP_003899478.1.76297 WP_003899478.1.76360 WP_003899478.1.76379 WP_003899478.1.76403 WP_003899478.1.76414 WP_003899478.1.76427 WP_003899478.1.76436 WP_003899478.1.76442 WP_003899478.1.76443 WP_003899478.1.76456 WP_003899478.1.76521 WP_003899478.1.76533 WP_003899478.1.76616 WP_003899478.1.76629 WP_003899478.1.76635 WP_003899478.1.76638 WP_003899478.1.76639 WP_003899478.1.76640 WP_003899478.1.76644 WP_003899478.1.76677 WP_003899478.1.76678 WP_003899478.1.76679 WP_003899478.1.76734 WP_003899478.1.76744 WP_003899478.1.76750 WP_003899478.1.76754 WP_003899478.1.76757 WP_003899478.1.76781 WP_003899478.1.76818 WP_003899478.1.76824 WP_003899478.1.76835 WP_003899478.1.76873 WP_003899478.1.76881 WP_003899478.1.76888 WP_003899478.1.76900 WP_003899478.1.7691 WP_003899478.1.76947 WP_003899478.1.76954 WP_003899478.1.76955 WP_003899478.1.76963 WP_003899478.1.76976 WP_003899478.1.770 WP_003899478.1.77000 WP_003899478.1.77008 WP_003899478.1.77021 WP_003899478.1.77056 WP_003899478.1.77065 WP_003899478.1.77075 WP_003899478.1.77093 WP_003899478.1.77107 WP_003899478.1.77115 WP_003899478.1.77118 WP_003899478.1.77125 WP_003899478.1.77141 WP_003899478.1.77142 WP_003899478.1.77166 WP_003899478.1.77250 WP_003899478.1.77252 WP_003899478.1.77260 WP_003899478.1.77266 WP_003899478.1.77280 WP_003899478.1.77285 WP_003899478.1.77312 WP_003899478.1.77348 WP_003899478.1.77351 WP_003899478.1.77361 WP_003899478.1.774 WP_003899478.1.7740 WP_003899478.1.77404 WP_003899478.1.77425 WP_003899478.1.77463 WP_003899478.1.77474 WP_003899478.1.7748 WP_003899478.1.77491 WP_003899478.1.77499 WP_003899478.1.77510 WP_003899478.1.77530 WP_003899478.1.77554 WP_003899478.1.77559 WP_003899478.1.77605 WP_003899478.1.7762 WP_003899478.1.77627 WP_003899478.1.77649 WP_003899478.1.77654 WP_003899478.1.7766 WP_003899478.1.77667 WP_003899478.1.77704 WP_003899478.1.77706 WP_003899478.1.77726 WP_003899478.1.77774 WP_003899478.1.7778 WP_003899478.1.77790 WP_003899478.1.77820 WP_003899478.1.77843 WP_003899478.1.77855 WP_003899478.1.77865 WP_003899478.1.77868 WP_003899478.1.77879 WP_003899478.1.77909 WP_003899478.1.77931 WP_003899478.1.77984 WP_003899478.1.78020 WP_003899478.1.78024 WP_003899478.1.78075 WP_003899478.1.78084 WP_003899478.1.78086 WP_003899478.1.7809 WP_003899478.1.78098 WP_003899478.1.78105 WP_003899478.1.78113 WP_003899478.1.78136 WP_003899478.1.78162 WP_003899478.1.7817 WP_003899478.1.78200 WP_003899478.1.78236 WP_003899478.1.78238 WP_003899478.1.78322 WP_003899478.1.78338 WP_003899478.1.7836 WP_003899478.1.78360 WP_003899478.1.78386 WP_003899478.1.78429 WP_003899478.1.78435 WP_003899478.1.7844 WP_003899478.1.78459 WP_003899478.1.78488 WP_003899478.1.7849 WP_003899478.1.78499 WP_003899478.1.785 WP_003899478.1.78516 WP_003899478.1.78524 WP_003899478.1.78526 WP_003899478.1.78538 WP_003899478.1.78544 WP_003899478.1.78545 WP_003899478.1.78547 WP_003899478.1.78574 WP_003899478.1.78580 WP_003899478.1.7860 WP_003899478.1.78646 WP_003899478.1.78648 WP_003899478.1.78649 WP_003899478.1.78655 WP_003899478.1.78657 WP_003899478.1.78659 WP_003899478.1.7869 WP_003899478.1.78692 WP_003899478.1.78760 WP_003899478.1.78766 WP_003899478.1.78776 WP_003899478.1.78778 WP_003899478.1.78784 WP_003899478.1.78788 WP_003899478.1.78790 WP_003899478.1.78793 WP_003899478.1.78848 WP_003899478.1.78860 WP_003899478.1.7887 WP_003899478.1.78884 WP_003899478.1.78969 WP_003899478.1.78977 WP_003899478.1.79005 WP_003899478.1.79016 WP_003899478.1.79033 