SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I6X5C9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I6X5C9
Domain Number 1 Region: 185-329
Classification Level Classification E-value
Superfamily Riboflavin kinase-like 9.37e-39
Family ATP-dependent riboflavin kinase-like 0.00054
Further Details:      
 
Domain Number 2 Region: 23-186
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 4.5e-30
Family Adenylyltransferase 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I6X5C9
Sequence length 331
Comment (tr|I6X5C9|I6X5C9_MYCTU) FAD synthase {ECO:0000256|PIRNR:PIRNR004491} KW=Complete proteome; Reference proteome OX=83332 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv). GN=Rv2786c OC=Mycobacterium; Mycobacterium tuberculosis complex.
Sequence
MRRRLAIVQRWRGQDEIPTDWGRCVLTIGVFDGVHRGHAELIAHAVKAGRARGVPAVLMT
FDPHPMEVVYPGSHPAQLTTLTRRAELVQDLGIEVFLVMPFTTDFMKLTPDRFIHELLVE
HLHVVEVVVGENFTFGKKAAGNVDTLRRAGERFGFAVESMSLVSEHHSNETVTFSSTYIR
SCVDAGDMVAAMEALGRPHRVEGVVVRGEGRGAELGFPTANVAPPMYSAIPADGVYAAWF
TVLGHGPVTGTVVPGERYQAAVSVGTNPTFSGRTRTVEAFVLDTTADLYGQHVALDFVGR
IRGQKKFESVRQLVAAMGADTERARDLLSTG
Download sequence
Identical sequences A0A045IJ12 A0A0C7DRJ5 A0A0H3MDE9 A0A1R3Y2C3 A5U6D9 F8M3P1 I6X5C9 M8CJN4 O33328
gi|121638666|ref|YP_978890.1| gi|253798130|ref|YP_003031131.1| NP_217302.1.84033 WP_003414131.1.100000 WP_003414131.1.100069 WP_003414131.1.100087 WP_003414131.1.10015 WP_003414131.1.100208 WP_003414131.1.100216 WP_003414131.1.10022 WP_003414131.1.100255 WP_003414131.1.100260 WP_003414131.1.100270 WP_003414131.1.100279 WP_003414131.1.100286 WP_003414131.1.100308 WP_003414131.1.100309 WP_003414131.1.100318 WP_003414131.1.100337 WP_003414131.1.10037 WP_003414131.1.100383 WP_003414131.1.100395 WP_003414131.1.100396 WP_003414131.1.1004 WP_003414131.1.100401 WP_003414131.1.100459 WP_003414131.1.100460 WP_003414131.1.100552 WP_003414131.1.100581 WP_003414131.1.100600 WP_003414131.1.100625 WP_003414131.1.10064 WP_003414131.1.100666 WP_003414131.1.100671 WP_003414131.1.100677 WP_003414131.1.100682 WP_003414131.1.100697 WP_003414131.1.100703 WP_003414131.1.100716 WP_003414131.1.100754 WP_003414131.1.100757 WP_003414131.1.100772 WP_003414131.1.1008 WP_003414131.1.100812 WP_003414131.1.100845 WP_003414131.1.100866 WP_003414131.1.10088 WP_003414131.1.100889 WP_003414131.1.10090 WP_003414131.1.100910 WP_003414131.1.100915 WP_003414131.1.100918 WP_003414131.1.100935 WP_003414131.1.100984 WP_003414131.1.100992 WP_003414131.1.100998 WP_003414131.1.101 WP_003414131.1.101025 WP_003414131.1.101028 WP_003414131.1.10104 WP_003414131.1.101048 WP_003414131.1.101054 WP_003414131.1.101143 WP_003414131.1.101146 WP_003414131.1.10116 WP_003414131.1.101209 WP_003414131.1.10125 WP_003414131.1.101290 WP_003414131.1.101323 WP_003414131.1.101324 WP_003414131.1.101350 WP_003414131.1.101367 WP_003414131.1.101398 WP_003414131.1.101403 WP_003414131.1.101421 WP_003414131.1.10144 WP_003414131.1.101442 WP_003414131.1.10145 WP_003414131.1.101452 WP_003414131.1.101456 WP_003414131.1.101481 WP_003414131.1.101493 WP_003414131.1.101496 WP_003414131.1.101525 WP_003414131.1.101533 WP_003414131.1.101535 WP_003414131.1.101553 WP_003414131.1.101558 WP_003414131.1.10156 WP_003414131.1.101573 WP_003414131.1.101576 WP_003414131.1.10159 WP_003414131.1.101592 WP_003414131.1.101604 WP_003414131.1.101607 WP_003414131.1.101622 WP_003414131.1.101644 WP_003414131.1.101659 WP_003414131.1.101671 WP_003414131.1.101687 WP_003414131.1.101698 WP_003414131.1.10170 WP_003414131.1.101722 WP_003414131.1.101733 WP_003414131.1.101743 WP_003414131.1.101753 WP_003414131.1.101754 WP_003414131.1.101764 WP_003414131.1.101773 WP_003414131.1.101795 WP_003414131.1.101797 WP_003414131.1.101798 WP_003414131.1.101802 WP_003414131.1.101826 WP_003414131.1.101836 WP_003414131.1.101858 WP_003414131.1.101859 WP_003414131.1.101862 WP_003414131.1.101888 WP_003414131.1.101899 WP_003414131.1.1019 WP_003414131.1.101925 WP_003414131.1.10193 WP_003414131.1.101996 WP_003414131.1.102 WP_003414131.1.102008 WP_003414131.1.102017 WP_003414131.1.102053 WP_003414131.1.102055 WP_003414131.1.102063 WP_003414131.1.102099 WP_003414131.1.1021 WP_003414131.1.10211 WP_003414131.1.102119 WP_003414131.1.102121 WP_003414131.1.102143 WP_003414131.1.10216 WP_003414131.1.10253 WP_003414131.1.10262 WP_003414131.1.10272 WP_003414131.1.10277 WP_003414131.1.1033 WP_003414131.1.10350 WP_003414131.1.10362 WP_003414131.1.10376 WP_003414131.1.10396 WP_003414131.1.10414 WP_003414131.1.10421 WP_003414131.1.10430 WP_003414131.1.1044 WP_003414131.1.10440 WP_003414131.1.10445 WP_003414131.1.10471 WP_003414131.1.10472 WP_003414131.1.10489 WP_003414131.1.105 WP_003414131.1.10523 WP_003414131.1.10545 WP_003414131.1.1057 WP_003414131.1.10594 WP_003414131.1.10603 WP_003414131.1.10606 WP_003414131.1.10615 WP_003414131.1.10623 WP_003414131.1.10635 WP_003414131.1.10643 WP_003414131.1.10648 WP_003414131.1.10662 WP_003414131.1.10709 WP_003414131.1.10735 WP_003414131.1.10740 WP_003414131.1.10756 WP_003414131.1.1078 WP_003414131.1.10791 WP_003414131.1.10799 WP_003414131.1.10825 WP_003414131.1.10848 WP_003414131.1.10863 WP_003414131.1.10879 WP_003414131.1.10912 WP_003414131.1.10916 WP_003414131.1.10923 WP_003414131.1.10927 WP_003414131.1.1095 WP_003414131.1.10956 WP_003414131.1.10958 WP_003414131.1.10962 WP_003414131.1.10980 WP_003414131.1.10981 WP_003414131.1.10993 WP_003414131.1.1100 WP_003414131.1.11040 WP_003414131.1.11061 WP_003414131.1.11070 WP_003414131.1.11141 WP_003414131.1.11171 WP_003414131.1.11175 WP_003414131.1.11176 WP_003414131.1.11222 WP_003414131.1.11236 WP_003414131.1.11329 WP_003414131.1.1133 WP_003414131.1.11342 WP_003414131.1.11373 WP_003414131.1.11376 WP_003414131.1.11390 WP_003414131.1.11402 WP_003414131.1.11481 WP_003414131.1.11487 WP_003414131.1.11489 WP_003414131.1.11491 WP_003414131.1.11514 WP_003414131.1.11587 WP_003414131.1.11589 WP_003414131.1.11596 WP_003414131.1.11604 WP_003414131.1.11610 WP_003414131.1.11697 WP_003414131.1.11707 WP_003414131.1.11752 WP_003414131.1.11758 WP_003414131.1.11761 WP_003414131.1.11775 WP_003414131.1.11804 WP_003414131.1.11822 WP_003414131.1.11826 WP_003414131.1.11856 WP_003414131.1.11898 WP_003414131.1.11906 WP_003414131.1.11939 WP_003414131.1.11960 WP_003414131.1.11961 WP_003414131.1.11972 WP_003414131.1.11984 WP_003414131.1.120 WP_003414131.1.12049 WP_003414131.1.12052 WP_003414131.1.12116 WP_003414131.1.12130 WP_003414131.1.12133 WP_003414131.1.12161 WP_003414131.1.12184 WP_003414131.1.12187 WP_003414131.1.12190 WP_003414131.1.12216 WP_003414131.1.12265 WP_003414131.1.12275 WP_003414131.1.12293 WP_003414131.1.12294 WP_003414131.1.123 WP_003414131.1.1231 WP_003414131.1.12327 WP_003414131.1.12338 WP_003414131.1.1236 WP_003414131.1.12371 WP_003414131.1.12372 WP_003414131.1.12389 WP_003414131.1.12406 WP_003414131.1.1241 WP_003414131.1.12421 WP_003414131.1.12424 WP_003414131.1.12446 WP_003414131.1.12464 WP_003414131.1.12479 WP_003414131.1.12523 WP_003414131.1.12526 WP_003414131.1.1255 WP_003414131.1.12550 WP_003414131.1.12551 WP_003414131.1.12563 WP_003414131.1.12611 WP_003414131.1.12669 WP_003414131.1.1267 WP_003414131.1.12672 WP_003414131.1.12692 WP_003414131.1.1271 WP_003414131.1.12710 WP_003414131.1.12768 WP_003414131.1.1279 WP_003414131.1.12794 WP_003414131.1.12801 WP_003414131.1.12804 WP_003414131.1.12821 WP_003414131.1.12841 WP_003414131.1.12854 WP_003414131.1.12871 WP_003414131.1.12901 WP_003414131.1.12941 WP_003414131.1.12947 WP_003414131.1.12957 WP_003414131.1.12972 WP_003414131.1.13028 WP_003414131.1.13043 WP_003414131.1.13086 WP_003414131.1.13087 WP_003414131.1.13090 WP_003414131.1.13096 WP_003414131.1.13163 WP_003414131.1.13175 WP_003414131.1.13183 WP_003414131.1.132 WP_003414131.1.13249 WP_003414131.1.13282 WP_003414131.1.13284 WP_003414131.1.13296 WP_003414131.1.13298 WP_003414131.1.13302 WP_003414131.1.13306 WP_003414131.1.13312 WP_003414131.1.13313 WP_003414131.1.13321 WP_003414131.1.13345 WP_003414131.1.13358 WP_003414131.1.13370 WP_003414131.1.13375 WP_003414131.1.1338 WP_003414131.1.13420 WP_003414131.1.13433 WP_003414131.1.13438 WP_003414131.1.13461 WP_003414131.1.13466 WP_003414131.1.13489 WP_003414131.1.13526 WP_003414131.1.13551 WP_003414131.1.13561 WP_003414131.1.13564 WP_003414131.1.13579 WP_003414131.1.13647 WP_003414131.1.13687 WP_003414131.1.13697 WP_003414131.1.13719 WP_003414131.1.13763 WP_003414131.1.1377 WP_003414131.1.13774 WP_003414131.1.13786 WP_003414131.1.13793 WP_003414131.1.13794 WP_003414131.1.13817 WP_003414131.1.13834 WP_003414131.1.13866 WP_003414131.1.13880 WP_003414131.1.13899 WP_003414131.1.13909 WP_003414131.1.13919 WP_003414131.1.13920 WP_003414131.1.13952 WP_003414131.1.13953 WP_003414131.1.13962 WP_003414131.1.1398 WP_003414131.1.13988 WP_003414131.1.14027 WP_003414131.1.14046 WP_003414131.1.14115 WP_003414131.1.1415 WP_003414131.1.14152 WP_003414131.1.14158 WP_003414131.1.14162 WP_003414131.1.14175 WP_003414131.1.14178 WP_003414131.1.14194 WP_003414131.1.14195 WP_003414131.1.14208 WP_003414131.1.14238 WP_003414131.1.14266 WP_003414131.1.14273 WP_003414131.1.14303 WP_003414131.1.14306 WP_003414131.1.14307 WP_003414131.1.14310 WP_003414131.1.14341 WP_003414131.1.14416 WP_003414131.1.14428 WP_003414131.1.14441 WP_003414131.1.14469 WP_003414131.1.14477 WP_003414131.1.14504 WP_003414131.1.14514 WP_003414131.1.1452 WP_003414131.1.14527 WP_003414131.1.1454 WP_003414131.1.14544 WP_003414131.1.14548 WP_003414131.1.14551 WP_003414131.1.14561 WP_003414131.1.14573 WP_003414131.1.1462 WP_003414131.1.14658 WP_003414131.1.14667 WP_003414131.1.14668 WP_003414131.1.14675 WP_003414131.1.14694 WP_003414131.1.14695 WP_003414131.1.14709 WP_003414131.1.14766 WP_003414131.1.14783 WP_003414131.1.14865 WP_003414131.1.14872 WP_003414131.1.14905 WP_003414131.1.14926 WP_003414131.1.14951 WP_003414131.1.14955 WP_003414131.1.15003 WP_003414131.1.15009 WP_003414131.1.15028 WP_003414131.1.15040 WP_003414131.1.15052 WP_003414131.1.15089 WP_003414131.1.1509 WP_003414131.1.15126 WP_003414131.1.15131 WP_003414131.1.15168 WP_003414131.1.15172 WP_003414131.1.15174 WP_003414131.1.15187 WP_003414131.1.15196 WP_003414131.1.15210 WP_003414131.1.15216 WP_003414131.1.1523 WP_003414131.1.15232 WP_003414131.1.15238 WP_003414131.1.15240 WP_003414131.1.15253 WP_003414131.1.15267 WP_003414131.1.1527 WP_003414131.1.15292 WP_003414131.1.15299 WP_003414131.1.15302 WP_003414131.1.15322 WP_003414131.1.1534 WP_003414131.1.15345 WP_003414131.1.15365 WP_003414131.1.15372 WP_003414131.1.15386 WP_003414131.1.15387 WP_003414131.1.15442 WP_003414131.1.15447 WP_003414131.1.15449 WP_003414131.1.15477 WP_003414131.1.15481 WP_003414131.1.15492 WP_003414131.1.15511 WP_003414131.1.15512 WP_003414131.1.15558 WP_003414131.1.15559 WP_003414131.1.15566 WP_003414131.1.15599 WP_003414131.1.1560 WP_003414131.1.15611 WP_003414131.1.1563 WP_003414131.1.15633 WP_003414131.1.15643 WP_003414131.1.15688 WP_003414131.1.15755 WP_003414131.1.15763 WP_003414131.1.15774 WP_003414131.1.1578 WP_003414131.1.15780 WP_003414131.1.15827 WP_003414131.1.15834 WP_003414131.1.15842 WP_003414131.1.15848 WP_003414131.1.15853 WP_003414131.1.15870 WP_003414131.1.15877 WP_003414131.1.15893 WP_003414131.1.15896 WP_003414131.1.15926 WP_003414131.1.15933 WP_003414131.1.15946 WP_003414131.1.15958 WP_003414131.1.15973 WP_003414131.1.15987 WP_003414131.1.15993 WP_003414131.1.16009 WP_003414131.1.16025 WP_003414131.1.16043 WP_003414131.1.16055 WP_003414131.1.16069 WP_003414131.1.16077 WP_003414131.1.16106 WP_003414131.1.16108 WP_003414131.1.16110 WP_003414131.1.16130 WP_003414131.1.16136 WP_003414131.1.16139 WP_003414131.1.16141 WP_003414131.1.16143 WP_003414131.1.1630 WP_003414131.1.16318 WP_003414131.1.1632 WP_003414131.1.16327 WP_003414131.1.16334 WP_003414131.1.16341 WP_003414131.1.16345 WP_003414131.1.16374 WP_003414131.1.16384 WP_003414131.1.16386 WP_003414131.1.164 WP_003414131.1.1642 WP_003414131.1.16421 WP_003414131.1.16424 WP_003414131.1.16426 WP_003414131.1.16438 WP_003414131.1.1644 WP_003414131.1.16442 WP_003414131.1.16448 WP_003414131.1.16451 WP_003414131.1.16476 WP_003414131.1.16480 WP_003414131.1.16494 WP_003414131.1.1652 WP_003414131.1.16549 WP_003414131.1.16560 WP_003414131.1.16598 WP_003414131.1.16609 WP_003414131.1.16619 WP_003414131.1.16620 WP_003414131.1.16622 WP_003414131.1.16637 WP_003414131.1.1669 WP_003414131.1.16707 WP_003414131.1.16724 WP_003414131.1.16731 WP_003414131.1.16743 WP_003414131.1.1683 WP_003414131.1.16837 WP_003414131.1.16852 WP_003414131.1.16937 WP_003414131.1.16940 WP_003414131.1.16950 WP_003414131.1.16959 WP_003414131.1.16968 WP_003414131.1.1697 