WP_003899478.1.79064 WP_003899478.1.79066 WP_003899478.1.79068 WP_003899478.1.79077 WP_003899478.1.79095 WP_003899478.1.79112 WP_003899478.1.79122 WP_003899478.1.79145 WP_003899478.1.79152 WP_003899478.1.79163 WP_003899478.1.79198 WP_003899478.1.79213 WP_003899478.1.79218 WP_003899478.1.79268 WP_003899478.1.79273 WP_003899478.1.79278 WP_003899478.1.79319 WP_003899478.1.79325 WP_003899478.1.79326 WP_003899478.1.7933 WP_003899478.1.79330 WP_003899478.1.79339 WP_003899478.1.79394 WP_003899478.1.79413 WP_003899478.1.79422 WP_003899478.1.79445 WP_003899478.1.79447 WP_003899478.1.79455 WP_003899478.1.79471 WP_003899478.1.79480 WP_003899478.1.79482 WP_003899478.1.79488 WP_003899478.1.79502 WP_003899478.1.79508 WP_003899478.1.79514 WP_003899478.1.79565 WP_003899478.1.79578 WP_003899478.1.79588 WP_003899478.1.79598 WP_003899478.1.79615 WP_003899478.1.79684 WP_003899478.1.79744 WP_003899478.1.79784 WP_003899478.1.79802 WP_003899478.1.79806 WP_003899478.1.79819 WP_003899478.1.79826 WP_003899478.1.79828 WP_003899478.1.79851 WP_003899478.1.79853 WP_003899478.1.79863 WP_003899478.1.79881 WP_003899478.1.79885 WP_003899478.1.79898 WP_003899478.1.7990 WP_003899478.1.79900 WP_003899478.1.79913 WP_003899478.1.79918 WP_003899478.1.79947 WP_003899478.1.79948 WP_003899478.1.7997 WP_003899478.1.80004 WP_003899478.1.80015 WP_003899478.1.80030 WP_003899478.1.80054 WP_003899478.1.80084 WP_003899478.1.80099 WP_003899478.1.80129 WP_003899478.1.80177 WP_003899478.1.80234 WP_003899478.1.8026 WP_003899478.1.80275 WP_003899478.1.8029 WP_003899478.1.80299 WP_003899478.1.80304 WP_003899478.1.80326 WP_003899478.1.80351 WP_003899478.1.8037 WP_003899478.1.80370 WP_003899478.1.80387 WP_003899478.1.80399 WP_003899478.1.8044 WP_003899478.1.80451 WP_003899478.1.80458 WP_003899478.1.80461 WP_003899478.1.80490 WP_003899478.1.80503 WP_003899478.1.80507 WP_003899478.1.80552 WP_003899478.1.80576 WP_003899478.1.80588 WP_003899478.1.80599 WP_003899478.1.8060 WP_003899478.1.80624 WP_003899478.1.80636 WP_003899478.1.80669 WP_003899478.1.80714 WP_003899478.1.80784 WP_003899478.1.80815 WP_003899478.1.80853 WP_003899478.1.80918 WP_003899478.1.8093 WP_003899478.1.80967 WP_003899478.1.8097 WP_003899478.1.81007 WP_003899478.1.81013 WP_003899478.1.8105 WP_003899478.1.81059 WP_003899478.1.81063 WP_003899478.1.81066 WP_003899478.1.81091 WP_003899478.1.81119 WP_003899478.1.81125 WP_003899478.1.81136 WP_003899478.1.8114 WP_003899478.1.81189 WP_003899478.1.81192 WP_003899478.1.812 WP_003899478.1.81230 WP_003899478.1.81249 WP_003899478.1.81250 WP_003899478.1.81264 WP_003899478.1.8128 WP_003899478.1.81287 WP_003899478.1.81297 WP_003899478.1.81407 WP_003899478.1.8143 WP_003899478.1.81439 WP_003899478.1.81465 WP_003899478.1.81505 WP_003899478.1.81529 WP_003899478.1.81538 WP_003899478.1.81541 WP_003899478.1.81560 WP_003899478.1.81567 WP_003899478.1.81583 WP_003899478.1.81686 WP_003899478.1.81712 WP_003899478.1.81720 WP_003899478.1.81774 WP_003899478.1.81788 WP_003899478.1.81809 WP_003899478.1.81820 WP_003899478.1.81850 WP_003899478.1.81883 WP_003899478.1.81891 WP_003899478.1.81911 WP_003899478.1.82011 WP_003899478.1.82048 WP_003899478.1.82069 WP_003899478.1.82071 WP_003899478.1.82108 WP_003899478.1.82136 WP_003899478.1.82142 WP_003899478.1.8215 WP_003899478.1.82158 WP_003899478.1.8217 WP_003899478.1.82209 WP_003899478.1.82210 WP_003899478.1.82228 WP_003899478.1.82236 WP_003899478.1.82251 WP_003899478.1.82271 WP_003899478.1.82305 WP_003899478.1.82307 WP_003899478.1.82309 WP_003899478.1.82317 WP_003899478.1.8232 WP_003899478.1.82346 WP_003899478.1.82374 WP_003899478.1.82385 WP_003899478.1.82429 WP_003899478.1.82460 WP_003899478.1.82462 WP_003899478.1.82483 WP_003899478.1.82531 WP_003899478.1.82546 WP_003899478.1.82547 WP_003899478.1.82549 WP_003899478.1.82577 WP_003899478.1.82592 WP_003899478.1.82597 WP_003899478.1.82598 WP_003899478.1.82625 WP_003899478.1.82642 WP_003899478.1.82651 WP_003899478.1.82653 WP_003899478.1.82681 WP_003899478.1.82685 WP_003899478.1.8271 WP_003899478.1.8273 WP_003899478.1.82743 WP_003899478.1.82757 WP_003899478.1.82774 WP_003899478.1.82803 WP_003899478.1.82836 WP_003899478.1.82860 WP_003899478.1.82871 WP_003899478.1.82935 WP_003899478.1.82957 WP_003899478.1.82973 WP_003899478.1.82981 WP_003899478.1.82983 WP_003899478.1.83004 WP_003899478.1.83009 WP_003899478.1.83044 WP_003899478.1.83074 WP_003899478.1.83110 WP_003899478.1.83146 WP_003899478.1.83149 WP_003899478.1.83159 WP_003899478.1.8317 WP_003899478.1.83173 WP_003899478.1.83182 WP_003899478.1.83191 WP_003899478.1.83197 WP_003899478.1.83212 WP_003899478.1.8326 WP_003899478.1.83262 WP_003899478.1.83268 WP_003899478.1.83273 WP_003899478.1.83309 WP_003899478.1.83332 WP_003899478.1.83334 WP_003899478.1.83341 WP_003899478.1.83349 WP_003899478.1.8335 WP_003899478.1.83353 WP_003899478.1.83367 WP_003899478.1.83380 WP_003899478.1.83381 WP_003899478.1.83389 WP_003899478.1.83408 WP_003899478.1.83409 WP_003899478.1.83435 WP_003899478.1.83470 WP_003899478.1.83524 WP_003899478.1.83526 WP_003899478.1.8358 WP_003899478.1.83589 WP_003899478.1.83601 WP_003899478.1.83611 WP_003899478.1.83638 WP_003899478.1.83648 WP_003899478.1.83656 WP_003899478.1.83667 WP_003899478.1.83689 WP_003899478.1.83705 WP_003899478.1.83766 WP_003899478.1.83793 WP_003899478.1.83794 WP_003899478.1.83805 WP_003899478.1.83839 WP_003899478.1.83842 WP_003899478.1.83850 WP_003899478.1.83861 WP_003899478.1.83884 WP_003899478.1.83920 WP_003899478.1.83929 WP_003899478.1.83975 WP_003899478.1.83991 WP_003899478.1.8400 WP_003899478.1.84027 WP_003899478.1.8404 WP_003899478.1.84057 WP_003899478.1.84070 WP_003899478.1.8409 WP_003899478.1.84112 WP_003899478.1.84146 WP_003899478.1.8415 WP_003899478.1.84176 WP_003899478.1.84186 WP_003899478.1.84192 WP_003899478.1.84228 WP_003899478.1.8424 WP_003899478.1.84244 WP_003899478.1.84259 WP_003899478.1.8426 WP_003899478.1.84277 WP_003899478.1.84287 WP_003899478.1.8434 WP_003899478.1.84388 WP_003899478.1.84408 WP_003899478.1.84409 WP_003899478.1.84438 WP_003899478.1.84460 WP_003899478.1.84488 WP_003899478.1.84504 WP_003899478.1.84525 WP_003899478.1.84623 WP_003899478.1.84641 WP_003899478.1.84655 WP_003899478.1.84666 WP_003899478.1.84670 WP_003899478.1.84739 WP_003899478.1.84748 WP_003899478.1.84766 WP_003899478.1.84772 WP_003899478.1.84774 WP_003899478.1.848 WP_003899478.1.84812 WP_003899478.1.84836 WP_003899478.1.84846 WP_003899478.1.84873 WP_003899478.1.84911 WP_003899478.1.84938 WP_003899478.1.84968 WP_003899478.1.84973 WP_003899478.1.84981 WP_003899478.1.84985 WP_003899478.1.8503 WP_003899478.1.85038 WP_003899478.1.85043 WP_003899478.1.8505 WP_003899478.1.8509 WP_003899478.1.8512 WP_003899478.1.8518 WP_003899478.1.8522 WP_003899478.1.85242 WP_003899478.1.85276 WP_003899478.1.85281 WP_003899478.1.85284 WP_003899478.1.85314 WP_003899478.1.85319 WP_003899478.1.85330 WP_003899478.1.85341 WP_003899478.1.85346 WP_003899478.1.8535 WP_003899478.1.85363 