WP_003414131.1.16973 WP_003414131.1.16977 WP_003414131.1.16987 WP_003414131.1.17005 WP_003414131.1.17006 WP_003414131.1.17010 WP_003414131.1.17015 WP_003414131.1.17019 WP_003414131.1.17039 WP_003414131.1.17041 WP_003414131.1.17052 WP_003414131.1.17057 WP_003414131.1.17062 WP_003414131.1.1707 WP_003414131.1.17094 WP_003414131.1.17130 WP_003414131.1.17138 WP_003414131.1.17147 WP_003414131.1.17167 WP_003414131.1.17224 WP_003414131.1.17251 WP_003414131.1.17288 WP_003414131.1.17304 WP_003414131.1.17314 WP_003414131.1.17345 WP_003414131.1.17381 WP_003414131.1.17391 WP_003414131.1.17412 WP_003414131.1.1743 WP_003414131.1.17440 WP_003414131.1.17466 WP_003414131.1.17477 WP_003414131.1.17483 WP_003414131.1.17505 WP_003414131.1.17527 WP_003414131.1.17535 WP_003414131.1.17540 WP_003414131.1.17553 WP_003414131.1.17558 WP_003414131.1.17599 WP_003414131.1.17635 WP_003414131.1.17655 WP_003414131.1.17679 WP_003414131.1.1768 WP_003414131.1.17687 WP_003414131.1.17700 WP_003414131.1.17710 WP_003414131.1.17713 WP_003414131.1.17722 WP_003414131.1.17746 WP_003414131.1.17798 WP_003414131.1.17803 WP_003414131.1.17816 WP_003414131.1.17821 WP_003414131.1.17830 WP_003414131.1.17868 WP_003414131.1.17878 WP_003414131.1.1792 WP_003414131.1.17923 WP_003414131.1.1795 WP_003414131.1.17955 WP_003414131.1.17973 WP_003414131.1.18009 WP_003414131.1.18013 WP_003414131.1.18033 WP_003414131.1.18057 WP_003414131.1.18065 WP_003414131.1.18070 WP_003414131.1.18116 WP_003414131.1.18120 WP_003414131.1.18126 WP_003414131.1.1817 WP_003414131.1.18170 WP_003414131.1.18206 WP_003414131.1.18216 WP_003414131.1.18240 WP_003414131.1.18257 WP_003414131.1.18297 WP_003414131.1.18306 WP_003414131.1.18364 WP_003414131.1.18399 WP_003414131.1.18411 WP_003414131.1.18444 WP_003414131.1.18448 WP_003414131.1.18467 WP_003414131.1.18476 WP_003414131.1.18522 WP_003414131.1.18580 WP_003414131.1.18582 WP_003414131.1.18587 WP_003414131.1.186 WP_003414131.1.18601 WP_003414131.1.18639 WP_003414131.1.18646 WP_003414131.1.18647 WP_003414131.1.1868 WP_003414131.1.18694 WP_003414131.1.18710 WP_003414131.1.18751 WP_003414131.1.18781 WP_003414131.1.18793 WP_003414131.1.18804 WP_003414131.1.18816 WP_003414131.1.18823 WP_003414131.1.18838 WP_003414131.1.18849 WP_003414131.1.18856 WP_003414131.1.18945 WP_003414131.1.1898 WP_003414131.1.19005 WP_003414131.1.19056 WP_003414131.1.19063 WP_003414131.1.19066 WP_003414131.1.19071 WP_003414131.1.19085 WP_003414131.1.19094 WP_003414131.1.19144 WP_003414131.1.19159 WP_003414131.1.19193 WP_003414131.1.19231 WP_003414131.1.19243 WP_003414131.1.19264 WP_003414131.1.19295 WP_003414131.1.19307 WP_003414131.1.19326 WP_003414131.1.1933 WP_003414131.1.19364 WP_003414131.1.19400 WP_003414131.1.19426 WP_003414131.1.19429 WP_003414131.1.19464 WP_003414131.1.19480 WP_003414131.1.19512 WP_003414131.1.19553 WP_003414131.1.19564 WP_003414131.1.19568 WP_003414131.1.19572 WP_003414131.1.19595 WP_003414131.1.19596 WP_003414131.1.19600 WP_003414131.1.19630 WP_003414131.1.1967 WP_003414131.1.19694 WP_003414131.1.1970 WP_003414131.1.19707 WP_003414131.1.19742 WP_003414131.1.19785 WP_003414131.1.19820 WP_003414131.1.19868 WP_003414131.1.19874 WP_003414131.1.19890 WP_003414131.1.19900 WP_003414131.1.19922 WP_003414131.1.19936 WP_003414131.1.19946 WP_003414131.1.19949 WP_003414131.1.19964 WP_003414131.1.20007 WP_003414131.1.20028 WP_003414131.1.2003 WP_003414131.1.20037 WP_003414131.1.20039 WP_003414131.1.20082 WP_003414131.1.20085 WP_003414131.1.20097 WP_003414131.1.20116 WP_003414131.1.20130 WP_003414131.1.20140 WP_003414131.1.20141 WP_003414131.1.20142 WP_003414131.1.20158 WP_003414131.1.20239 WP_003414131.1.20243 WP_003414131.1.20259 WP_003414131.1.20262 WP_003414131.1.20268 WP_003414131.1.20272 WP_003414131.1.20273 WP_003414131.1.20280 WP_003414131.1.20294 WP_003414131.1.20300 WP_003414131.1.20309 WP_003414131.1.20322 WP_003414131.1.2037 WP_003414131.1.20372 WP_003414131.1.20381 WP_003414131.1.204 WP_003414131.1.20427 WP_003414131.1.20432 WP_003414131.1.20457 WP_003414131.1.20459 WP_003414131.1.20460 WP_003414131.1.20542 WP_003414131.1.20578 WP_003414131.1.20608 WP_003414131.1.20624 WP_003414131.1.20628 WP_003414131.1.2066 WP_003414131.1.20707 WP_003414131.1.20722 WP_003414131.1.20729 WP_003414131.1.20742 WP_003414131.1.20751 WP_003414131.1.20776 WP_003414131.1.20843 WP_003414131.1.20850 WP_003414131.1.2086 WP_003414131.1.20868 WP_003414131.1.20876 WP_003414131.1.20897 WP_003414131.1.20898 WP_003414131.1.2090 WP_003414131.1.20911 WP_003414131.1.20916 WP_003414131.1.20921 WP_003414131.1.20926 WP_003414131.1.20927 WP_003414131.1.20951 WP_003414131.1.20970 WP_003414131.1.2104 WP_003414131.1.21070 WP_003414131.1.21127 WP_003414131.1.21135 WP_003414131.1.21173 WP_003414131.1.21187 WP_003414131.1.212 WP_003414131.1.2120 WP_003414131.1.21218 WP_003414131.1.21219 WP_003414131.1.2123 WP_003414131.1.21231 WP_003414131.1.21234 WP_003414131.1.2126 WP_003414131.1.21307 WP_003414131.1.2131 WP_003414131.1.21311 WP_003414131.1.21321 WP_003414131.1.21365 WP_003414131.1.2137 WP_003414131.1.21392 WP_003414131.1.21397 WP_003414131.1.21415 WP_003414131.1.21418 WP_003414131.1.21430 WP_003414131.1.21434 WP_003414131.1.21444 WP_003414131.1.21468 WP_003414131.1.21498 WP_003414131.1.21509 WP_003414131.1.21513 WP_003414131.1.21560 WP_003414131.1.21565 WP_003414131.1.21586 WP_003414131.1.21591 WP_003414131.1.21594 WP_003414131.1.21602 WP_003414131.1.21615 WP_003414131.1.21638 WP_003414131.1.21639 WP_003414131.1.21655 WP_003414131.1.21658 WP_003414131.1.2168 WP_003414131.1.2174 WP_003414131.1.21741 WP_003414131.1.21742 WP_003414131.1.21777 WP_003414131.1.21786 WP_003414131.1.21795 WP_003414131.1.21826 WP_003414131.1.21829 WP_003414131.1.21840 WP_003414131.1.21843 WP_003414131.1.21873 WP_003414131.1.2188 WP_003414131.1.21882 WP_003414131.1.21906 WP_003414131.1.21912 WP_003414131.1.2194 WP_003414131.1.21941 WP_003414131.1.21956 WP_003414131.1.21958 WP_003414131.1.21960 WP_003414131.1.21971 WP_003414131.1.21973 WP_003414131.1.21983 WP_003414131.1.22003 WP_003414131.1.22013 WP_003414131.1.22025 WP_003414131.1.22036 WP_003414131.1.22075 WP_003414131.1.22092 WP_003414131.1.2212 WP_003414131.1.22127 WP_003414131.1.22140 WP_003414131.1.22233 WP_003414131.1.22255 WP_003414131.1.22277 WP_003414131.1.22305 WP_003414131.1.22348 WP_003414131.1.22356 WP_003414131.1.22366 WP_003414131.1.2238 WP_003414131.1.22380 WP_003414131.1.22438 WP_003414131.1.22445 WP_003414131.1.22490 WP_003414131.1.22511 WP_003414131.1.22524 WP_003414131.1.2253 WP_003414131.1.22585 WP_003414131.1.22589 WP_003414131.1.22606 WP_003414131.1.22608 WP_003414131.1.22609 WP_003414131.1.22618 WP_003414131.1.2262 WP_003414131.1.22624 WP_003414131.1.22629 WP_003414131.1.22647 WP_003414131.1.22664 WP_003414131.1.22665 WP_003414131.1.22670 WP_003414131.1.22674 WP_003414131.1.22680 WP_003414131.1.22725 WP_003414131.1.22728 WP_003414131.1.22733 WP_003414131.1.22737 WP_003414131.1.2275 WP_003414131.1.22754 WP_003414131.1.22797 WP_003414131.1.22800 WP_003414131.1.22804 WP_003414131.1.22829 WP_003414131.1.22840 WP_003414131.1.22844 WP_003414131.1.22963 WP_003414131.1.22970 WP_003414131.1.22996 WP_003414131.1.22997 WP_003414131.1.22999 WP_003414131.1.23015 WP_003414131.1.23032 WP_003414131.1.231 WP_003414131.1.23101 WP_003414131.1.2312 WP_003414131.1.23140 WP_003414131.1.23153 WP_003414131.1.23171 WP_003414131.1.23199 WP_003414131.1.2320 WP_003414131.1.23204 WP_003414131.1.23216 WP_003414131.1.23229 WP_003414131.1.2326 WP_003414131.1.23272 WP_003414131.1.23289 WP_003414131.1.2329 WP_003414131.1.23308 WP_003414131.1.23316 WP_003414131.1.23321 WP_003414131.1.23325 WP_003414131.1.2339 WP_003414131.1.23406 WP_003414131.1.23438 WP_003414131.1.23445 WP_003414131.1.23447 WP_003414131.1.23452 WP_003414131.1.23461 WP_003414131.1.2349 WP_003414131.1.23496 WP_003414131.1.23497 WP_003414131.1.23506 WP_003414131.1.23530 WP_003414131.1.23539 WP_003414131.1.23546 WP_003414131.1.23551 WP_003414131.1.23573 WP_003414131.1.23583 WP_003414131.1.23588 WP_003414131.1.23677 WP_003414131.1.23683 WP_003414131.1.23692 WP_003414131.1.23694 WP_003414131.1.2371 WP_003414131.1.23803 WP_003414131.1.23807 WP_003414131.1.23825 WP_003414131.1.23832 WP_003414131.1.2384 WP_003414131.1.23843 WP_003414131.1.23863 WP_003414131.1.2387 WP_003414131.1.23894 WP_003414131.1.23993 WP_003414131.1.2400 WP_003414131.1.24007 WP_003414131.1.24008 WP_003414131.1.24046 WP_003414131.1.24057 WP_003414131.1.24062 WP_003414131.1.24113 WP_003414131.1.24119 WP_003414131.1.24128 WP_003414131.1.24140 WP_003414131.1.24176 WP_003414131.1.24190 WP_003414131.1.24202 WP_003414131.1.24244 WP_003414131.1.24261 WP_003414131.1.24284 WP_003414131.1.24294 WP_003414131.1.24357 WP_003414131.1.24396 WP_003414131.1.24414 WP_003414131.1.24423 WP_003414131.1.2443 WP_003414131.1.24461 WP_003414131.1.24500 WP_003414131.1.24507 WP_003414131.1.24509 WP_003414131.1.24529 WP_003414131.1.24553 WP_003414131.1.24599 WP_003414131.1.24629 WP_003414131.1.24638 WP_003414131.1.24648 WP_003414131.1.2466 WP_003414131.1.24767 WP_003414131.1.24824 WP_003414131.1.24831 WP_003414131.1.24840 WP_003414131.1.24848 WP_003414131.1.24857 WP_003414131.1.2487 WP_003414131.1.24893 WP_003414131.1.24907 WP_003414131.1.24933 WP_003414131.1.24956 WP_003414131.1.24958 WP_003414131.1.24985 WP_003414131.1.2499 WP_003414131.1.25004 WP_003414131.1.2505 WP_003414131.1.25051 WP_003414131.1.2507 WP_003414131.1.25096 WP_003414131.1.25103 WP_003414131.1.25129 WP_003414131.1.25171 WP_003414131.1.25184 WP_003414131.1.25247 WP_003414131.1.25252 WP_003414131.1.25278 WP_003414131.1.25283 WP_003414131.1.25309 WP_003414131.1.25313 WP_003414131.1.25342 WP_003414131.1.25343 WP_003414131.1.25367 WP_003414131.1.25393 WP_003414131.1.25406 WP_003414131.1.25435 WP_003414131.1.25437 WP_003414131.1.25445 WP_003414131.1.25455 WP_003414131.1.25473 WP_003414131.1.25504 WP_003414131.1.25513 WP_003414131.1.25542 WP_003414131.1.25579 WP_003414131.1.25594 WP_003414131.1.25606 WP_003414131.1.2566 WP_003414131.1.25673 WP_003414131.1.25674 WP_003414131.1.25693 WP_003414131.1.25699 WP_003414131.1.25727 WP_003414131.1.25736 WP_003414131.1.25738 WP_003414131.1.25756 WP_003414131.1.25759 WP_003414131.1.2580 WP_003414131.1.25813 WP_003414131.1.25853 WP_003414131.1.25854 WP_003414131.1.25874 WP_003414131.1.25885 WP_003414131.1.25892 WP_003414131.1.25906 WP_003414131.1.25914 WP_003414131.1.25916 WP_003414131.1.2594 WP_003414131.1.25954 WP_003414131.1.25965 WP_003414131.1.25972 WP_003414131.1.26017 WP_003414131.1.26032 WP_003414131.1.26038 WP_003414131.1.26072 WP_003414131.1.26089 WP_003414131.1.26097 WP_003414131.1.26098 WP_003414131.1.26108 WP_003414131.1.26109 WP_003414131.1.26118 WP_003414131.1.26126 WP_003414131.1.2614 WP_003414131.1.26168 WP_003414131.1.26182 WP_003414131.1.26190 WP_003414131.1.2620 WP_003414131.1.26234 WP_003414131.1.26243 WP_003414131.1.26265 WP_003414131.1.26267 WP_003414131.1.26292 WP_003414131.1.26310 WP_003414131.1.26328 WP_003414131.1.26349 WP_003414131.1.26366 WP_003414131.1.26374 WP_003414131.1.26407 WP_003414131.1.26412 WP_003414131.1.26454 WP_003414131.1.26464 WP_003414131.1.2653 WP_003414131.1.26560 WP_003414131.1.26571 WP_003414131.1.2659 WP_003414131.1.26597 WP_003414131.1.26603 WP_003414131.1.26629 WP_003414131.1.26651 WP_003414131.1.26702 WP_003414131.1.26707 WP_003414131.1.26710 WP_003414131.1.26719 WP_003414131.1.26737 WP_003414131.1.26738 WP_003414131.1.26745 WP_003414131.1.26756 WP_003414131.1.2676 WP_003414131.1.2677 WP_003414131.1.26779 WP_003414131.1.26780 WP_003414131.1.26798 WP_003414131.1.26854 WP_003414131.1.26868 WP_003414131.1.26876 WP_003414131.1.26888 WP_003414131.1.26914 WP_003414131.1.26945 WP_003414131.1.26959 WP_003414131.1.26969 WP_003414131.1.26984 WP_003414131.1.26992 WP_003414131.1.27004 WP_003414131.1.27017 WP_003414131.1.27045 WP_003414131.1.27074 WP_003414131.1.27075 WP_003414131.1.27128 WP_003414131.1.27130 WP_003414131.1.27139 WP_003414131.1.27152 WP_003414131.1.27162 WP_003414131.1.27164 WP_003414131.1.27193 WP_003414131.1.27254 WP_003414131.1.27278 WP_003414131.1.27343 WP_003414131.1.27352 WP_003414131.1.27369 WP_003414131.1.27391 WP_003414131.1.27398 WP_003414131.1.27402 WP_003414131.1.27410 WP_003414131.1.27411 WP_003414131.1.27449 WP_003414131.1.27460 WP_003414131.1.27463 WP_003414131.1.2749 WP_003414131.1.27492 WP_003414131.1.27528 WP_003414131.1.27541 WP_003414131.1.27576 WP_003414131.1.27582 WP_003414131.1.27596 WP_003414131.1.2766 WP_003414131.1.277 WP_003414131.1.27724 WP_003414131.1.27730 WP_003414131.1.27736 WP_003414131.1.27743 WP_003414131.1.27750 WP_003414131.1.27771 WP_003414131.1.27779 