WP_003899478.1.85371 WP_003899478.1.85377 WP_003899478.1.85387 WP_003899478.1.85399 WP_003899478.1.85458 WP_003899478.1.8546 WP_003899478.1.85464 WP_003899478.1.85478 WP_003899478.1.85480 WP_003899478.1.85488 WP_003899478.1.85495 WP_003899478.1.85551 WP_003899478.1.85557 WP_003899478.1.85577 WP_003899478.1.85597 WP_003899478.1.85599 WP_003899478.1.85610 WP_003899478.1.8563 WP_003899478.1.85648 WP_003899478.1.85679 WP_003899478.1.85704 WP_003899478.1.85727 WP_003899478.1.85737 WP_003899478.1.85763 WP_003899478.1.85808 WP_003899478.1.85819 WP_003899478.1.85820 WP_003899478.1.85823 WP_003899478.1.85832 WP_003899478.1.8586 WP_003899478.1.85872 WP_003899478.1.85894 WP_003899478.1.85909 WP_003899478.1.85913 WP_003899478.1.85986 WP_003899478.1.86000 WP_003899478.1.86024 WP_003899478.1.86025 WP_003899478.1.86032 WP_003899478.1.86048 WP_003899478.1.86052 WP_003899478.1.86067 WP_003899478.1.86103 WP_003899478.1.86122 WP_003899478.1.86124 WP_003899478.1.86160 WP_003899478.1.86164 WP_003899478.1.86190 WP_003899478.1.86204 WP_003899478.1.86208 WP_003899478.1.86235 WP_003899478.1.86249 WP_003899478.1.86260 WP_003899478.1.86290 WP_003899478.1.863 WP_003899478.1.86327 WP_003899478.1.86334 WP_003899478.1.86337 WP_003899478.1.86368 WP_003899478.1.86377 WP_003899478.1.86425 WP_003899478.1.86459 WP_003899478.1.8649 WP_003899478.1.86499 WP_003899478.1.86520 WP_003899478.1.86561 WP_003899478.1.86568 WP_003899478.1.86575 WP_003899478.1.86584 WP_003899478.1.86605 WP_003899478.1.86626 WP_003899478.1.86648 WP_003899478.1.8666 WP_003899478.1.86684 WP_003899478.1.86696 WP_003899478.1.86718 WP_003899478.1.86766 WP_003899478.1.86801 WP_003899478.1.86814 WP_003899478.1.86820 WP_003899478.1.86825 WP_003899478.1.86834 WP_003899478.1.86855 WP_003899478.1.86867 WP_003899478.1.86877 WP_003899478.1.8689 WP_003899478.1.86892 WP_003899478.1.86941 WP_003899478.1.86950 WP_003899478.1.86962 WP_003899478.1.86963 WP_003899478.1.86979 WP_003899478.1.8700 WP_003899478.1.87001 WP_003899478.1.87002 WP_003899478.1.87031 WP_003899478.1.87116 WP_003899478.1.87117 WP_003899478.1.8714 WP_003899478.1.87162 WP_003899478.1.87178 WP_003899478.1.87191 WP_003899478.1.87201 WP_003899478.1.87209 WP_003899478.1.87240 WP_003899478.1.87266 WP_003899478.1.87273 WP_003899478.1.87275 WP_003899478.1.8733 WP_003899478.1.87345 WP_003899478.1.87369 WP_003899478.1.8737 WP_003899478.1.87401 WP_003899478.1.87404 WP_003899478.1.87406 WP_003899478.1.87409 WP_003899478.1.87444 WP_003899478.1.87446 WP_003899478.1.87459 WP_003899478.1.87489 WP_003899478.1.87494 WP_003899478.1.87496 WP_003899478.1.87582 WP_003899478.1.87588 WP_003899478.1.87617 WP_003899478.1.87619 WP_003899478.1.87620 WP_003899478.1.87634 WP_003899478.1.87643 WP_003899478.1.8765 WP_003899478.1.87650 WP_003899478.1.87654 WP_003899478.1.87658 WP_003899478.1.87665 WP_003899478.1.87676 WP_003899478.1.87684 WP_003899478.1.87692 WP_003899478.1.87707 WP_003899478.1.87732 WP_003899478.1.87784 WP_003899478.1.87796 WP_003899478.1.87809 WP_003899478.1.87817 WP_003899478.1.87827 WP_003899478.1.87831 WP_003899478.1.87835 WP_003899478.1.87837 WP_003899478.1.87866 WP_003899478.1.8789 WP_003899478.1.87911 WP_003899478.1.87951 WP_003899478.1.87955 WP_003899478.1.87956 WP_003899478.1.87991 WP_003899478.1.88 WP_003899478.1.88002 WP_003899478.1.88037 WP_003899478.1.88039 WP_003899478.1.88072 WP_003899478.1.88077 WP_003899478.1.88121 WP_003899478.1.88180 WP_003899478.1.88191 WP_003899478.1.88205 WP_003899478.1.88217 WP_003899478.1.88219 WP_003899478.1.88245 WP_003899478.1.88253 WP_003899478.1.88294 WP_003899478.1.88316 WP_003899478.1.88320 WP_003899478.1.88338 WP_003899478.1.8840 WP_003899478.1.88437 WP_003899478.1.88453 WP_003899478.1.88469 WP_003899478.1.88489 WP_003899478.1.88521 WP_003899478.1.88530 WP_003899478.1.88537 WP_003899478.1.88541 WP_003899478.1.88592 WP_003899478.1.88616 WP_003899478.1.88618 WP_003899478.1.8862 WP_003899478.1.88625 WP_003899478.1.88632 WP_003899478.1.88634 WP_003899478.1.88649 WP_003899478.1.8870 WP_003899478.1.88737 WP_003899478.1.888 WP_003899478.1.88824 WP_003899478.1.88886 WP_003899478.1.88965 WP_003899478.1.88985 WP_003899478.1.8902 WP_003899478.1.89025 WP_003899478.1.89041 WP_003899478.1.89046 WP_003899478.1.89082 WP_003899478.1.89162 WP_003899478.1.89168 WP_003899478.1.8917 WP_003899478.1.89193 WP_003899478.1.89205 WP_003899478.1.89207 WP_003899478.1.89225 WP_003899478.1.8925 WP_003899478.1.89277 WP_003899478.1.89286 WP_003899478.1.89293 WP_003899478.1.89320 WP_003899478.1.8935 WP_003899478.1.89371 WP_003899478.1.89378 WP_003899478.1.89392 WP_003899478.1.89406 WP_003899478.1.8943 WP_003899478.1.89451 WP_003899478.1.89453 WP_003899478.1.89473 WP_003899478.1.89475 WP_003899478.1.89483 WP_003899478.1.895 WP_003899478.1.89517 WP_003899478.1.89522 WP_003899478.1.8954 WP_003899478.1.89543 WP_003899478.1.89567 WP_003899478.1.8957 WP_003899478.1.89607 WP_003899478.1.89625 WP_003899478.1.89648 WP_003899478.1.8967 WP_003899478.1.89670 WP_003899478.1.89676 WP_003899478.1.89729 WP_003899478.1.89739 WP_003899478.1.89762 WP_003899478.1.8977 WP_003899478.1.89802 WP_003899478.1.89808 WP_003899478.1.8982 WP_003899478.1.89829 WP_003899478.1.89831 WP_003899478.1.89844 WP_003899478.1.89849 WP_003899478.1.8989 WP_003899478.1.89903 WP_003899478.1.89909 WP_003899478.1.89922 WP_003899478.1.89926 WP_003899478.1.89963 WP_003899478.1.89971 WP_003899478.1.8998 WP_003899478.1.89987 WP_003899478.1.900 WP_003899478.1.90048 WP_003899478.1.9007 WP_003899478.1.90080 WP_003899478.1.90130 WP_003899478.1.90134 WP_003899478.1.90137 WP_003899478.1.90157 WP_003899478.1.90184 WP_003899478.1.90199 WP_003899478.1.90231 WP_003899478.1.90245 WP_003899478.1.90308 WP_003899478.1.90322 WP_003899478.1.90328 WP_003899478.1.90372 WP_003899478.1.90439 WP_003899478.1.90481 WP_003899478.1.90499 WP_003899478.1.90527 WP_003899478.1.90550 WP_003899478.1.90560 WP_003899478.1.90612 WP_003899478.1.90640 WP_003899478.1.90672 WP_003899478.1.90691 WP_003899478.1.90711 WP_003899478.1.90722 WP_003899478.1.9075 WP_003899478.1.90756 WP_003899478.1.90767 WP_003899478.1.90771 WP_003899478.1.90785 WP_003899478.1.90788 WP_003899478.1.90800 WP_003899478.1.90810 WP_003899478.1.90816 WP_003899478.1.90819 WP_003899478.1.9082 WP_003899478.1.90831 WP_003899478.1.90899 WP_003899478.1.90906 WP_003899478.1.90958 WP_003899478.1.90976 WP_003899478.1.90977 WP_003899478.1.90987 WP_003899478.1.9102 WP_003899478.1.91026 WP_003899478.1.91032 WP_003899478.1.91043 WP_003899478.1.91053 WP_003899478.1.91082 WP_003899478.1.91112 WP_003899478.1.91144 WP_003899478.1.91151 WP_003899478.1.91157 WP_003899478.1.91167 WP_003899478.1.91169 WP_003899478.1.91192 WP_003899478.1.91201 WP_003899478.1.91207 WP_003899478.1.91208 WP_003899478.1.91214 WP_003899478.1.91230 WP_003899478.1.91244 WP_003899478.1.91251 WP_003899478.1.91260 WP_003899478.1.9128 WP_003899478.1.91284 WP_003899478.1.91294 WP_003899478.1.91303 