WP_003414131.1.27795 WP_003414131.1.27803 WP_003414131.1.27819 WP_003414131.1.27835 WP_003414131.1.27915 WP_003414131.1.27935 WP_003414131.1.27962 WP_003414131.1.28053 WP_003414131.1.28092 WP_003414131.1.28106 WP_003414131.1.28131 WP_003414131.1.28142 WP_003414131.1.28159 WP_003414131.1.2816 WP_003414131.1.28161 WP_003414131.1.28192 WP_003414131.1.28202 WP_003414131.1.28241 WP_003414131.1.28242 WP_003414131.1.28251 WP_003414131.1.28269 WP_003414131.1.28276 WP_003414131.1.28293 WP_003414131.1.28331 WP_003414131.1.28367 WP_003414131.1.28378 WP_003414131.1.28391 WP_003414131.1.2842 WP_003414131.1.28448 WP_003414131.1.2847 WP_003414131.1.28471 WP_003414131.1.28473 WP_003414131.1.28493 WP_003414131.1.28497 WP_003414131.1.28530 WP_003414131.1.28545 WP_003414131.1.28561 WP_003414131.1.28567 WP_003414131.1.28585 WP_003414131.1.286 WP_003414131.1.28610 WP_003414131.1.28617 WP_003414131.1.28634 WP_003414131.1.28642 WP_003414131.1.28671 WP_003414131.1.28682 WP_003414131.1.28698 WP_003414131.1.28703 WP_003414131.1.28739 WP_003414131.1.28758 WP_003414131.1.28781 WP_003414131.1.28787 WP_003414131.1.28827 WP_003414131.1.28839 WP_003414131.1.28847 WP_003414131.1.28850 WP_003414131.1.28851 WP_003414131.1.28865 WP_003414131.1.28897 WP_003414131.1.28914 WP_003414131.1.28935 WP_003414131.1.28936 WP_003414131.1.28939 WP_003414131.1.28943 WP_003414131.1.28952 WP_003414131.1.2899 WP_003414131.1.29000 WP_003414131.1.2901 WP_003414131.1.29028 WP_003414131.1.29033 WP_003414131.1.29058 WP_003414131.1.29078 WP_003414131.1.29102 WP_003414131.1.29115 WP_003414131.1.2916 WP_003414131.1.29217 WP_003414131.1.29223 WP_003414131.1.29234 WP_003414131.1.29264 WP_003414131.1.29275 WP_003414131.1.29306 WP_003414131.1.29339 WP_003414131.1.29348 WP_003414131.1.29364 WP_003414131.1.29367 WP_003414131.1.2938 WP_003414131.1.29399 WP_003414131.1.29426 WP_003414131.1.2944 WP_003414131.1.29449 WP_003414131.1.29450 WP_003414131.1.29452 WP_003414131.1.2949 WP_003414131.1.29510 WP_003414131.1.29515 WP_003414131.1.29525 WP_003414131.1.2953 WP_003414131.1.29559 WP_003414131.1.29587 WP_003414131.1.2959 WP_003414131.1.29592 WP_003414131.1.29599 WP_003414131.1.29611 WP_003414131.1.29632 WP_003414131.1.29649 WP_003414131.1.2965 WP_003414131.1.29659 WP_003414131.1.29696 WP_003414131.1.29698 WP_003414131.1.29718 WP_003414131.1.29742 WP_003414131.1.29745 WP_003414131.1.29747 WP_003414131.1.29769 WP_003414131.1.29825 WP_003414131.1.29830 WP_003414131.1.29847 WP_003414131.1.29861 WP_003414131.1.29869 WP_003414131.1.29883 WP_003414131.1.29890 WP_003414131.1.299 WP_003414131.1.29931 WP_003414131.1.29960 WP_003414131.1.3004 WP_003414131.1.30040 WP_003414131.1.30043 WP_003414131.1.30074 WP_003414131.1.30097 WP_003414131.1.30101 WP_003414131.1.30106 WP_003414131.1.30114 WP_003414131.1.30126 WP_003414131.1.30131 WP_003414131.1.30138 WP_003414131.1.30139 WP_003414131.1.30145 WP_003414131.1.30211 WP_003414131.1.30224 WP_003414131.1.30235 WP_003414131.1.30237 WP_003414131.1.3027 WP_003414131.1.30279 WP_003414131.1.30282 WP_003414131.1.30283 WP_003414131.1.30288 WP_003414131.1.30291 WP_003414131.1.30363 WP_003414131.1.30374 WP_003414131.1.30404 WP_003414131.1.3043 WP_003414131.1.30433 WP_003414131.1.30438 WP_003414131.1.30462 WP_003414131.1.30464 WP_003414131.1.30468 WP_003414131.1.30500 WP_003414131.1.3057 WP_003414131.1.30574 WP_003414131.1.30628 WP_003414131.1.30641 WP_003414131.1.30642 WP_003414131.1.30661 WP_003414131.1.30669 WP_003414131.1.30683 WP_003414131.1.30699 WP_003414131.1.30709 WP_003414131.1.30713 WP_003414131.1.30716 WP_003414131.1.30719 WP_003414131.1.30730 WP_003414131.1.30732 WP_003414131.1.30736 WP_003414131.1.30745 WP_003414131.1.30760 WP_003414131.1.30791 WP_003414131.1.308 WP_003414131.1.30807 WP_003414131.1.30818 WP_003414131.1.30824 WP_003414131.1.30848 WP_003414131.1.30877 WP_003414131.1.30888 WP_003414131.1.30901 WP_003414131.1.30903 WP_003414131.1.30912 WP_003414131.1.30913 WP_003414131.1.30914 WP_003414131.1.30919 WP_003414131.1.30977 WP_003414131.1.3100 WP_003414131.1.31002 WP_003414131.1.3101 WP_003414131.1.31034 WP_003414131.1.31047 WP_003414131.1.31070 WP_003414131.1.31074 WP_003414131.1.31102 WP_003414131.1.31127 WP_003414131.1.31184 WP_003414131.1.31199 WP_003414131.1.31226 WP_003414131.1.31230 WP_003414131.1.31233 WP_003414131.1.31263 WP_003414131.1.31264 WP_003414131.1.31270 WP_003414131.1.31287 WP_003414131.1.31290 WP_003414131.1.31304 WP_003414131.1.31346 WP_003414131.1.31348 WP_003414131.1.31354 WP_003414131.1.31390 WP_003414131.1.31414 WP_003414131.1.31417 WP_003414131.1.31428 WP_003414131.1.3143 WP_003414131.1.31458 WP_003414131.1.31483 WP_003414131.1.3149 WP_003414131.1.31498 WP_003414131.1.31507 WP_003414131.1.31537 WP_003414131.1.31548 WP_003414131.1.31569 WP_003414131.1.31573 WP_003414131.1.316 WP_003414131.1.31629 WP_003414131.1.31666 WP_003414131.1.31693 WP_003414131.1.31703 WP_003414131.1.31744 WP_003414131.1.31770 WP_003414131.1.31776 WP_003414131.1.31783 WP_003414131.1.318 WP_003414131.1.3184 WP_003414131.1.31840 WP_003414131.1.31880 WP_003414131.1.31911 WP_003414131.1.31930 WP_003414131.1.31932 WP_003414131.1.31955 WP_003414131.1.31985 WP_003414131.1.31991 WP_003414131.1.31995 WP_003414131.1.32004 WP_003414131.1.32039 WP_003414131.1.32045 WP_003414131.1.32071 WP_003414131.1.32098 WP_003414131.1.32132 WP_003414131.1.32157 WP_003414131.1.32164 WP_003414131.1.32179 WP_003414131.1.32198 WP_003414131.1.32297 WP_003414131.1.32317 WP_003414131.1.32383 WP_003414131.1.32400 WP_003414131.1.32403 WP_003414131.1.32416 WP_003414131.1.32421 WP_003414131.1.32433 WP_003414131.1.32461 WP_003414131.1.32482 WP_003414131.1.32503 WP_003414131.1.32556 WP_003414131.1.32562 WP_003414131.1.32569 WP_003414131.1.32592 WP_003414131.1.32620 WP_003414131.1.32647 WP_003414131.1.32653 WP_003414131.1.32654 WP_003414131.1.3268 WP_003414131.1.32695 WP_003414131.1.32706 WP_003414131.1.32716 WP_003414131.1.32738 WP_003414131.1.32752 WP_003414131.1.32780 WP_003414131.1.32781 WP_003414131.1.32793 WP_003414131.1.32799 WP_003414131.1.32822 WP_003414131.1.32833 WP_003414131.1.32862 WP_003414131.1.32880 WP_003414131.1.32897 WP_003414131.1.32909 WP_003414131.1.32935 WP_003414131.1.32974 WP_003414131.1.33007 WP_003414131.1.3302 WP_003414131.1.33028 WP_003414131.1.33035 WP_003414131.1.33044 WP_003414131.1.33054 WP_003414131.1.33082 WP_003414131.1.33141 WP_003414131.1.33148 WP_003414131.1.33155 WP_003414131.1.33168 WP_003414131.1.3321 WP_003414131.1.33215 WP_003414131.1.3325 WP_003414131.1.3327 WP_003414131.1.33278 WP_003414131.1.33288 WP_003414131.1.33305 WP_003414131.1.3331 WP_003414131.1.33319 WP_003414131.1.3333 WP_003414131.1.33393 WP_003414131.1.33403 WP_003414131.1.33452 WP_003414131.1.33467 WP_003414131.1.33477 WP_003414131.1.3349 WP_003414131.1.33519 WP_003414131.1.33542 WP_003414131.1.33601 WP_003414131.1.33602 WP_003414131.1.33633 WP_003414131.1.33646 WP_003414131.1.33673 WP_003414131.1.3369 WP_003414131.1.33705 WP_003414131.1.33762 WP_003414131.1.33783 WP_003414131.1.33789 WP_003414131.1.3383 WP_003414131.1.33832 WP_003414131.1.33839 WP_003414131.1.33848 WP_003414131.1.3387 WP_003414131.1.33886 WP_003414131.1.33895 WP_003414131.1.33906 WP_003414131.1.33912 WP_003414131.1.33954 WP_003414131.1.3399 WP_003414131.1.34042 WP_003414131.1.3405 WP_003414131.1.34055 WP_003414131.1.34056 WP_003414131.1.34065 WP_003414131.1.3408 WP_003414131.1.34090 WP_003414131.1.34109 WP_003414131.1.34111 WP_003414131.1.34131 WP_003414131.1.34153 WP_003414131.1.34163 WP_003414131.1.34181 WP_003414131.1.34197 WP_003414131.1.34198 WP_003414131.1.34215 WP_003414131.1.34219 WP_003414131.1.34255 WP_003414131.1.34260 WP_003414131.1.34275 WP_003414131.1.343 WP_003414131.1.34347 WP_003414131.1.34358 WP_003414131.1.34392 WP_003414131.1.344 WP_003414131.1.34428 WP_003414131.1.3443 WP_003414131.1.34435 WP_003414131.1.34446 WP_003414131.1.34499 WP_003414131.1.34505 WP_003414131.1.34516 WP_003414131.1.34529 WP_003414131.1.34551 WP_003414131.1.34563 WP_003414131.1.34576 WP_003414131.1.34581 WP_003414131.1.34588 WP_003414131.1.34599 WP_003414131.1.34639 WP_003414131.1.34673 WP_003414131.1.34724 WP_003414131.1.34740 WP_003414131.1.34755 WP_003414131.1.34777 WP_003414131.1.34783 WP_003414131.1.34841 WP_003414131.1.34908 WP_003414131.1.34919 WP_003414131.1.3492 WP_003414131.1.34933 WP_003414131.1.34945 WP_003414131.1.34946 WP_003414131.1.34954 WP_003414131.1.34960 WP_003414131.1.34961 WP_003414131.1.34963 WP_003414131.1.34965 WP_003414131.1.35023 WP_003414131.1.35069 WP_003414131.1.35072 WP_003414131.1.35078 WP_003414131.1.35100 WP_003414131.1.35146 WP_003414131.1.35156 WP_003414131.1.35160 WP_003414131.1.35162 WP_003414131.1.35173 WP_003414131.1.35176 WP_003414131.1.3520 WP_003414131.1.35213 WP_003414131.1.35221 WP_003414131.1.35246 WP_003414131.1.35278 WP_003414131.1.35311 WP_003414131.1.35312 WP_003414131.1.35317 WP_003414131.1.35319 WP_003414131.1.35363 WP_003414131.1.35382 WP_003414131.1.35385 WP_003414131.1.35396 WP_003414131.1.35397 WP_003414131.1.35426 WP_003414131.1.35439 WP_003414131.1.35455 WP_003414131.1.3548 WP_003414131.1.35484 WP_003414131.1.35492 WP_003414131.1.3553 WP_003414131.1.35553 WP_003414131.1.35555 WP_003414131.1.35561 WP_003414131.1.35602 WP_003414131.1.35610 WP_003414131.1.35635 WP_003414131.1.35657 WP_003414131.1.35680 WP_003414131.1.35687 WP_003414131.1.35689 WP_003414131.1.35707 WP_003414131.1.35732 WP_003414131.1.35754 WP_003414131.1.35770 WP_003414131.1.35771 WP_003414131.1.35780 WP_003414131.1.35811 WP_003414131.1.35821 WP_003414131.1.3584 WP_003414131.1.35848 WP_003414131.1.35864 WP_003414131.1.35874 WP_003414131.1.35897 WP_003414131.1.35899 WP_003414131.1.35923 WP_003414131.1.3593 WP_003414131.1.35954 WP_003414131.1.36005 WP_003414131.1.36014 WP_003414131.1.36023 WP_003414131.1.36051 WP_003414131.1.36053 WP_003414131.1.36075 WP_003414131.1.36089 WP_003414131.1.36097 WP_003414131.1.36098 WP_003414131.1.36116 WP_003414131.1.36145 WP_003414131.1.36156 WP_003414131.1.36205 WP_003414131.1.36228 WP_003414131.1.36246 WP_003414131.1.36252 WP_003414131.1.36260 WP_003414131.1.36270 WP_003414131.1.36271 WP_003414131.1.36303 WP_003414131.1.36315 WP_003414131.1.36319 WP_003414131.1.36321 WP_003414131.1.36326 WP_003414131.1.3634 WP_003414131.1.36356 WP_003414131.1.36357 WP_003414131.1.3636 WP_003414131.1.36385 WP_003414131.1.36399 WP_003414131.1.36436 WP_003414131.1.36465 WP_003414131.1.36469 WP_003414131.1.36473 WP_003414131.1.36485 WP_003414131.1.36508 WP_003414131.1.36540 WP_003414131.1.36561 WP_003414131.1.36571 WP_003414131.1.36573 WP_003414131.1.36578 WP_003414131.1.36585 WP_003414131.1.36597 WP_003414131.1.36614 WP_003414131.1.36657 WP_003414131.1.36674 WP_003414131.1.36720 WP_003414131.1.36727 WP_003414131.1.36733 WP_003414131.1.36785 WP_003414131.1.36844 WP_003414131.1.36851 WP_003414131.1.36862 WP_003414131.1.36893 WP_003414131.1.36901 WP_003414131.1.36921 WP_003414131.1.36935 WP_003414131.1.36941 WP_003414131.1.3695 WP_003414131.1.36951 WP_003414131.1.36968 WP_003414131.1.3700 WP_003414131.1.37004 WP_003414131.1.37012 WP_003414131.1.37071 WP_003414131.1.37088 WP_003414131.1.37131 WP_003414131.1.37175 WP_003414131.1.37188 WP_003414131.1.37213 WP_003414131.1.37229 WP_003414131.1.3724 WP_003414131.1.37277 WP_003414131.1.37305 WP_003414131.1.37330 WP_003414131.1.37389 WP_003414131.1.37400 WP_003414131.1.37440 WP_003414131.1.37459 WP_003414131.1.37468 WP_003414131.1.37475 WP_003414131.1.37484 WP_003414131.1.37601 WP_003414131.1.37612 WP_003414131.1.37632 WP_003414131.1.37643 WP_003414131.1.37660 WP_003414131.1.37674 WP_003414131.1.37700 WP_003414131.1.37701 WP_003414131.1.37709 WP_003414131.1.37711 WP_003414131.1.37721 WP_003414131.1.37722 WP_003414131.1.37747 WP_003414131.1.37765 WP_003414131.1.37772 WP_003414131.1.37804 WP_003414131.1.37809 WP_003414131.1.37877 WP_003414131.1.37912 WP_003414131.1.37943 WP_003414131.1.37950 WP_003414131.1.37973 WP_003414131.1.37975 WP_003414131.1.37983 WP_003414131.1.38 WP_003414131.1.38002 WP_003414131.1.3802 WP_003414131.1.38039 WP_003414131.1.38040 WP_003414131.1.38067 WP_003414131.1.38068 WP_003414131.1.38135 WP_003414131.1.38138 WP_003414131.1.38144 WP_003414131.1.38158 WP_003414131.1.38159 WP_003414131.1.38210 WP_003414131.1.38233 WP_003414131.1.38240 WP_003414131.1.38299 WP_003414131.1.38332 WP_003414131.1.38347 WP_003414131.1.38354 WP_003414131.1.38380 WP_003414131.1.38384 WP_003414131.1.38389 WP_003414131.1.38398 WP_003414131.1.38402 WP_003414131.1.38418 WP_003414131.1.38421 WP_003414131.1.38466 WP_003414131.1.38477 WP_003414131.1.38483 WP_003414131.1.3849 WP_003414131.1.385 WP_003414131.1.38530 WP_003414131.1.38535 WP_003414131.1.38539 WP_003414131.1.38594 WP_003414131.1.38601 WP_003414131.1.38611 WP_003414131.1.38638 WP_003414131.1.38639 WP_003414131.1.38646 WP_003414131.1.38648 WP_003414131.1.38654 WP_003414131.1.38659 WP_003414131.1.38660 WP_003414131.1.38666 WP_003414131.1.38671 WP_003414131.1.38672 WP_003414131.1.38677 WP_003414131.1.38750 WP_003414131.1.38772 WP_003414131.1.38812 WP_003414131.1.38821 WP_003414131.1.38844 WP_003414131.1.38863 WP_003414131.1.38865 WP_003414131.1.3889 WP_003414131.1.38894 WP_003414131.1.38909 WP_003414131.1.38939 WP_003414131.1.38974 WP_003414131.1.38975 WP_003414131.1.38991 WP_003414131.1.39025 WP_003414131.1.39072 WP_003414131.1.39095 WP_003414131.1.39106 WP_003414131.1.39165 WP_003414131.1.39174 WP_003414131.1.39176 WP_003414131.1.39178 WP_003414131.1.39190 WP_003414131.1.39201 WP_003414131.1.39207 WP_003414131.1.39211 WP_003414131.1.39236 WP_003414131.1.39239 WP_003414131.1.39252 WP_003414131.1.39288 WP_003414131.1.39295 WP_003414131.1.39306 WP_003414131.1.39359 WP_003414131.1.39364 WP_003414131.1.39400 WP_003414131.1.39447 WP_003414131.1.3945 WP_003414131.1.39450 WP_003414131.1.39455 WP_003414131.1.3949 WP_003414131.1.39521 WP_003414131.1.39560 WP_003414131.1.39592 WP_003414131.1.39593 WP_003414131.1.396 WP_003414131.1.39616 WP_003414131.1.39654 WP_003414131.1.39657 WP_003414131.1.39661 WP_003414131.1.39674 WP_003414131.1.39678 WP_003414131.1.3968 WP_003414131.1.39694 WP_003414131.1.3971 WP_003414131.1.39718 WP_003414131.1.39728 WP_003414131.1.39739 WP_003414131.1.39748 WP_003414131.1.39751 WP_003414131.1.39759 WP_003414131.1.39801 WP_003414131.1.39804 WP_003414131.1.39848 WP_003414131.1.39877 WP_003414131.1.39925 WP_003414131.1.3994 WP_003414131.1.39959 WP_003414131.1.3996 WP_003414131.1.39960 WP_003414131.1.3997 WP_003414131.1.39980 WP_003414131.1.40000 WP_003414131.1.40028 WP_003414131.1.40029 WP_003414131.1.4003 WP_003414131.1.40094 WP_003414131.1.40096 WP_003414131.1.40150 WP_003414131.1.40156 WP_003414131.1.40186 WP_003414131.1.40276 WP_003414131.1.40277 WP_003414131.1.40323 WP_003414131.1.40336 WP_003414131.1.40353 WP_003414131.1.4036 WP_003414131.1.40372 WP_003414131.1.40402 WP_003414131.1.40413 WP_003414131.1.40440 WP_003414131.1.40446 WP_003414131.1.40451 WP_003414131.1.40455 WP_003414131.1.40523 WP_003414131.1.40543 WP_003414131.1.40641 WP_003414131.1.40646 WP_003414131.1.40651 WP_003414131.1.40653 WP_003414131.1.4067 WP_003414131.1.40705 WP_003414131.1.40723 WP_003414131.1.40731 WP_003414131.1.40735 WP_003414131.1.40795 WP_003414131.1.40799 WP_003414131.1.40852 WP_003414131.1.40876 WP_003414131.1.40881 WP_003414131.1.40922 WP_003414131.1.40948 WP_003414131.1.4095 WP_003414131.1.40956 WP_003414131.1.40957 WP_003414131.1.40964 WP_003414131.1.4097 WP_003414131.1.410 WP_003414131.1.41000 WP_003414131.1.41055 WP_003414131.1.41108 WP_003414131.1.41123 WP_003414131.1.41202 WP_003414131.1.41219 WP_003414131.1.41231 WP_003414131.1.41249 WP_003414131.1.4127 WP_003414131.1.41296 WP_003414131.1.41355 WP_003414131.1.41376 WP_003414131.1.41430 WP_003414131.1.41447 WP_003414131.1.41469 WP_003414131.1.41504 WP_003414131.1.41553 WP_003414131.1.41564 WP_003414131.1.41583 WP_003414131.1.41616 WP_003414131.1.41632 WP_003414131.1.41635 WP_003414131.1.41636 WP_003414131.1.41648 WP_003414131.1.41660 WP_003414131.1.41685 WP_003414131.1.41704 WP_003414131.1.4171 WP_003414131.1.41719 WP_003414131.1.41733 WP_003414131.1.41744 WP_003414131.1.41774 WP_003414131.1.41791 WP_003414131.1.41803 WP_003414131.1.41820 WP_003414131.1.41828 WP_003414131.1.41829 WP_003414131.1.41860 WP_003414131.1.41912 WP_003414131.1.41921 WP_003414131.1.41933 WP_003414131.1.41944 WP_003414131.1.42043 WP_003414131.1.42075 WP_003414131.1.42078 WP_003414131.1.42094 WP_003414131.1.42112 WP_003414131.1.4212 WP_003414131.1.42122 WP_003414131.1.42134 WP_003414131.1.42183 WP_003414131.1.42188 WP_003414131.1.42201 WP_003414131.1.42202 WP_003414131.1.42208 WP_003414131.1.42247 WP_003414131.1.42255 WP_003414131.1.42273 WP_003414131.1.42304 WP_003414131.1.42309 WP_003414131.1.42370 WP_003414131.1.42385 WP_003414131.1.42400 WP_003414131.1.42409 WP_003414131.1.42414 WP_003414131.1.42417 WP_003414131.1.42430 WP_003414131.1.42461 WP_003414131.1.42465 WP_003414131.1.42467 WP_003414131.1.42474 WP_003414131.1.4248 WP_003414131.1.42494 WP_003414131.1.42519 WP_003414131.1.42524 WP_003414131.1.42534 WP_003414131.1.4255 WP_003414131.1.42562 WP_003414131.1.42568 WP_003414131.1.42570 WP_003414131.1.42618 WP_003414131.1.42660 WP_003414131.1.42704 WP_003414131.1.42705 WP_003414131.1.42722 WP_003414131.1.42777 WP_003414131.1.42782 WP_003414131.1.42835 WP_003414131.1.42839 WP_003414131.1.42842 WP_003414131.1.42905 WP_003414131.1.42916 WP_003414131.1.42930 WP_003414131.1.42971 WP_003414131.1.43005 WP_003414131.1.43009 WP_003414131.1.43053 WP_003414131.1.43082 WP_003414131.1.43087 WP_003414131.1.43098 WP_003414131.1.43208 WP_003414131.1.43236 WP_003414131.1.43246 WP_003414131.1.43255 WP_003414131.1.43266 WP_003414131.1.43269 WP_003414131.1.43273 WP_003414131.1.43296 WP_003414131.1.43306 WP_003414131.1.4335 WP_003414131.1.43368 WP_003414131.1.43395 WP_003414131.1.43457 WP_003414131.1.43462 WP_003414131.1.43475 WP_003414131.1.43478 WP_003414131.1.43484 WP_003414131.1.43557 WP_003414131.1.43578 WP_003414131.1.43588 WP_003414131.1.43643 WP_003414131.1.43664 WP_003414131.1.43684 WP_003414131.1.43686 WP_003414131.1.43706 WP_003414131.1.43716 WP_003414131.1.4377 WP_003414131.1.43781 WP_003414131.1.43794 WP_003414131.1.43815 WP_003414131.1.43846 WP_003414131.1.43861 WP_003414131.1.43863 WP_003414131.1.43866 WP_003414131.1.43872 WP_003414131.1.43885 WP_003414131.1.43897 WP_003414131.1.4390 WP_003414131.1.43921 WP_003414131.1.43936 WP_003414131.1.43937 WP_003414131.1.43960 WP_003414131.1.43965 WP_003414131.1.4399 WP_003414131.1.43993 WP_003414131.1.43996 WP_003414131.1.44 WP_003414131.1.44001 WP_003414131.1.44008 WP_003414131.1.44016 WP_003414131.1.44033 WP_003414131.1.44037 WP_003414131.1.44041 WP_003414131.1.44070 WP_003414131.1.44071 WP_003414131.1.44076 WP_003414131.1.44104 WP_003414131.1.44124 WP_003414131.1.44169 WP_003414131.1.44219 WP_003414131.1.44237 WP_003414131.1.44277 WP_003414131.1.44279 WP_003414131.1.44336 WP_003414131.1.44355 WP_003414131.1.44358 WP_003414131.1.4438 WP_003414131.1.44390 WP_003414131.1.44392 WP_003414131.1.44415 WP_003414131.1.44464 WP_003414131.1.44466 WP_003414131.1.44489 WP_003414131.1.44492 WP_003414131.1.44500 WP_003414131.1.44519 WP_003414131.1.44526 WP_003414131.1.44532 WP_003414131.1.44534 WP_003414131.1.44562 WP_003414131.1.44589 WP_003414131.1.44597 WP_003414131.1.44600 WP_003414131.1.44602 WP_003414131.1.44615 WP_003414131.1.4464 WP_003414131.1.44651 WP_003414131.1.44659 WP_003414131.1.44665 WP_003414131.1.44694 WP_003414131.1.44700 WP_003414131.1.44713 WP_003414131.1.44735 WP_003414131.1.44740 WP_003414131.1.44757 WP_003414131.1.4476 WP_003414131.1.44761 WP_003414131.1.44767 WP_003414131.1.44776 WP_003414131.1.44779 WP_003414131.1.44786 WP_003414131.1.44808 WP_003414131.1.44864 WP_003414131.1.44901 WP_003414131.1.44908 WP_003414131.1.44913 WP_003414131.1.4492 WP_003414131.1.44979 WP_003414131.1.44981 WP_003414131.1.45002 WP_003414131.1.45011 WP_003414131.1.4504 WP_003414131.1.45066 WP_003414131.1.45081 WP_003414131.1.45113 WP_003414131.1.45129 WP_003414131.1.45135 WP_003414131.1.45147 WP_003414131.1.45168 WP_003414131.1.4517 WP_003414131.1.45181 WP_003414131.1.45185 WP_003414131.1.45192 WP_003414131.1.45200 WP_003414131.1.45205 WP_003414131.1.45211 WP_003414131.1.45249 WP_003414131.1.4526 WP_003414131.1.45286 WP_003414131.1.45326 WP_003414131.1.45347 WP_003414131.1.45374 WP_003414131.1.454 WP_003414131.1.45407 WP_003414131.1.45451 WP_003414131.1.45453 WP_003414131.1.45460 WP_003414131.1.45463 WP_003414131.1.45470 WP_003414131.1.45474 WP_003414131.1.45491 WP_003414131.1.45510 WP_003414131.1.45584 WP_003414131.1.45590 WP_003414131.1.45619 WP_003414131.1.45626 WP_003414131.1.45631 WP_003414131.1.45666 WP_003414131.1.45697 WP_003414131.1.4571 WP_003414131.1.45731 WP_003414131.1.45743 WP_003414131.1.45765 WP_003414131.1.45776 WP_003414131.1.45783 WP_003414131.1.45805 WP_003414131.1.45867 WP_003414131.1.45884 WP_003414131.1.4590 WP_003414131.1.45923 WP_003414131.1.45926 WP_003414131.1.45963 WP_003414131.1.45989 WP_003414131.1.46025 WP_003414131.1.46083 WP_003414131.1.46090 WP_003414131.1.46092 WP_003414131.1.46100 WP_003414131.1.46101 WP_003414131.1.46103 WP_003414131.1.46107 WP_003414131.1.46127 WP_003414131.1.46128 WP_003414131.1.46129 WP_003414131.1.46141 WP_003414131.1.46150 WP_003414131.1.46201 WP_003414131.1.46226 WP_003414131.1.4624 WP_003414131.1.46253 WP_003414131.1.46268 WP_003414131.1.46285 WP_003414131.1.46300 WP_003414131.1.46313 WP_003414131.1.46336 WP_003414131.1.46365 WP_003414131.1.46370 WP_003414131.1.46381 WP_003414131.1.46402 WP_003414131.1.46411 WP_003414131.1.4644 WP_003414131.1.46442 WP_003414131.1.46453 WP_003414131.1.46463 WP_003414131.1.46478 WP_003414131.1.46492 WP_003414131.1.46521 WP_003414131.1.4653 WP_003414131.1.46532 WP_003414131.1.46539 WP_003414131.1.46568 WP_003414131.1.46585 WP_003414131.1.46609 WP_003414131.1.46613 WP_003414131.1.46625 WP_003414131.1.46642 WP_003414131.1.46647 WP_003414131.1.46674 WP_003414131.1.46724 WP_003414131.1.46758 WP_003414131.1.46773 WP_003414131.1.46777 WP_003414131.1.46786 WP_003414131.1.46792 WP_003414131.1.46847 WP_003414131.1.46851 WP_003414131.1.4687 WP_003414131.1.46897 WP_003414131.1.46936 WP_003414131.1.46980 WP_003414131.1.47012 WP_003414131.1.47066 WP_003414131.1.47077 WP_003414131.1.47083 WP_003414131.1.47106 WP_003414131.1.47142 WP_003414131.1.47147 WP_003414131.1.47166 WP_003414131.1.47178 WP_003414131.1.47179 WP_003414131.1.47194 WP_003414131.1.47207 WP_003414131.1.47210 WP_003414131.1.47261 WP_003414131.1.47262 WP_003414131.1.47402 WP_003414131.1.47423 WP_003414131.1.47467 WP_003414131.1.47502 WP_003414131.1.4751 WP_003414131.1.47511 WP_003414131.1.47537 WP_003414131.1.47540 WP_003414131.1.47568 WP_003414131.1.47572 WP_003414131.1.47588 WP_003414131.1.47636 WP_003414131.1.4764 WP_003414131.1.47653 WP_003414131.1.47679 WP_003414131.1.47681 WP_003414131.1.4771 WP_003414131.1.47717 WP_003414131.1.47743 WP_003414131.1.47754 WP_003414131.1.47773 WP_003414131.1.47776 WP_003414131.1.47780 WP_003414131.1.47805 WP_003414131.1.47832 WP_003414131.1.47847 WP_003414131.1.47858 WP_003414131.1.47861 WP_003414131.1.47868 WP_003414131.1.47893 WP_003414131.1.47899 WP_003414131.1.479 WP_003414131.1.47912 WP_003414131.1.47913 WP_003414131.1.47926 WP_003414131.1.4794 WP_003414131.1.47943 WP_003414131.1.47944 WP_003414131.1.47959 WP_003414131.1.47974 WP_003414131.1.47993 WP_003414131.1.48004 WP_003414131.1.48039 WP_003414131.1.48050 WP_003414131.1.48084 WP_003414131.1.48101 WP_003414131.1.48109 WP_003414131.1.4813 WP_003414131.1.48130 WP_003414131.1.48135 WP_003414131.1.48143 WP_003414131.1.48152 WP_003414131.1.48155 WP_003414131.1.48170 WP_003414131.1.48173 WP_003414131.1.48177 WP_003414131.1.48185 WP_003414131.1.48204 WP_003414131.1.48219 WP_003414131.1.4823 WP_003414131.1.48256 WP_003414131.1.48264 WP_003414131.1.48287 WP_003414131.1.48330 WP_003414131.1.48333 WP_003414131.1.48348 WP_003414131.1.48354 WP_003414131.1.48372 WP_003414131.1.48383 WP_003414131.1.48388 WP_003414131.1.48419 WP_003414131.1.48423 WP_003414131.1.48443 WP_003414131.1.48450 WP_003414131.1.48462 WP_003414131.1.48543 WP_003414131.1.48550 WP_003414131.1.48605 WP_003414131.1.48618 WP_003414131.1.4863 WP_003414131.1.48648 WP_003414131.1.48658 WP_003414131.1.48666 WP_003414131.1.48687 WP_003414131.1.48779 WP_003414131.1.4878 WP_003414131.1.48798 WP_003414131.1.48802 WP_003414131.1.48826 WP_003414131.1.48831 WP_003414131.1.48843 WP_003414131.1.48857 WP_003414131.1.4890 WP_003414131.1.48946 WP_003414131.1.48979 WP_003414131.1.49017 WP_003414131.1.49048 WP_003414131.1.49059 WP_003414131.1.4906 WP_003414131.1.4907 WP_003414131.1.49103 WP_003414131.1.49110 WP_003414131.1.49111 WP_003414131.1.49112 WP_003414131.1.4919 WP_003414131.1.49251 WP_003414131.1.49254 WP_003414131.1.49263 WP_003414131.1.49291 WP_003414131.1.49296 WP_003414131.1.49335 WP_003414131.1.49337 WP_003414131.1.49419 WP_003414131.1.49426 WP_003414131.1.49437 WP_003414131.1.49439 WP_003414131.1.49474 WP_003414131.1.49506 WP_003414131.1.49516 WP_003414131.1.49523 WP_003414131.1.49526 WP_003414131.1.49532 WP_003414131.1.49588 WP_003414131.1.4959 WP_003414131.1.49678 WP_003414131.1.49687 WP_003414131.1.49699 WP_003414131.1.49709 WP_003414131.1.4971 WP_003414131.1.4972 WP_003414131.1.49736 