WP_003899478.1.91322 WP_003899478.1.91352 WP_003899478.1.91386 WP_003899478.1.9139 WP_003899478.1.91398 WP_003899478.1.91411 WP_003899478.1.91430 WP_003899478.1.91436 WP_003899478.1.91483 WP_003899478.1.91496 WP_003899478.1.91507 WP_003899478.1.91508 WP_003899478.1.91576 WP_003899478.1.91589 WP_003899478.1.91694 WP_003899478.1.91695 WP_003899478.1.91713 WP_003899478.1.91716 WP_003899478.1.91717 WP_003899478.1.91728 WP_003899478.1.91743 WP_003899478.1.91759 WP_003899478.1.91784 WP_003899478.1.91785 WP_003899478.1.91786 WP_003899478.1.91802 WP_003899478.1.91822 WP_003899478.1.9189 WP_003899478.1.91896 WP_003899478.1.9190 WP_003899478.1.91915 WP_003899478.1.91931 WP_003899478.1.91937 WP_003899478.1.91944 WP_003899478.1.91953 WP_003899478.1.91957 WP_003899478.1.91976 WP_003899478.1.91978 WP_003899478.1.92021 WP_003899478.1.92083 WP_003899478.1.92127 WP_003899478.1.92144 WP_003899478.1.92153 WP_003899478.1.92190 WP_003899478.1.92192 WP_003899478.1.92200 WP_003899478.1.92220 WP_003899478.1.92221 WP_003899478.1.92222 WP_003899478.1.92289 WP_003899478.1.9229 WP_003899478.1.92294 WP_003899478.1.92300 WP_003899478.1.92317 WP_003899478.1.92334 WP_003899478.1.92338 WP_003899478.1.92345 WP_003899478.1.92356 WP_003899478.1.92364 WP_003899478.1.92380 WP_003899478.1.92416 WP_003899478.1.92428 WP_003899478.1.92447 WP_003899478.1.92456 WP_003899478.1.92467 WP_003899478.1.92471 WP_003899478.1.92490 WP_003899478.1.92508 WP_003899478.1.9251 WP_003899478.1.92511 WP_003899478.1.92523 WP_003899478.1.92536 WP_003899478.1.92592 WP_003899478.1.92603 WP_003899478.1.92606 WP_003899478.1.92610 WP_003899478.1.92613 WP_003899478.1.9263 WP_003899478.1.9265 WP_003899478.1.92650 WP_003899478.1.92660 WP_003899478.1.92677 WP_003899478.1.92685 WP_003899478.1.92689 WP_003899478.1.92690 WP_003899478.1.92706 WP_003899478.1.92714 WP_003899478.1.9274 WP_003899478.1.92760 WP_003899478.1.92777 WP_003899478.1.92803 WP_003899478.1.92833 WP_003899478.1.92856 WP_003899478.1.92881 WP_003899478.1.92892 WP_003899478.1.92907 WP_003899478.1.92908 WP_003899478.1.9291 WP_003899478.1.92917 WP_003899478.1.92996 WP_003899478.1.93006 WP_003899478.1.93008 WP_003899478.1.93009 WP_003899478.1.93015 WP_003899478.1.93043 WP_003899478.1.9307 WP_003899478.1.93083 WP_003899478.1.93097 WP_003899478.1.93137 WP_003899478.1.93192 WP_003899478.1.93199 WP_003899478.1.93203 WP_003899478.1.93212 WP_003899478.1.93234 WP_003899478.1.93245 WP_003899478.1.93257 WP_003899478.1.93265 WP_003899478.1.93320 WP_003899478.1.93328 WP_003899478.1.93337 WP_003899478.1.93343 WP_003899478.1.93349 WP_003899478.1.93363 WP_003899478.1.93377 WP_003899478.1.9338 WP_003899478.1.93407 WP_003899478.1.93417 WP_003899478.1.93419 WP_003899478.1.93426 WP_003899478.1.9344 WP_003899478.1.93443 WP_003899478.1.93470 WP_003899478.1.93483 WP_003899478.1.93487 WP_003899478.1.93495 WP_003899478.1.93499 WP_003899478.1.93516 WP_003899478.1.93544 WP_003899478.1.93555 WP_003899478.1.93560 WP_003899478.1.93573 WP_003899478.1.93576 WP_003899478.1.93588 WP_003899478.1.9363 WP_003899478.1.93645 WP_003899478.1.93649 WP_003899478.1.93659 WP_003899478.1.93677 WP_003899478.1.9368 WP_003899478.1.93689 WP_003899478.1.93693 WP_003899478.1.9371 WP_003899478.1.93792 WP_003899478.1.93823 WP_003899478.1.93871 WP_003899478.1.9388 WP_003899478.1.93894 WP_003899478.1.93903 WP_003899478.1.93907 WP_003899478.1.93913 WP_003899478.1.93946 WP_003899478.1.93950 WP_003899478.1.93953 WP_003899478.1.93954 