WP_003414131.1.49746 WP_003414131.1.49764 WP_003414131.1.49773 WP_003414131.1.49796 WP_003414131.1.49814 WP_003414131.1.49815 WP_003414131.1.49816 WP_003414131.1.49839 WP_003414131.1.49857 WP_003414131.1.49878 WP_003414131.1.49880 WP_003414131.1.49944 WP_003414131.1.4999 WP_003414131.1.49990 WP_003414131.1.50068 WP_003414131.1.50077 WP_003414131.1.5008 WP_003414131.1.50081 WP_003414131.1.50122 WP_003414131.1.50126 WP_003414131.1.50149 WP_003414131.1.50162 WP_003414131.1.5018 WP_003414131.1.50194 WP_003414131.1.50235 WP_003414131.1.50249 WP_003414131.1.50265 WP_003414131.1.50271 WP_003414131.1.50324 WP_003414131.1.50347 WP_003414131.1.50372 WP_003414131.1.50398 WP_003414131.1.50407 WP_003414131.1.50444 WP_003414131.1.50466 WP_003414131.1.50472 WP_003414131.1.5048 WP_003414131.1.50498 WP_003414131.1.5050 WP_003414131.1.50554 WP_003414131.1.50557 WP_003414131.1.50601 WP_003414131.1.50610 WP_003414131.1.50632 WP_003414131.1.50633 WP_003414131.1.50642 WP_003414131.1.50655 WP_003414131.1.50659 WP_003414131.1.50689 WP_003414131.1.50692 WP_003414131.1.50714 WP_003414131.1.50729 WP_003414131.1.50756 WP_003414131.1.50784 WP_003414131.1.50794 WP_003414131.1.50841 WP_003414131.1.50860 WP_003414131.1.50868 WP_003414131.1.50877 WP_003414131.1.5096 WP_003414131.1.50981 WP_003414131.1.50987 WP_003414131.1.51003 WP_003414131.1.51009 WP_003414131.1.51037 WP_003414131.1.51074 WP_003414131.1.51082 WP_003414131.1.51101 WP_003414131.1.51116 WP_003414131.1.51149 WP_003414131.1.51157 WP_003414131.1.51213 WP_003414131.1.51232 WP_003414131.1.51239 WP_003414131.1.51247 WP_003414131.1.51266 WP_003414131.1.51279 WP_003414131.1.51291 WP_003414131.1.51294 WP_003414131.1.51301 WP_003414131.1.51329 WP_003414131.1.51391 WP_003414131.1.51422 WP_003414131.1.51445 WP_003414131.1.51455 WP_003414131.1.51466 WP_003414131.1.51468 WP_003414131.1.51478 WP_003414131.1.51497 WP_003414131.1.51520 WP_003414131.1.51593 WP_003414131.1.51628 WP_003414131.1.51647 WP_003414131.1.51696 WP_003414131.1.51721 WP_003414131.1.51788 WP_003414131.1.51795 WP_003414131.1.51801 WP_003414131.1.51817 WP_003414131.1.51819 WP_003414131.1.51854 WP_003414131.1.51923 WP_003414131.1.51942 WP_003414131.1.51948 WP_003414131.1.51963 WP_003414131.1.52000 WP_003414131.1.52001 WP_003414131.1.52003 WP_003414131.1.52006 WP_003414131.1.52036 WP_003414131.1.52038 WP_003414131.1.52046 WP_003414131.1.52059 WP_003414131.1.52069 WP_003414131.1.52082 WP_003414131.1.52102 WP_003414131.1.52106 WP_003414131.1.52166 WP_003414131.1.52168 WP_003414131.1.52173 WP_003414131.1.52178 WP_003414131.1.52206 WP_003414131.1.52216 WP_003414131.1.52238 WP_003414131.1.52241 WP_003414131.1.52280 WP_003414131.1.52314 WP_003414131.1.52385 WP_003414131.1.52390 WP_003414131.1.524 WP_003414131.1.52460 WP_003414131.1.52485 WP_003414131.1.52486 WP_003414131.1.52495 WP_003414131.1.52531 WP_003414131.1.52533 WP_003414131.1.52545 WP_003414131.1.52553 WP_003414131.1.52563 WP_003414131.1.52564 WP_003414131.1.52574 WP_003414131.1.52641 WP_003414131.1.52673 WP_003414131.1.52674 WP_003414131.1.52708 WP_003414131.1.52713 WP_003414131.1.52761 WP_003414131.1.52778 WP_003414131.1.52791 WP_003414131.1.52797 WP_003414131.1.52818 WP_003414131.1.52872 WP_003414131.1.52873 WP_003414131.1.52891 WP_003414131.1.52892 WP_003414131.1.52909 WP_003414131.1.52970 WP_003414131.1.52998 WP_003414131.1.53053 WP_003414131.1.5306 WP_003414131.1.53088 WP_003414131.1.5309 WP_003414131.1.531 WP_003414131.1.53117 WP_003414131.1.53118 WP_003414131.1.53142 WP_003414131.1.53143 WP_003414131.1.53157 WP_003414131.1.53167 WP_003414131.1.53200 WP_003414131.1.53204 WP_003414131.1.53213 WP_003414131.1.53217 WP_003414131.1.53226 WP_003414131.1.53229 WP_003414131.1.53230 WP_003414131.1.53237 WP_003414131.1.53254 WP_003414131.1.53257 WP_003414131.1.5327 WP_003414131.1.53276 WP_003414131.1.53278 WP_003414131.1.533 WP_003414131.1.53302 WP_003414131.1.53306 WP_003414131.1.5335 WP_003414131.1.53353 WP_003414131.1.53381 WP_003414131.1.53413 WP_003414131.1.53458 WP_003414131.1.53460 WP_003414131.1.53480 WP_003414131.1.53517 WP_003414131.1.53522 WP_003414131.1.53525 WP_003414131.1.53526 WP_003414131.1.53553 WP_003414131.1.53606 WP_003414131.1.53609 WP_003414131.1.53628 WP_003414131.1.53643 WP_003414131.1.53667 WP_003414131.1.53679 WP_003414131.1.53715 WP_003414131.1.53730 WP_003414131.1.53742 WP_003414131.1.53743 WP_003414131.1.53754 WP_003414131.1.53775 WP_003414131.1.53787 WP_003414131.1.53803 WP_003414131.1.53818 WP_003414131.1.53822 WP_003414131.1.53853 WP_003414131.1.53865 WP_003414131.1.53888 WP_003414131.1.53900 WP_003414131.1.53912 WP_003414131.1.53914 WP_003414131.1.53952 WP_003414131.1.53973 WP_003414131.1.5398 WP_003414131.1.5408 WP_003414131.1.54089 WP_003414131.1.54093 WP_003414131.1.54099 WP_003414131.1.54112 WP_003414131.1.54125 WP_003414131.1.54141 WP_003414131.1.54162 WP_003414131.1.54179 WP_003414131.1.54206 WP_003414131.1.54218 WP_003414131.1.54225 WP_003414131.1.54241 WP_003414131.1.54245 WP_003414131.1.54247 WP_003414131.1.54260 WP_003414131.1.54275 WP_003414131.1.54280 WP_003414131.1.5429 WP_003414131.1.54294 WP_003414131.1.54314 WP_003414131.1.54351 WP_003414131.1.54370 WP_003414131.1.54449 WP_003414131.1.54494 WP_003414131.1.54502 WP_003414131.1.54514 WP_003414131.1.54519 WP_003414131.1.5452 WP_003414131.1.54531 WP_003414131.1.54537 WP_003414131.1.54553 WP_003414131.1.54555 WP_003414131.1.54575 WP_003414131.1.54633 WP_003414131.1.54686 WP_003414131.1.54687 WP_003414131.1.54705 WP_003414131.1.54730 WP_003414131.1.54732 WP_003414131.1.54797 WP_003414131.1.54807 WP_003414131.1.54836 WP_003414131.1.54838 WP_003414131.1.54860 WP_003414131.1.54888 WP_003414131.1.54897 WP_003414131.1.54905 WP_003414131.1.54909 WP_003414131.1.54937 WP_003414131.1.54939 WP_003414131.1.54944 WP_003414131.1.54945 WP_003414131.1.54953 WP_003414131.1.54964 WP_003414131.1.55015 WP_003414131.1.55022 WP_003414131.1.55023 WP_003414131.1.55051 WP_003414131.1.55072 WP_003414131.1.55088 WP_003414131.1.55106 WP_003414131.1.55126 WP_003414131.1.55128 WP_003414131.1.55140 WP_003414131.1.55150 WP_003414131.1.55210 WP_003414131.1.55227 WP_003414131.1.55248 WP_003414131.1.55257 WP_003414131.1.55258 WP_003414131.1.55279 WP_003414131.1.55307 WP_003414131.1.55326 WP_003414131.1.55328 WP_003414131.1.5533 WP_003414131.1.55345 WP_003414131.1.55396 WP_003414131.1.55398 WP_003414131.1.55441 WP_003414131.1.55459 WP_003414131.1.55501 WP_003414131.1.55504 WP_003414131.1.55578 WP_003414131.1.55626 WP_003414131.1.55641 WP_003414131.1.5569 WP_003414131.1.55723 WP_003414131.1.5574 WP_003414131.1.55772 WP_003414131.1.55802 WP_003414131.1.55807 WP_003414131.1.55819 WP_003414131.1.55821 WP_003414131.1.5583 WP_003414131.1.55849 WP_003414131.1.55860 WP_003414131.1.55882 WP_003414131.1.55883 WP_003414131.1.55894 WP_003414131.1.55902 WP_003414131.1.55908 WP_003414131.1.55909 WP_003414131.1.5591 WP_003414131.1.55977 WP_003414131.1.55983 WP_003414131.1.56028 WP_003414131.1.56057 WP_003414131.1.56060 WP_003414131.1.56107 WP_003414131.1.56132 WP_003414131.1.56163 WP_003414131.1.56167 WP_003414131.1.56178 WP_003414131.1.56287 WP_003414131.1.56292 WP_003414131.1.56327 WP_003414131.1.56341 WP_003414131.1.56359 WP_003414131.1.56365 WP_003414131.1.56394 WP_003414131.1.56443 WP_003414131.1.56473 WP_003414131.1.56478 WP_003414131.1.56500 WP_003414131.1.56517 WP_003414131.1.56534 WP_003414131.1.5656 WP_003414131.1.56577 WP_003414131.1.56593 WP_003414131.1.56637 WP_003414131.1.56670 WP_003414131.1.56697 WP_003414131.1.567 WP_003414131.1.56701 WP_003414131.1.56709 WP_003414131.1.56729 WP_003414131.1.56743 WP_003414131.1.56755 WP_003414131.1.56764 WP_003414131.1.56769 WP_003414131.1.56770 WP_003414131.1.56795 WP_003414131.1.5681 WP_003414131.1.56827 WP_003414131.1.56839 WP_003414131.1.56863 WP_003414131.1.56868 WP_003414131.1.56869 WP_003414131.1.56915 WP_003414131.1.56926 WP_003414131.1.56961 WP_003414131.1.56971 WP_003414131.1.57023 WP_003414131.1.57035 WP_003414131.1.57077 WP_003414131.1.57094 WP_003414131.1.57134 WP_003414131.1.57151 WP_003414131.1.57169 WP_003414131.1.57212 WP_003414131.1.57230 WP_003414131.1.5724 WP_003414131.1.5725 WP_003414131.1.5727 WP_003414131.1.573 WP_003414131.1.57314 WP_003414131.1.57326 WP_003414131.1.57328 WP_003414131.1.57331 WP_003414131.1.57340 WP_003414131.1.57351 WP_003414131.1.57352 WP_003414131.1.57380 WP_003414131.1.57430 WP_003414131.1.5744 WP_003414131.1.57440 WP_003414131.1.5745 WP_003414131.1.57461 WP_003414131.1.57469 WP_003414131.1.57489 WP_003414131.1.575 WP_003414131.1.57509 WP_003414131.1.57519 WP_003414131.1.57525 WP_003414131.1.57551 WP_003414131.1.5758 WP_003414131.1.57596 WP_003414131.1.57604 WP_003414131.1.57616 WP_003414131.1.57617 WP_003414131.1.57619 WP_003414131.1.57627 WP_003414131.1.57642 WP_003414131.1.57658 WP_003414131.1.57667 WP_003414131.1.57675 WP_003414131.1.57689 WP_003414131.1.57708 WP_003414131.1.57794 WP_003414131.1.57821 WP_003414131.1.57825 WP_003414131.1.57843 WP_003414131.1.57906 WP_003414131.1.57924 WP_003414131.1.57926 WP_003414131.1.57930 WP_003414131.1.57957 WP_003414131.1.57960 WP_003414131.1.57964 WP_003414131.1.57991 WP_003414131.1.58000 WP_003414131.1.58086 WP_003414131.1.58101 WP_003414131.1.58103 WP_003414131.1.58108 WP_003414131.1.5811 WP_003414131.1.58121 WP_003414131.1.58145 WP_003414131.1.58164 WP_003414131.1.58174 WP_003414131.1.582 WP_003414131.1.58202 WP_003414131.1.58209 WP_003414131.1.58215 WP_003414131.1.5824 WP_003414131.1.58250 WP_003414131.1.58259 WP_003414131.1.58283 WP_003414131.1.58288 WP_003414131.1.5830 WP_003414131.1.58303 WP_003414131.1.58311 WP_003414131.1.58330 WP_003414131.1.58359 WP_003414131.1.58386 WP_003414131.1.58393 WP_003414131.1.58431 WP_003414131.1.5844 WP_003414131.1.58457 WP_003414131.1.58488 WP_003414131.1.58534 WP_003414131.1.58559 WP_003414131.1.58567 WP_003414131.1.58573 WP_003414131.1.58612 WP_003414131.1.58619 WP_003414131.1.58630 WP_003414131.1.5865 WP_003414131.1.58671 WP_003414131.1.58702 WP_003414131.1.58743 WP_003414131.1.58754 WP_003414131.1.5879 WP_003414131.1.58824 WP_003414131.1.58848 WP_003414131.1.58857 WP_003414131.1.58891 WP_003414131.1.58892 WP_003414131.1.58904 WP_003414131.1.58921 WP_003414131.1.58930 WP_003414131.1.58939 WP_003414131.1.58941 WP_003414131.1.58953 WP_003414131.1.58961 WP_003414131.1.5898 WP_003414131.1.59025 WP_003414131.1.59029 WP_003414131.1.59037 WP_003414131.1.59044 WP_003414131.1.59085 WP_003414131.1.59088 WP_003414131.1.59112 WP_003414131.1.59130 WP_003414131.1.5914 WP_003414131.1.59147 WP_003414131.1.59166 WP_003414131.1.59205 WP_003414131.1.59209 WP_003414131.1.59237 WP_003414131.1.59240 WP_003414131.1.59253 WP_003414131.1.59254 WP_003414131.1.59262 WP_003414131.1.59270 WP_003414131.1.5928 WP_003414131.1.59304 WP_003414131.1.59305 WP_003414131.1.59309 WP_003414131.1.59316 WP_003414131.1.59326 WP_003414131.1.59328 WP_003414131.1.59333 WP_003414131.1.59338 WP_003414131.1.59388 WP_003414131.1.59428 WP_003414131.1.59487 WP_003414131.1.59537 WP_003414131.1.59561 WP_003414131.1.59677 WP_003414131.1.59722 WP_003414131.1.59727 WP_003414131.1.59732 WP_003414131.1.59738 WP_003414131.1.59750 WP_003414131.1.59757 WP_003414131.1.59761 WP_003414131.1.59808 WP_003414131.1.59850 WP_003414131.1.59856 WP_003414131.1.59860 WP_003414131.1.5987 WP_003414131.1.59878 WP_003414131.1.59888 WP_003414131.1.59952 WP_003414131.1.5996 WP_003414131.1.59961 WP_003414131.1.59974 WP_003414131.1.6000 WP_003414131.1.60007 WP_003414131.1.60016 WP_003414131.1.6003 WP_003414131.1.60047 WP_003414131.1.6007 WP_003414131.1.60121 WP_003414131.1.60125 WP_003414131.1.60135 WP_003414131.1.60139 WP_003414131.1.60152 WP_003414131.1.60171 WP_003414131.1.60197 WP_003414131.1.6020 WP_003414131.1.60205 WP_003414131.1.60207 WP_003414131.1.60215 WP_003414131.1.60217 WP_003414131.1.60267 WP_003414131.1.60288 WP_003414131.1.60291 WP_003414131.1.60301 WP_003414131.1.60305 WP_003414131.1.60312 WP_003414131.1.60367 WP_003414131.1.60376 WP_003414131.1.60413 WP_003414131.1.60421 WP_003414131.1.60451 WP_003414131.1.60460 WP_003414131.1.60479 WP_003414131.1.60487 WP_003414131.1.60573 WP_003414131.1.60583 WP_003414131.1.60632 WP_003414131.1.60657 WP_003414131.1.60687 WP_003414131.1.60689 WP_003414131.1.60727 WP_003414131.1.60738 WP_003414131.1.60763 WP_003414131.1.6077 WP_003414131.1.60791 WP_003414131.1.60834 WP_003414131.1.60870 WP_003414131.1.60878 WP_003414131.1.60879 WP_003414131.1.60913 WP_003414131.1.60978 WP_003414131.1.61000 WP_003414131.1.61001 WP_003414131.1.61012 WP_003414131.1.61014 WP_003414131.1.61015 WP_003414131.1.61037 WP_003414131.1.61100 WP_003414131.1.61101 