WP_003899478.1.93988 WP_003899478.1.9407 WP_003899478.1.94143 WP_003899478.1.94154 WP_003899478.1.94184 WP_003899478.1.94204 WP_003899478.1.94226 WP_003899478.1.94231 WP_003899478.1.94256 WP_003899478.1.94261 WP_003899478.1.94281 WP_003899478.1.94292 WP_003899478.1.94297 WP_003899478.1.9431 WP_003899478.1.94326 WP_003899478.1.94339 WP_003899478.1.94392 WP_003899478.1.94416 WP_003899478.1.94421 WP_003899478.1.94456 WP_003899478.1.94470 WP_003899478.1.94480 WP_003899478.1.94495 WP_003899478.1.94511 WP_003899478.1.94512 WP_003899478.1.94525 WP_003899478.1.94528 WP_003899478.1.94564 WP_003899478.1.946 WP_003899478.1.94602 WP_003899478.1.94623 WP_003899478.1.94629 WP_003899478.1.9465 WP_003899478.1.94673 WP_003899478.1.94714 WP_003899478.1.94730 WP_003899478.1.94736 WP_003899478.1.94776 WP_003899478.1.9478 WP_003899478.1.94852 WP_003899478.1.94872 WP_003899478.1.9488 WP_003899478.1.94902 WP_003899478.1.94916 WP_003899478.1.94979 WP_003899478.1.94994 WP_003899478.1.94996 WP_003899478.1.94998 WP_003899478.1.95007 WP_003899478.1.95015 WP_003899478.1.95034 WP_003899478.1.95068 WP_003899478.1.95081 WP_003899478.1.95082 WP_003899478.1.9509 WP_003899478.1.95096 WP_003899478.1.95112 WP_003899478.1.95138 WP_003899478.1.9514 WP_003899478.1.95234 WP_003899478.1.95245 WP_003899478.1.95257 WP_003899478.1.95279 WP_003899478.1.9531 WP_003899478.1.95335 WP_003899478.1.9535 WP_003899478.1.95370 WP_003899478.1.95392 WP_003899478.1.95416 WP_003899478.1.95417 WP_003899478.1.95454 WP_003899478.1.95455 WP_003899478.1.95491 WP_003899478.1.95497 WP_003899478.1.95508 WP_003899478.1.95509 WP_003899478.1.95529 WP_003899478.1.95556 WP_003899478.1.95557 WP_003899478.1.95565 WP_003899478.1.95578 WP_003899478.1.95580 WP_003899478.1.95585 WP_003899478.1.95643 WP_003899478.1.95685 WP_003899478.1.957 WP_003899478.1.95727 WP_003899478.1.95730 WP_003899478.1.95735 WP_003899478.1.95758 WP_003899478.1.95772 WP_003899478.1.95797 WP_003899478.1.95839 WP_003899478.1.9585 WP_003899478.1.9590 WP_003899478.1.95902 WP_003899478.1.95908 WP_003899478.1.95924 WP_003899478.1.95926 WP_003899478.1.95953 WP_003899478.1.95958 WP_003899478.1.95964 WP_003899478.1.96006 WP_003899478.1.96062 WP_003899478.1.96065 WP_003899478.1.96098 WP_003899478.1.96166 WP_003899478.1.96171 WP_003899478.1.96182 WP_003899478.1.96204 WP_003899478.1.96235 WP_003899478.1.96242 WP_003899478.1.96254 WP_003899478.1.96259 WP_003899478.1.96286 WP_003899478.1.96313 WP_003899478.1.96318 WP_003899478.1.96345 WP_003899478.1.96360 WP_003899478.1.96373 WP_003899478.1.96456 WP_003899478.1.96486 WP_003899478.1.96560 WP_003899478.1.96569 WP_003899478.1.96573 WP_003899478.1.96575 WP_003899478.1.96576 WP_003899478.1.96611 WP_003899478.1.96621 WP_003899478.1.9667 WP_003899478.1.96681 WP_003899478.1.96726 WP_003899478.1.96733 WP_003899478.1.96742 WP_003899478.1.96754 WP_003899478.1.9678 WP_003899478.1.96832 WP_003899478.1.9685 WP_003899478.1.97008 WP_003899478.1.97009 WP_003899478.1.97056 WP_003899478.1.97084 WP_003899478.1.97087 WP_003899478.1.97094 WP_003899478.1.97096 WP_003899478.1.97099 WP_003899478.1.97108 WP_003899478.1.97113 WP_003899478.1.97122 WP_003899478.1.97127 WP_003899478.1.97129 WP_003899478.1.97136 WP_003899478.1.9716 WP_003899478.1.97176 WP_003899478.1.97222 WP_003899478.1.97223 WP_003899478.1.97237 WP_003899478.1.97242 WP_003899478.1.97270 WP_003899478.1.97283 WP_003899478.1.97296 WP_003899478.1.97321 WP_003899478.1.97325 WP_003899478.1.97330 