WP_003414131.1.61138 WP_003414131.1.61142 WP_003414131.1.61198 WP_003414131.1.612 WP_003414131.1.61234 WP_003414131.1.61256 WP_003414131.1.61281 WP_003414131.1.61314 WP_003414131.1.61321 WP_003414131.1.61326 WP_003414131.1.61328 WP_003414131.1.61368 WP_003414131.1.61391 WP_003414131.1.61406 WP_003414131.1.61409 WP_003414131.1.61420 WP_003414131.1.61422 WP_003414131.1.61425 WP_003414131.1.61428 WP_003414131.1.61469 WP_003414131.1.61494 WP_003414131.1.61522 WP_003414131.1.61552 WP_003414131.1.61557 WP_003414131.1.61567 WP_003414131.1.61571 WP_003414131.1.61573 WP_003414131.1.61584 WP_003414131.1.61586 WP_003414131.1.6159 WP_003414131.1.61592 WP_003414131.1.6160 WP_003414131.1.61614 WP_003414131.1.6163 WP_003414131.1.61655 WP_003414131.1.61665 WP_003414131.1.61669 WP_003414131.1.61692 WP_003414131.1.61719 WP_003414131.1.61728 WP_003414131.1.61750 WP_003414131.1.61754 WP_003414131.1.61755 WP_003414131.1.61757 WP_003414131.1.61778 WP_003414131.1.6179 WP_003414131.1.61793 WP_003414131.1.61816 WP_003414131.1.61842 WP_003414131.1.61850 WP_003414131.1.61862 WP_003414131.1.61865 WP_003414131.1.61868 WP_003414131.1.61911 WP_003414131.1.61925 WP_003414131.1.61941 WP_003414131.1.61953 WP_003414131.1.61979 WP_003414131.1.61986 WP_003414131.1.61987 WP_003414131.1.61998 WP_003414131.1.62021 WP_003414131.1.62087 WP_003414131.1.62089 WP_003414131.1.62101 WP_003414131.1.62104 WP_003414131.1.6211 WP_003414131.1.62132 WP_003414131.1.62162 WP_003414131.1.62225 WP_003414131.1.62230 WP_003414131.1.62238 WP_003414131.1.62249 WP_003414131.1.62270 WP_003414131.1.62281 WP_003414131.1.62307 WP_003414131.1.6231 WP_003414131.1.62359 WP_003414131.1.62360 WP_003414131.1.62371 WP_003414131.1.62379 WP_003414131.1.62395 WP_003414131.1.62408 WP_003414131.1.62449 WP_003414131.1.62468 WP_003414131.1.6248 WP_003414131.1.62508 WP_003414131.1.62565 WP_003414131.1.62594 WP_003414131.1.62606 WP_003414131.1.62616 WP_003414131.1.62666 WP_003414131.1.62687 WP_003414131.1.62715 WP_003414131.1.62730 WP_003414131.1.62738 WP_003414131.1.62761 WP_003414131.1.62766 WP_003414131.1.62786 WP_003414131.1.62813 WP_003414131.1.62839 WP_003414131.1.62841 WP_003414131.1.62909 WP_003414131.1.62936 WP_003414131.1.6295 WP_003414131.1.62962 WP_003414131.1.63007 WP_003414131.1.63019 WP_003414131.1.63032 WP_003414131.1.63037 WP_003414131.1.63064 WP_003414131.1.63066 WP_003414131.1.63072 WP_003414131.1.6308 WP_003414131.1.63081 WP_003414131.1.63096 WP_003414131.1.63106 WP_003414131.1.6314 WP_003414131.1.63144 WP_003414131.1.63154 WP_003414131.1.63160 WP_003414131.1.63161 WP_003414131.1.63166 WP_003414131.1.63175 WP_003414131.1.63194 WP_003414131.1.6322 WP_003414131.1.63222 WP_003414131.1.63247 WP_003414131.1.6328 WP_003414131.1.63312 WP_003414131.1.63331 WP_003414131.1.63373 WP_003414131.1.63384 WP_003414131.1.63403 WP_003414131.1.63424 WP_003414131.1.63428 WP_003414131.1.6345 WP_003414131.1.63464 WP_003414131.1.63483 WP_003414131.1.63502 WP_003414131.1.63504 WP_003414131.1.63522 WP_003414131.1.63530 WP_003414131.1.63538 WP_003414131.1.63564 WP_003414131.1.63567 WP_003414131.1.63596 WP_003414131.1.63600 WP_003414131.1.63623 WP_003414131.1.63624 WP_003414131.1.63625 WP_003414131.1.63627 WP_003414131.1.63654 WP_003414131.1.63711 WP_003414131.1.63734 WP_003414131.1.63807 WP_003414131.1.63819 WP_003414131.1.63844 WP_003414131.1.63888 WP_003414131.1.63913 WP_003414131.1.63915 WP_003414131.1.63918 WP_003414131.1.63961 WP_003414131.1.63970 WP_003414131.1.64000 WP_003414131.1.64027 WP_003414131.1.64058 WP_003414131.1.64065 WP_003414131.1.6407 WP_003414131.1.64082 WP_003414131.1.64091 WP_003414131.1.64102 WP_003414131.1.64104 WP_003414131.1.64119 WP_003414131.1.64169 WP_003414131.1.6422 WP_003414131.1.64222 WP_003414131.1.64223 WP_003414131.1.64228 WP_003414131.1.64235 WP_003414131.1.64249 WP_003414131.1.6427 WP_003414131.1.64278 WP_003414131.1.64287 WP_003414131.1.64414 WP_003414131.1.64419 WP_003414131.1.6443 WP_003414131.1.64463 WP_003414131.1.64480 WP_003414131.1.64497 WP_003414131.1.64506 WP_003414131.1.64511 WP_003414131.1.64513 WP_003414131.1.64514 WP_003414131.1.64515 WP_003414131.1.64522 WP_003414131.1.64526 WP_003414131.1.64543 WP_003414131.1.6456 WP_003414131.1.64567 WP_003414131.1.64589 WP_003414131.1.64595 WP_003414131.1.64619 WP_003414131.1.64629 WP_003414131.1.6464 WP_003414131.1.64664 WP_003414131.1.64669 WP_003414131.1.64672 WP_003414131.1.64680 WP_003414131.1.64682 WP_003414131.1.64727 WP_003414131.1.64729 WP_003414131.1.64774 WP_003414131.1.64776 WP_003414131.1.64802 WP_003414131.1.64832 WP_003414131.1.6486 WP_003414131.1.64870 WP_003414131.1.64898 WP_003414131.1.64922 WP_003414131.1.64924 WP_003414131.1.6493 WP_003414131.1.64937 WP_003414131.1.64941 WP_003414131.1.64966 WP_003414131.1.64973 WP_003414131.1.65001 WP_003414131.1.65053 WP_003414131.1.65070 WP_003414131.1.65079 WP_003414131.1.65102 WP_003414131.1.65157 WP_003414131.1.65181 WP_003414131.1.65212 WP_003414131.1.65229 WP_003414131.1.6523 WP_003414131.1.65289 WP_003414131.1.65291 WP_003414131.1.65315 WP_003414131.1.65329 WP_003414131.1.65359 WP_003414131.1.6536 WP_003414131.1.65374 WP_003414131.1.65386 WP_003414131.1.65414 WP_003414131.1.65416 WP_003414131.1.65433 WP_003414131.1.65467 WP_003414131.1.65529 WP_003414131.1.65539 WP_003414131.1.65583 WP_003414131.1.65612 WP_003414131.1.65623 WP_003414131.1.65635 WP_003414131.1.65637 WP_003414131.1.65648 WP_003414131.1.65683 WP_003414131.1.65686 WP_003414131.1.65688 WP_003414131.1.65707 WP_003414131.1.65733 WP_003414131.1.65746 WP_003414131.1.65747 WP_003414131.1.65759 WP_003414131.1.65816 WP_003414131.1.65830 WP_003414131.1.65858 WP_003414131.1.65862 WP_003414131.1.65869 WP_003414131.1.65893 WP_003414131.1.65929 WP_003414131.1.65932 WP_003414131.1.65958 WP_003414131.1.65974 WP_003414131.1.66004 WP_003414131.1.66013 WP_003414131.1.6606 WP_003414131.1.66089 WP_003414131.1.66149 WP_003414131.1.66151 WP_003414131.1.66229 WP_003414131.1.66276 WP_003414131.1.66293 WP_003414131.1.66297 WP_003414131.1.66323 WP_003414131.1.66325 WP_003414131.1.6633 WP_003414131.1.66334 WP_003414131.1.66355 WP_003414131.1.66367 WP_003414131.1.66394 WP_003414131.1.66396 WP_003414131.1.66451 WP_003414131.1.66455 WP_003414131.1.66457 WP_003414131.1.66460 WP_003414131.1.66464 WP_003414131.1.66466 WP_003414131.1.66487 WP_003414131.1.66504 WP_003414131.1.66544 WP_003414131.1.66558 WP_003414131.1.66580 WP_003414131.1.66582 WP_003414131.1.66612 WP_003414131.1.66615 WP_003414131.1.66617 WP_003414131.1.66635 WP_003414131.1.66656 WP_003414131.1.66663 WP_003414131.1.66675 WP_003414131.1.66715 WP_003414131.1.66718 WP_003414131.1.66762 WP_003414131.1.66776 WP_003414131.1.66808 WP_003414131.1.66817 WP_003414131.1.66819 WP_003414131.1.66826 WP_003414131.1.66830 WP_003414131.1.66842 WP_003414131.1.66878 WP_003414131.1.66880 WP_003414131.1.66893 WP_003414131.1.66961 WP_003414131.1.67005 WP_003414131.1.6704 WP_003414131.1.67044 WP_003414131.1.67061 WP_003414131.1.67089 WP_003414131.1.67098 WP_003414131.1.67146 WP_003414131.1.67170 WP_003414131.1.67197 WP_003414131.1.67198 WP_003414131.1.6720 WP_003414131.1.67207 WP_003414131.1.67218 WP_003414131.1.67220 WP_003414131.1.67231 WP_003414131.1.6724 WP_003414131.1.67257 WP_003414131.1.67298 WP_003414131.1.67307 WP_003414131.1.67324 WP_003414131.1.67332 WP_003414131.1.67346 WP_003414131.1.67354 WP_003414131.1.67360 WP_003414131.1.67381 WP_003414131.1.67396 WP_003414131.1.67417 WP_003414131.1.67422 WP_003414131.1.67453 WP_003414131.1.67459 WP_003414131.1.6746 WP_003414131.1.67473 WP_003414131.1.67481 WP_003414131.1.67482 WP_003414131.1.67496 WP_003414131.1.67499 WP_003414131.1.67516 WP_003414131.1.67523 WP_003414131.1.67536 WP_003414131.1.67575 WP_003414131.1.67587 WP_003414131.1.67598 WP_003414131.1.67600 WP_003414131.1.67602 WP_003414131.1.67630 WP_003414131.1.67679 WP_003414131.1.67692 WP_003414131.1.67744 WP_003414131.1.6775 WP_003414131.1.67750 WP_003414131.1.6777 WP_003414131.1.67809 WP_003414131.1.67816 WP_003414131.1.67844 WP_003414131.1.67848 WP_003414131.1.67870 WP_003414131.1.67888 WP_003414131.1.67915 WP_003414131.1.67945 WP_003414131.1.67949 WP_003414131.1.67980 WP_003414131.1.67982 WP_003414131.1.68022 WP_003414131.1.68037 WP_003414131.1.68038 WP_003414131.1.68045 WP_003414131.1.68057 WP_003414131.1.68083 WP_003414131.1.68088 WP_003414131.1.68106 WP_003414131.1.68110 WP_003414131.1.68153 WP_003414131.1.68164 WP_003414131.1.68169 WP_003414131.1.68193 WP_003414131.1.68227 WP_003414131.1.68243 WP_003414131.1.6825 WP_003414131.1.68309 WP_003414131.1.68325 WP_003414131.1.68329 WP_003414131.1.68384 WP_003414131.1.68388 WP_003414131.1.68429 WP_003414131.1.6843 WP_003414131.1.68433 WP_003414131.1.68444 WP_003414131.1.68465 WP_003414131.1.68484 WP_003414131.1.68518 WP_003414131.1.68569 WP_003414131.1.68576 WP_003414131.1.68580 WP_003414131.1.68586 WP_003414131.1.68623 WP_003414131.1.68624 WP_003414131.1.68637 WP_003414131.1.68646 WP_003414131.1.68667 WP_003414131.1.68669 WP_003414131.1.68672 WP_003414131.1.68684 WP_003414131.1.68704 WP_003414131.1.68708 WP_003414131.1.6872 WP_003414131.1.68730 WP_003414131.1.68734 WP_003414131.1.68748 WP_003414131.1.68754 WP_003414131.1.6876 WP_003414131.1.68761 WP_003414131.1.68763 WP_003414131.1.68766 WP_003414131.1.68796 WP_003414131.1.68824 WP_003414131.1.68832 WP_003414131.1.68833 WP_003414131.1.68841 WP_003414131.1.68859 WP_003414131.1.68876 WP_003414131.1.68906 WP_003414131.1.68916 WP_003414131.1.68923 WP_003414131.1.68945 WP_003414131.1.6896 WP_003414131.1.68981 WP_003414131.1.68997 WP_003414131.1.69008 WP_003414131.1.69076 WP_003414131.1.69079 WP_003414131.1.6908 WP_003414131.1.69082 WP_003414131.1.69178 WP_003414131.1.69181 WP_003414131.1.69208 WP_003414131.1.69231 WP_003414131.1.69256 WP_003414131.1.69311 WP_003414131.1.69315 WP_003414131.1.69322 WP_003414131.1.69342 WP_003414131.1.6935 WP_003414131.1.6936 WP_003414131.1.69369 WP_003414131.1.69374 WP_003414131.1.69398 WP_003414131.1.69401 WP_003414131.1.69427 WP_003414131.1.69429 WP_003414131.1.6949 WP_003414131.1.6951 WP_003414131.1.69511 WP_003414131.1.69526 WP_003414131.1.69528 WP_003414131.1.69547 WP_003414131.1.69573 WP_003414131.1.69581 WP_003414131.1.6960 WP_003414131.1.69617 WP_003414131.1.69634 WP_003414131.1.69647 WP_003414131.1.69659 WP_003414131.1.69673 WP_003414131.1.69682 WP_003414131.1.69684 WP_003414131.1.69686 WP_003414131.1.69707 WP_003414131.1.69709 WP_003414131.1.69723 WP_003414131.1.69736 WP_003414131.1.69778 WP_003414131.1.69800 WP_003414131.1.69802 WP_003414131.1.69845 WP_003414131.1.69870 WP_003414131.1.69873 WP_003414131.1.69898 WP_003414131.1.69913 WP_003414131.1.69925 WP_003414131.1.69931 WP_003414131.1.69955 WP_003414131.1.69957 WP_003414131.1.69981 WP_003414131.1.69990 WP_003414131.1.70 WP_003414131.1.70000 WP_003414131.1.70017 WP_003414131.1.70032 WP_003414131.1.70055 WP_003414131.1.70072 WP_003414131.1.70131 WP_003414131.1.70132 WP_003414131.1.7022 WP_003414131.1.70255 WP_003414131.1.70271 WP_003414131.1.70274 WP_003414131.1.7029 WP_003414131.1.70325 WP_003414131.1.70328 WP_003414131.1.70356 WP_003414131.1.70364 WP_003414131.1.70368 WP_003414131.1.70369 WP_003414131.1.70418 WP_003414131.1.70422 WP_003414131.1.70435 WP_003414131.1.70444 WP_003414131.1.70463 WP_003414131.1.70471 WP_003414131.1.70480 WP_003414131.1.70494 WP_003414131.1.70498 WP_003414131.1.70505 WP_003414131.1.70525 WP_003414131.1.70573 WP_003414131.1.70610 WP_003414131.1.70615 WP_003414131.1.70618 WP_003414131.1.70622 WP_003414131.1.70626 WP_003414131.1.70668 WP_003414131.1.70699 WP_003414131.1.70704 WP_003414131.1.70757 WP_003414131.1.70782 WP_003414131.1.70796 WP_003414131.1.70830 WP_003414131.1.70834 WP_003414131.1.7084 WP_003414131.1.70840 WP_003414131.1.70864 WP_003414131.1.70915 WP_003414131.1.70955 WP_003414131.1.70958 WP_003414131.1.70964 WP_003414131.1.70976 WP_003414131.1.71015 WP_003414131.1.71063 WP_003414131.1.71076 WP_003414131.1.71083 WP_003414131.1.7111 WP_003414131.1.71118 WP_003414131.1.71128 WP_003414131.1.7113 WP_003414131.1.71187 WP_003414131.1.71191 WP_003414131.1.71255 WP_003414131.1.71258 WP_003414131.1.71259 WP_003414131.1.71289 WP_003414131.1.71326 WP_003414131.1.71329 WP_003414131.1.71344 WP_003414131.1.71390 WP_003414131.1.71414 WP_003414131.1.71440 WP_003414131.1.7146 WP_003414131.1.71464 WP_003414131.1.71490 WP_003414131.1.71492 WP_003414131.1.71509 WP_003414131.1.71516 WP_003414131.1.71517 WP_003414131.1.71527 WP_003414131.1.71532 WP_003414131.1.71545 WP_003414131.1.71546 WP_003414131.1.71569 WP_003414131.1.71604 WP_003414131.1.71621 WP_003414131.1.71630 WP_003414131.1.71638 WP_003414131.1.71654 WP_003414131.1.71664 WP_003414131.1.71665 WP_003414131.1.71683 WP_003414131.1.71701 WP_003414131.1.71718 WP_003414131.1.71731 WP_003414131.1.71778 WP_003414131.1.71781 WP_003414131.1.71803 WP_003414131.1.71820 WP_003414131.1.71847 WP_003414131.1.7185 WP_003414131.1.71851 WP_003414131.1.71871 WP_003414131.1.71909 WP_003414131.1.71957 WP_003414131.1.71970 WP_003414131.1.72047 WP_003414131.1.72061 WP_003414131.1.72062 WP_003414131.1.72072 WP_003414131.1.72111 WP_003414131.1.72122 WP_003414131.1.72128 WP_003414131.1.72143 WP_003414131.1.7216 WP_003414131.1.72168 WP_003414131.1.72179 WP_003414131.1.72209 WP_003414131.1.72218 WP_003414131.1.72219 WP_003414131.1.72268 WP_003414131.1.72332 WP_003414131.1.72380 WP_003414131.1.72401 WP_003414131.1.72405 WP_003414131.1.72420 WP_003414131.1.72441 WP_003414131.1.72451 WP_003414131.1.72452 WP_003414131.1.72457 WP_003414131.1.72459 WP_003414131.1.72460 WP_003414131.1.72466 WP_003414131.1.72487 WP_003414131.1.72488 WP_003414131.1.72492 WP_003414131.1.72506 WP_003414131.1.72543 WP_003414131.1.72576 WP_003414131.1.72578 WP_003414131.1.72585 WP_003414131.1.72591 WP_003414131.1.72592 WP_003414131.1.72640 WP_003414131.1.7266 WP_003414131.1.72661 WP_003414131.1.72684 WP_003414131.1.72739 WP_003414131.1.72744 WP_003414131.1.72755 WP_003414131.1.72759 WP_003414131.1.72784 WP_003414131.1.72792 WP_003414131.1.72826 WP_003414131.1.72831 WP_003414131.1.72852 WP_003414131.1.72853 WP_003414131.1.72879 WP_003414131.1.72880 WP_003414131.1.72938 WP_003414131.1.72954 WP_003414131.1.72957 WP_003414131.1.72959 WP_003414131.1.72973 WP_003414131.1.7298 WP_003414131.1.72982 WP_003414131.1.72988 WP_003414131.1.72993 WP_003414131.1.73006 WP_003414131.1.73013 WP_003414131.1.73025 WP_003414131.1.73028 WP_003414131.1.73042 WP_003414131.1.73045 WP_003414131.1.73092 WP_003414131.1.73118 WP_003414131.1.7312 WP_003414131.1.73127 WP_003414131.1.73134 WP_003414131.1.73150 WP_003414131.1.73154 WP_003414131.1.73163 WP_003414131.1.73182 WP_003414131.1.73205 WP_003414131.1.7321 WP_003414131.1.73310 WP_003414131.1.73365 WP_003414131.1.73391 WP_003414131.1.73424 WP_003414131.1.73436 WP_003414131.1.73445 WP_003414131.1.73453 WP_003414131.1.73465 WP_003414131.1.73466 WP_003414131.1.73470 WP_003414131.1.73471 WP_003414131.1.73478 WP_003414131.1.73482 WP_003414131.1.73507 WP_003414131.1.73532 WP_003414131.1.73550 WP_003414131.1.73564 WP_003414131.1.73623 WP_003414131.1.73629 WP_003414131.1.73644 WP_003414131.1.7366 WP_003414131.1.73661 WP_003414131.1.7368 WP_003414131.1.73688 WP_003414131.1.73744 WP_003414131.1.73750 WP_003414131.1.73760 WP_003414131.1.73774 WP_003414131.1.7379 WP_003414131.1.73813 WP_003414131.1.73840 WP_003414131.1.73876 WP_003414131.1.7389 WP_003414131.1.73986 WP_003414131.1.74016 WP_003414131.1.74039 WP_003414131.1.74083 WP_003414131.1.74101 WP_003414131.1.74107 WP_003414131.1.74120 WP_003414131.1.74129 WP_003414131.1.74144 WP_003414131.1.7417 WP_003414131.1.74190 WP_003414131.1.74210 WP_003414131.1.7423 WP_003414131.1.74259 WP_003414131.1.74262 WP_003414131.1.74269 WP_003414131.1.74282 WP_003414131.1.74291 WP_003414131.1.74296 WP_003414131.1.74304 WP_003414131.1.7432 WP_003414131.1.74347 WP_003414131.1.7436 WP_003414131.1.74378 WP_003414131.1.74382 WP_003414131.1.74395 WP_003414131.1.74400 WP_003414131.1.74401 WP_003414131.1.74432 WP_003414131.1.74442 WP_003414131.1.74477 WP_003414131.1.74487 WP_003414131.1.74499 WP_003414131.1.74504 WP_003414131.1.74511 WP_003414131.1.74523 WP_003414131.1.74525 WP_003414131.1.74551 WP_003414131.1.74555 WP_003414131.1.74628 WP_003414131.1.74641 WP_003414131.1.74653 WP_003414131.1.74660 WP_003414131.1.74683 WP_003414131.1.7469 WP_003414131.1.74725 WP_003414131.1.74760 WP_003414131.1.74786 WP_003414131.1.74809 WP_003414131.1.74820 WP_003414131.1.74870 WP_003414131.1.74888 WP_003414131.1.74952 WP_003414131.1.7496 WP_003414131.1.74988 WP_003414131.1.75043 WP_003414131.1.75045 WP_003414131.1.75055 WP_003414131.1.75078 WP_003414131.1.75081 WP_003414131.1.75120 WP_003414131.1.75163 WP_003414131.1.75188 WP_003414131.1.75200 WP_003414131.1.75202 WP_003414131.1.75234 WP_003414131.1.75239 WP_003414131.1.75250 WP_003414131.1.75281 WP_003414131.1.75342 WP_003414131.1.7535 WP_003414131.1.75376 WP_003414131.1.75391 WP_003414131.1.75395 WP_003414131.1.75441 WP_003414131.1.75510 WP_003414131.1.75581 WP_003414131.1.75598 WP_003414131.1.75635 WP_003414131.1.75645 WP_003414131.1.75665 WP_003414131.1.75671 WP_003414131.1.75741 WP_003414131.1.75749 WP_003414131.1.75772 WP_003414131.1.75774 WP_003414131.1.75811 WP_003414131.1.75833 WP_003414131.1.7585 WP_003414131.1.75864 WP_003414131.1.75868 WP_003414131.1.75878 WP_003414131.1.75927 WP_003414131.1.75946 WP_003414131.1.75968 WP_003414131.1.75974 WP_003414131.1.76007 WP_003414131.1.76016 WP_003414131.1.76032 WP_003414131.1.76037 WP_003414131.1.7604 WP_003414131.1.76045 WP_003414131.1.76052 WP_003414131.1.76058 WP_003414131.1.76064 WP_003414131.1.76110 WP_003414131.1.76126 WP_003414131.1.76133 WP_003414131.1.76138 WP_003414131.1.76157 WP_003414131.1.76172 WP_003414131.1.76177 WP_003414131.1.76183 WP_003414131.1.76209 WP_003414131.1.76239 WP_003414131.1.76272 WP_003414131.1.76277 WP_003414131.1.76280 WP_003414131.1.76291 WP_003414131.1.76297 WP_003414131.1.76360 WP_003414131.1.76379 WP_003414131.1.76403 WP_003414131.1.76413 WP_003414131.1.76414 WP_003414131.1.76427 WP_003414131.1.76436 WP_003414131.1.76442 WP_003414131.1.76443 WP_003414131.1.76456 WP_003414131.1.76521 WP_003414131.1.76533 WP_003414131.1.76616 WP_003414131.1.76625 WP_003414131.1.76629 WP_003414131.1.76635 WP_003414131.1.76638 WP_003414131.1.76639 WP_003414131.1.76640 WP_003414131.1.76644 WP_003414131.1.76677 WP_003414131.1.76678 WP_003414131.1.76679 WP_003414131.1.76734 WP_003414131.1.76744 WP_003414131.1.76750 WP_003414131.1.76757 WP_003414131.1.76781 WP_003414131.1.76818 WP_003414131.1.76824 WP_003414131.1.76835 WP_003414131.1.76873 WP_003414131.1.76881 WP_003414131.1.76888 WP_003414131.1.76900 WP_003414131.1.7691 WP_003414131.1.76947 WP_003414131.1.76954 WP_003414131.1.76955 WP_003414131.1.76963 WP_003414131.1.76976 WP_003414131.1.770 WP_003414131.1.77000 WP_003414131.1.77008 WP_003414131.1.77021 WP_003414131.1.77065 WP_003414131.1.77075 WP_003414131.1.77093 WP_003414131.1.77107 WP_003414131.1.77115 WP_003414131.1.77118 WP_003414131.1.77125 WP_003414131.1.77141 WP_003414131.1.77166 WP_003414131.1.77250 WP_003414131.1.77252 WP_003414131.1.77260 WP_003414131.1.77266 WP_003414131.1.77280 WP_003414131.1.77285 WP_003414131.1.77312 WP_003414131.1.77348 WP_003414131.1.77351 WP_003414131.1.77352 WP_003414131.1.77361 WP_003414131.1.774 WP_003414131.1.7740 WP_003414131.1.77404 WP_003414131.1.77425 WP_003414131.1.77474 WP_003414131.1.7748 WP_003414131.1.77484 WP_003414131.1.77491 WP_003414131.1.77499 WP_003414131.1.77510 WP_003414131.1.77530 WP_003414131.1.77554 WP_003414131.1.77559 WP_003414131.1.77605 WP_003414131.1.7762 WP_003414131.1.77627 WP_003414131.1.77654 WP_003414131.1.7766 WP_003414131.1.77667 WP_003414131.1.77704 WP_003414131.1.77706 WP_003414131.1.77726 WP_003414131.1.77774 WP_003414131.1.7778 WP_003414131.1.77790 WP_003414131.1.77809 WP_003414131.1.77820 WP_003414131.1.77843 WP_003414131.1.77855 WP_003414131.1.77865 WP_003414131.1.77868 WP_003414131.1.77879 WP_003414131.1.77890 WP_003414131.1.77909 WP_003414131.1.77911 WP_003414131.1.77931 WP_003414131.1.77984 WP_003414131.1.78020 WP_003414131.1.78024 WP_003414131.1.78075 WP_003414131.1.78084 WP_003414131.1.78086 WP_003414131.1.7809 WP_003414131.1.78098 WP_003414131.1.78105 WP_003414131.1.78113 WP_003414131.1.78136 WP_003414131.1.78162 WP_003414131.1.7817 WP_003414131.1.78200 WP_003414131.1.78216 WP_003414131.1.78236 WP_003414131.1.78238 WP_003414131.1.78322 WP_003414131.1.78338 WP_003414131.1.7836 WP_003414131.1.78360 WP_003414131.1.78386 WP_003414131.1.78429 WP_003414131.1.78435 WP_003414131.1.7844 WP_003414131.1.78459 WP_003414131.1.78499 WP_003414131.1.785 WP_003414131.1.78516 WP_003414131.1.78524 WP_003414131.1.78526 WP_003414131.1.78538 WP_003414131.1.78545 WP_003414131.1.78547 WP_003414131.1.78574 WP_003414131.1.78580 WP_003414131.1.7860 WP_003414131.1.78646 WP_003414131.1.78649 WP_003414131.1.78655 WP_003414131.1.78657 WP_003414131.1.78659 WP_003414131.1.78692 WP_003414131.1.78760 WP_003414131.1.78766 WP_003414131.1.78776 WP_003414131.1.78778 WP_003414131.1.78784 WP_003414131.1.78788 WP_003414131.1.78790 WP_003414131.1.78793 WP_003414131.1.78848 WP_003414131.1.78860 WP_003414131.1.7887 WP_003414131.1.78884 WP_003414131.1.78932 WP_003414131.1.78969 WP_003414131.1.78980 WP_003414131.1.79005 WP_003414131.1.79016 WP_003414131.1.79033 WP_003414131.1.79064 WP_003414131.1.79066 WP_003414131.1.79068 WP_003414131.1.79077 WP_003414131.1.79095 WP_003414131.1.79112 WP_003414131.1.79122 WP_003414131.1.79145 WP_003414131.1.79152 WP_003414131.1.79163 WP_003414131.1.79198 WP_003414131.1.79213 WP_003414131.1.79218 WP_003414131.1.79268 WP_003414131.1.79273 WP_003414131.1.79278 WP_003414131.1.79290 WP_003414131.1.79325 WP_003414131.1.79326 WP_003414131.1.7933 WP_003414131.1.79330 WP_003414131.1.79339 WP_003414131.1.79394 WP_003414131.1.79399 WP_003414131.1.79413 WP_003414131.1.79422 WP_003414131.1.79445 WP_003414131.1.79447 WP_003414131.1.79455 WP_003414131.1.79471 WP_003414131.1.79480 WP_003414131.1.79482 WP_003414131.1.79488 WP_003414131.1.79500 WP_003414131.1.79502 WP_003414131.1.79514 WP_003414131.1.79561 WP_003414131.1.79565 WP_003414131.1.79578 WP_003414131.1.79588 WP_003414131.1.79598 WP_003414131.1.79615 WP_003414131.1.79684 WP_003414131.1.79698 WP_003414131.1.797 WP_003414131.1.79744 WP_003414131.1.79784 WP_003414131.1.79802 WP_003414131.1.79806 WP_003414131.1.79819 WP_003414131.1.79826 WP_003414131.1.79851 WP_003414131.1.79853 WP_003414131.1.79863 WP_003414131.1.79881 WP_003414131.1.79885 WP_003414131.1.79898 WP_003414131.1.7990 WP_003414131.1.79900 WP_003414131.1.79913 WP_003414131.1.79918 WP_003414131.1.79947 WP_003414131.1.7995 WP_003414131.1.7997 WP_003414131.1.80004 WP_003414131.1.80015 WP_003414131.1.80022 WP_003414131.1.80030 WP_003414131.1.80084 WP_003414131.1.80099 WP_003414131.1.80129 WP_003414131.1.80177 WP_003414131.1.80234 WP_003414131.1.8026 WP_003414131.1.80275 WP_003414131.1.8029 WP_003414131.1.80299 WP_003414131.1.80300 WP_003414131.1.80304 WP_003414131.1.80326 WP_003414131.1.80351 WP_003414131.1.8037 WP_003414131.1.80370 WP_003414131.1.80387 WP_003414131.1.80399 WP_003414131.1.8044 WP_003414131.1.80451 WP_003414131.1.80458 WP_003414131.1.80461 WP_003414131.1.80490 WP_003414131.1.80503 WP_003414131.1.80507 WP_003414131.1.80552 WP_003414131.1.80576 WP_003414131.1.80588 WP_003414131.1.80599 WP_003414131.1.80624 WP_003414131.1.80636 WP_003414131.1.80669 WP_003414131.1.80673 WP_003414131.1.80711 WP_003414131.1.80714 WP_003414131.1.80743 WP_003414131.1.80784 WP_003414131.1.80815 WP_003414131.1.80918 WP_003414131.1.8093 WP_003414131.1.80967 WP_003414131.1.8097 WP_003414131.1.80988 WP_003414131.1.81007 WP_003414131.1.81013 WP_003414131.1.8105 WP_003414131.1.81059 WP_003414131.1.81063 WP_003414131.1.81066 WP_003414131.1.81075 WP_003414131.1.81091 WP_003414131.1.81119 WP_003414131.1.81125 WP_003414131.1.81136 WP_003414131.1.8114 WP_003414131.1.81189 WP_003414131.1.81192 WP_003414131.1.812 WP_003414131.1.81230 WP_003414131.1.81249 WP_003414131.1.81250 WP_003414131.1.81264 WP_003414131.1.8128 WP_003414131.1.81287 WP_003414131.1.81297 WP_003414131.1.8138 WP_003414131.1.8143 WP_003414131.1.81439 WP_003414131.1.81465 WP_003414131.1.81505 WP_003414131.1.81529 WP_003414131.1.81538 WP_003414131.1.81541 WP_003414131.1.81560 WP_003414131.1.81561 WP_003414131.1.81567 WP_003414131.1.81583 WP_003414131.1.81686 WP_003414131.1.81712 WP_003414131.1.81720 WP_003414131.1.81731 WP_003414131.1.81774 WP_003414131.1.81788 WP_003414131.1.81809 WP_003414131.1.81820 WP_003414131.1.81850 WP_003414131.1.81883 WP_003414131.1.81891 WP_003414131.1.81911 WP_003414131.1.81918 WP_003414131.1.82011 WP_003414131.1.82048 WP_003414131.1.82069 WP_003414131.1.82071 WP_003414131.1.82108 WP_003414131.1.82136 WP_003414131.1.82142 WP_003414131.1.8215 WP_003414131.1.82158 WP_003414131.1.8217 WP_003414131.1.82209 WP_003414131.1.82210 WP_003414131.1.82228 WP_003414131.1.82236 WP_003414131.1.82251 WP_003414131.1.82271 WP_003414131.1.82305 WP_003414131.1.82307 WP_003414131.1.82309 WP_003414131.1.82317 WP_003414131.1.8232 WP_003414131.1.82346 WP_003414131.1.82374 WP_003414131.1.82385 WP_003414131.1.82429 WP_003414131.1.82460 WP_003414131.1.82462 WP_003414131.1.82483 WP_003414131.1.82494 WP_003414131.1.82531 WP_003414131.1.82547 