WP_003899478.1.97376 WP_003899478.1.9739 WP_003899478.1.97462 WP_003899478.1.97517 WP_003899478.1.97519 WP_003899478.1.97535 WP_003899478.1.97540 WP_003899478.1.97546 WP_003899478.1.97550 WP_003899478.1.97568 WP_003899478.1.97577 WP_003899478.1.97584 WP_003899478.1.9759 WP_003899478.1.97591 WP_003899478.1.97596 WP_003899478.1.97609 WP_003899478.1.97618 WP_003899478.1.9763 WP_003899478.1.97669 WP_003899478.1.97673 WP_003899478.1.97701 WP_003899478.1.9773 WP_003899478.1.97730 WP_003899478.1.97740 WP_003899478.1.97751 WP_003899478.1.97754 WP_003899478.1.97797 WP_003899478.1.9782 WP_003899478.1.9784 WP_003899478.1.97888 WP_003899478.1.9790 WP_003899478.1.9795 WP_003899478.1.97951 WP_003899478.1.97958 WP_003899478.1.97966 WP_003899478.1.97977 WP_003899478.1.97979 WP_003899478.1.97995 WP_003899478.1.98018 WP_003899478.1.98034 WP_003899478.1.98052 WP_003899478.1.98071 WP_003899478.1.98072 WP_003899478.1.98114 WP_003899478.1.98128 WP_003899478.1.98181 WP_003899478.1.98188 WP_003899478.1.98189 WP_003899478.1.98213 WP_003899478.1.98225 WP_003899478.1.98291 WP_003899478.1.98350 WP_003899478.1.98395 WP_003899478.1.98412 WP_003899478.1.98441 WP_003899478.1.98443 WP_003899478.1.98462 WP_003899478.1.9848 WP_003899478.1.98482 WP_003899478.1.98486 WP_003899478.1.98488 WP_003899478.1.98503 WP_003899478.1.98524 WP_003899478.1.98536 WP_003899478.1.98541 WP_003899478.1.98566 WP_003899478.1.98576 WP_003899478.1.98590 WP_003899478.1.98594 WP_003899478.1.98599 WP_003899478.1.98629 WP_003899478.1.98645 WP_003899478.1.98646 WP_003899478.1.98649 WP_003899478.1.98656 WP_003899478.1.98674 WP_003899478.1.98697 WP_003899478.1.98739 WP_003899478.1.98749 WP_003899478.1.98765 WP_003899478.1.98770 WP_003899478.1.98777 WP_003899478.1.98778 WP_003899478.1.98802 WP_003899478.1.98838 WP_003899478.1.98850 WP_003899478.1.98906 WP_003899478.1.98935 WP_003899478.1.98948 WP_003899478.1.98953 WP_003899478.1.98984 WP_003899478.1.99023 WP_003899478.1.99030 WP_003899478.1.99037 WP_003899478.1.99062 WP_003899478.1.99086 WP_003899478.1.99115 WP_003899478.1.99117 WP_003899478.1.99161 WP_003899478.1.99176 WP_003899478.1.99205 WP_003899478.1.99216 WP_003899478.1.99222 WP_003899478.1.99251 WP_003899478.1.99269 WP_003899478.1.99294 WP_003899478.1.99312 WP_003899478.1.99315 WP_003899478.1.99316 WP_003899478.1.99322 WP_003899478.1.99328 WP_003899478.1.99365 WP_003899478.1.99368 WP_003899478.1.99379 WP_003899478.1.99396 WP_003899478.1.99402 WP_003899478.1.99404 WP_003899478.1.99419 WP_003899478.1.99438 WP_003899478.1.99460 WP_003899478.1.99468 WP_003899478.1.99513 WP_003899478.1.99529 WP_003899478.1.99548 WP_003899478.1.99572 WP_003899478.1.99575 WP_003899478.1.99578 WP_003899478.1.99605 WP_003899478.1.99609 WP_003899478.1.99617 WP_003899478.1.99635 WP_003899478.1.99650 WP_003899478.1.99672 WP_003899478.1.99701 WP_003899478.1.99711 WP_003899478.1.99740 WP_003899478.1.99745 WP_003899478.1.99749 WP_003899478.1.9976 WP_003899478.1.99798 WP_003899478.1.99817 WP_003899478.1.99832 WP_003899478.1.99847 WP_003899478.1.99852 WP_003899478.1.99886 WP_003899478.1.99897 WP_003899478.1.99899 WP_003899478.1.99915 WP_003899478.1.9993 WP_003899478.1.99982 WP_003899478.1.99991 gi|15609918|ref|NP_217297.1| gi|148662623|ref|YP_001284146.1| gi|449064853|ref|YP_007431936.1| gi|15609918|ref|NP_217297.1| gi|253798135|ref|YP_003031136.1| gi|385999562|ref|YP_005917861.1| gi|378772516|ref|YP_005172249.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]