WP_003414131.1.82549 WP_003414131.1.82577 WP_003414131.1.82592 WP_003414131.1.82597 WP_003414131.1.82598 WP_003414131.1.82625 WP_003414131.1.82642 WP_003414131.1.82651 WP_003414131.1.82653 WP_003414131.1.82681 WP_003414131.1.82685 WP_003414131.1.8271 WP_003414131.1.82712 WP_003414131.1.8273 WP_003414131.1.82743 WP_003414131.1.82757 WP_003414131.1.82774 WP_003414131.1.82803 WP_003414131.1.82836 WP_003414131.1.82860 WP_003414131.1.82871 WP_003414131.1.82892 WP_003414131.1.82935 WP_003414131.1.82957 WP_003414131.1.82973 WP_003414131.1.82981 WP_003414131.1.82983 WP_003414131.1.83004 WP_003414131.1.83009 WP_003414131.1.83044 WP_003414131.1.83065 WP_003414131.1.83074 WP_003414131.1.83110 WP_003414131.1.83146 WP_003414131.1.83149 WP_003414131.1.83159 WP_003414131.1.8317 WP_003414131.1.83173 WP_003414131.1.83181 WP_003414131.1.83182 WP_003414131.1.83191 WP_003414131.1.83212 WP_003414131.1.8326 WP_003414131.1.83262 WP_003414131.1.83268 WP_003414131.1.83273 WP_003414131.1.83309 WP_003414131.1.83332 WP_003414131.1.83334 WP_003414131.1.83349 WP_003414131.1.8335 WP_003414131.1.83353 WP_003414131.1.83367 WP_003414131.1.83380 WP_003414131.1.83381 WP_003414131.1.83389 WP_003414131.1.83408 WP_003414131.1.83409 WP_003414131.1.83435 WP_003414131.1.83470 WP_003414131.1.83524 WP_003414131.1.83526 WP_003414131.1.8358 WP_003414131.1.83589 WP_003414131.1.83601 WP_003414131.1.83611 WP_003414131.1.83638 WP_003414131.1.83648 WP_003414131.1.83656 WP_003414131.1.83667 WP_003414131.1.83689 WP_003414131.1.83704 WP_003414131.1.83705 WP_003414131.1.83766 WP_003414131.1.83793 WP_003414131.1.83794 WP_003414131.1.83802 WP_003414131.1.83805 WP_003414131.1.83839 WP_003414131.1.83842 WP_003414131.1.83850 WP_003414131.1.83861 WP_003414131.1.83884 WP_003414131.1.83920 WP_003414131.1.83929 WP_003414131.1.83930 WP_003414131.1.83975 WP_003414131.1.83991 WP_003414131.1.8400 WP_003414131.1.84027 WP_003414131.1.8404 WP_003414131.1.84057 WP_003414131.1.84070 WP_003414131.1.8409 WP_003414131.1.84112 WP_003414131.1.84146 WP_003414131.1.8415 WP_003414131.1.84186 WP_003414131.1.84192 WP_003414131.1.84228 WP_003414131.1.8424 WP_003414131.1.84244 WP_003414131.1.84259 WP_003414131.1.8426 WP_003414131.1.84277 WP_003414131.1.84287 WP_003414131.1.8434 WP_003414131.1.84388 WP_003414131.1.84408 WP_003414131.1.84409 WP_003414131.1.84438 WP_003414131.1.84460 WP_003414131.1.84488 WP_003414131.1.84504 WP_003414131.1.84525 WP_003414131.1.84620 WP_003414131.1.84623 WP_003414131.1.84641 WP_003414131.1.84655 WP_003414131.1.84670 WP_003414131.1.84739 WP_003414131.1.84748 WP_003414131.1.84766 WP_003414131.1.84772 WP_003414131.1.84774 WP_003414131.1.848 WP_003414131.1.84812 WP_003414131.1.84836 WP_003414131.1.84839 WP_003414131.1.84846 WP_003414131.1.84873 WP_003414131.1.84911 WP_003414131.1.84938 WP_003414131.1.84968 WP_003414131.1.84973 WP_003414131.1.84981 WP_003414131.1.84985 WP_003414131.1.8503 WP_003414131.1.85041 WP_003414131.1.85043 WP_003414131.1.8505 WP_003414131.1.85074 WP_003414131.1.8509 WP_003414131.1.8512 WP_003414131.1.85148 WP_003414131.1.8518 WP_003414131.1.8522 WP_003414131.1.85276 WP_003414131.1.85281 WP_003414131.1.85284 WP_003414131.1.85314 WP_003414131.1.85319 WP_003414131.1.85330 WP_003414131.1.85341 WP_003414131.1.85346 WP_003414131.1.8535 WP_003414131.1.85363 WP_003414131.1.85371 WP_003414131.1.85377 WP_003414131.1.85387 WP_003414131.1.85399 WP_003414131.1.85458 WP_003414131.1.8546 WP_003414131.1.85464 WP_003414131.1.85478 WP_003414131.1.85480 WP_003414131.1.85488 WP_003414131.1.85495 WP_003414131.1.85551 WP_003414131.1.85557 WP_003414131.1.85577 WP_003414131.1.85597 WP_003414131.1.85599 WP_003414131.1.85610 WP_003414131.1.8563 WP_003414131.1.85648 WP_003414131.1.85679 WP_003414131.1.85704 WP_003414131.1.85717 WP_003414131.1.85727 WP_003414131.1.85737 WP_003414131.1.85763 WP_003414131.1.85808 WP_003414131.1.85819 WP_003414131.1.85820 WP_003414131.1.85823 WP_003414131.1.85832 WP_003414131.1.8586 WP_003414131.1.85872 WP_003414131.1.85894 WP_003414131.1.85909 WP_003414131.1.85913 WP_003414131.1.85953 WP_003414131.1.85986 WP_003414131.1.86000 WP_003414131.1.86024 WP_003414131.1.86025 WP_003414131.1.86032 WP_003414131.1.86048 WP_003414131.1.86052 WP_003414131.1.86067 WP_003414131.1.86122 WP_003414131.1.86124 WP_003414131.1.86160 WP_003414131.1.86168 WP_003414131.1.86190 WP_003414131.1.86204 WP_003414131.1.86208 WP_003414131.1.86235 WP_003414131.1.86249 WP_003414131.1.86260 WP_003414131.1.86290 WP_003414131.1.863 WP_003414131.1.86327 WP_003414131.1.86334 WP_003414131.1.86337 WP_003414131.1.86368 WP_003414131.1.86377 WP_003414131.1.86425 WP_003414131.1.86459 WP_003414131.1.8649 WP_003414131.1.86499 WP_003414131.1.86520 WP_003414131.1.86561 WP_003414131.1.86568 WP_003414131.1.86575 WP_003414131.1.86584 WP_003414131.1.86605 WP_003414131.1.86626 WP_003414131.1.86648 WP_003414131.1.8666 WP_003414131.1.86684 WP_003414131.1.86696 WP_003414131.1.86705 WP_003414131.1.86718 WP_003414131.1.86725 WP_003414131.1.86757 WP_003414131.1.86766 WP_003414131.1.86801 WP_003414131.1.86814 WP_003414131.1.86820 WP_003414131.1.86825 WP_003414131.1.86834 WP_003414131.1.8685 WP_003414131.1.86851 WP_003414131.1.86855 WP_003414131.1.86867 WP_003414131.1.86877 WP_003414131.1.86883 WP_003414131.1.8689 WP_003414131.1.86892 WP_003414131.1.86933 WP_003414131.1.86941 WP_003414131.1.86962 WP_003414131.1.86963 WP_003414131.1.86979 WP_003414131.1.8700 WP_003414131.1.87001 WP_003414131.1.87002 WP_003414131.1.87031 WP_003414131.1.87116 WP_003414131.1.87117 WP_003414131.1.8714 WP_003414131.1.87162 WP_003414131.1.87178 WP_003414131.1.87191 WP_003414131.1.87201 WP_003414131.1.87209 WP_003414131.1.87240 WP_003414131.1.87266 WP_003414131.1.87273 WP_003414131.1.87275 WP_003414131.1.8733 WP_003414131.1.87345 WP_003414131.1.87369 WP_003414131.1.8737 WP_003414131.1.87401 WP_003414131.1.87404 WP_003414131.1.87406 WP_003414131.1.87409 WP_003414131.1.87444 WP_003414131.1.87446 WP_003414131.1.87459 WP_003414131.1.87472 WP_003414131.1.87489 WP_003414131.1.87494 WP_003414131.1.87496 WP_003414131.1.87582 WP_003414131.1.87588 WP_003414131.1.87617 WP_003414131.1.87619 WP_003414131.1.87620 WP_003414131.1.87634 WP_003414131.1.87643 WP_003414131.1.8765 WP_003414131.1.87650 WP_003414131.1.87654 WP_003414131.1.87658 WP_003414131.1.87665 WP_003414131.1.87676 WP_003414131.1.87677 WP_003414131.1.87684 WP_003414131.1.87692 WP_003414131.1.87707 WP_003414131.1.87732 WP_003414131.1.87784 WP_003414131.1.87796 WP_003414131.1.87809 WP_003414131.1.87817 WP_003414131.1.87827 WP_003414131.1.87831 WP_003414131.1.87835 WP_003414131.1.87837 WP_003414131.1.87866 WP_003414131.1.8789 WP_003414131.1.87924 WP_003414131.1.87951 WP_003414131.1.87955 WP_003414131.1.87956 WP_003414131.1.87991 WP_003414131.1.88 WP_003414131.1.88002 WP_003414131.1.88037 WP_003414131.1.88039 WP_003414131.1.88072 WP_003414131.1.88077 WP_003414131.1.88121 WP_003414131.1.88180 WP_003414131.1.88191 WP_003414131.1.88205 WP_003414131.1.88217 WP_003414131.1.88219 WP_003414131.1.88245 WP_003414131.1.88253 WP_003414131.1.88294 WP_003414131.1.88315 WP_003414131.1.88316 WP_003414131.1.88320 WP_003414131.1.88338 WP_003414131.1.8840 WP_003414131.1.88437 WP_003414131.1.88453 WP_003414131.1.88469 WP_003414131.1.88489 WP_003414131.1.88507 WP_003414131.1.88521 WP_003414131.1.88530 WP_003414131.1.88537 WP_003414131.1.88541 WP_003414131.1.88592 WP_003414131.1.88616 WP_003414131.1.88618 WP_003414131.1.8862 WP_003414131.1.88625 WP_003414131.1.88632 WP_003414131.1.88634 WP_003414131.1.88649 WP_003414131.1.8870 WP_003414131.1.88737 WP_003414131.1.88756 WP_003414131.1.888 WP_003414131.1.88824 WP_003414131.1.88886 WP_003414131.1.88965 WP_003414131.1.8902 WP_003414131.1.89025 WP_003414131.1.89041 WP_003414131.1.89046 WP_003414131.1.89082 WP_003414131.1.89162 WP_003414131.1.89168 WP_003414131.1.8917 WP_003414131.1.89193 WP_003414131.1.89205 WP_003414131.1.89207 WP_003414131.1.89225 WP_003414131.1.8925 WP_003414131.1.89277 WP_003414131.1.89286 WP_003414131.1.89293 WP_003414131.1.89320 WP_003414131.1.8935 WP_003414131.1.89371 WP_003414131.1.89378 WP_003414131.1.89392 WP_003414131.1.89406 WP_003414131.1.8943 WP_003414131.1.89451 WP_003414131.1.89453 WP_003414131.1.89473 WP_003414131.1.89475 WP_003414131.1.89483 WP_003414131.1.895 WP_003414131.1.89513 WP_003414131.1.89522 WP_003414131.1.8954 WP_003414131.1.89543 WP_003414131.1.89567 WP_003414131.1.8957 WP_003414131.1.89572 WP_003414131.1.89589 WP_003414131.1.89607 WP_003414131.1.89613 WP_003414131.1.89625 WP_003414131.1.89648 WP_003414131.1.8967 WP_003414131.1.89670 WP_003414131.1.89676 WP_003414131.1.89729 WP_003414131.1.89739 WP_003414131.1.89762 WP_003414131.1.8977 WP_003414131.1.89802 WP_003414131.1.89808 WP_003414131.1.8982 WP_003414131.1.89829 WP_003414131.1.89831 WP_003414131.1.89844 WP_003414131.1.89849 WP_003414131.1.8989 WP_003414131.1.89901 WP_003414131.1.89903 WP_003414131.1.89909 WP_003414131.1.89922 WP_003414131.1.89926 WP_003414131.1.89963 WP_003414131.1.89971 WP_003414131.1.8998 WP_003414131.1.89987 WP_003414131.1.900 WP_003414131.1.90048 WP_003414131.1.9007 WP_003414131.1.90130 WP_003414131.1.90134 WP_003414131.1.90137 WP_003414131.1.90157 WP_003414131.1.90184 WP_003414131.1.90199 WP_003414131.1.90231 WP_003414131.1.90245 WP_003414131.1.90308 WP_003414131.1.90322 WP_003414131.1.90328 WP_003414131.1.90372 WP_003414131.1.90439 WP_003414131.1.90499 WP_003414131.1.9050 WP_003414131.1.90527 WP_003414131.1.90550 WP_003414131.1.90560 WP_003414131.1.90612 WP_003414131.1.90640 WP_003414131.1.90672 WP_003414131.1.90687 WP_003414131.1.90691 WP_003414131.1.90711 WP_003414131.1.90722 WP_003414131.1.90744 WP_003414131.1.9075 WP_003414131.1.90756 WP_003414131.1.90767 WP_003414131.1.90771 WP_003414131.1.90785 WP_003414131.1.90788 WP_003414131.1.90800 WP_003414131.1.90810 WP_003414131.1.90816 WP_003414131.1.90819 WP_003414131.1.9082 WP_003414131.1.90831 WP_003414131.1.90884 WP_003414131.1.90899 WP_003414131.1.90906 WP_003414131.1.90958 WP_003414131.1.90976 WP_003414131.1.90977 WP_003414131.1.90987 WP_003414131.1.9102 WP_003414131.1.91026 WP_003414131.1.91032 WP_003414131.1.91043 WP_003414131.1.91053 WP_003414131.1.91082 WP_003414131.1.91106 WP_003414131.1.91112 WP_003414131.1.91144 WP_003414131.1.91151 WP_003414131.1.91157 WP_003414131.1.91167 WP_003414131.1.91169 WP_003414131.1.91192 WP_003414131.1.91201 WP_003414131.1.91207 WP_003414131.1.91208 WP_003414131.1.91211 WP_003414131.1.91214 WP_003414131.1.91230 WP_003414131.1.91244 WP_003414131.1.91251 WP_003414131.1.91260 WP_003414131.1.91265 WP_003414131.1.9128 WP_003414131.1.91284 WP_003414131.1.91294 WP_003414131.1.91303 WP_003414131.1.91322 WP_003414131.1.91352 WP_003414131.1.91386 WP_003414131.1.9139 WP_003414131.1.91411 WP_003414131.1.91430 WP_003414131.1.91436 WP_003414131.1.91483 WP_003414131.1.91496 WP_003414131.1.91507 WP_003414131.1.91508 WP_003414131.1.91576 WP_003414131.1.91589 WP_003414131.1.91694 WP_003414131.1.91695 WP_003414131.1.91713 WP_003414131.1.91716 WP_003414131.1.91717 WP_003414131.1.91728 WP_003414131.1.91743 WP_003414131.1.91759 WP_003414131.1.91784 WP_003414131.1.91785 WP_003414131.1.91786 WP_003414131.1.91802 WP_003414131.1.91822 WP_003414131.1.91828 WP_003414131.1.9189 WP_003414131.1.91896 WP_003414131.1.9190 WP_003414131.1.91915 WP_003414131.1.91931 WP_003414131.1.91937 WP_003414131.1.91944 WP_003414131.1.91953 WP_003414131.1.91957 WP_003414131.1.91976 WP_003414131.1.91978 WP_003414131.1.92021 WP_003414131.1.92083 WP_003414131.1.92127 WP_003414131.1.92144 WP_003414131.1.92153 WP_003414131.1.92190 WP_003414131.1.92192 WP_003414131.1.92200 WP_003414131.1.92220 WP_003414131.1.92221 WP_003414131.1.92222 WP_003414131.1.92273 WP_003414131.1.92289 WP_003414131.1.9229 WP_003414131.1.92294 WP_003414131.1.92300 WP_003414131.1.92334 WP_003414131.1.92338 WP_003414131.1.92345 WP_003414131.1.92356 WP_003414131.1.92364 WP_003414131.1.92380 WP_003414131.1.92416 WP_003414131.1.92428 WP_003414131.1.92447 WP_003414131.1.92456 WP_003414131.1.92467 WP_003414131.1.92471 WP_003414131.1.92490 WP_003414131.1.92508 WP_003414131.1.9251 WP_003414131.1.92511 WP_003414131.1.92523 WP_003414131.1.92527 WP_003414131.1.92536 WP_003414131.1.92592 WP_003414131.1.92597 WP_003414131.1.92603 WP_003414131.1.92606 WP_003414131.1.92610 WP_003414131.1.92613 WP_003414131.1.9263 WP_003414131.1.9265 WP_003414131.1.92660 WP_003414131.1.92677 WP_003414131.1.92689 WP_003414131.1.92690 WP_003414131.1.92706 WP_003414131.1.92714 WP_003414131.1.92736 WP_003414131.1.9274 WP_003414131.1.92752 WP_003414131.1.92760 WP_003414131.1.92803 WP_003414131.1.92833 WP_003414131.1.92856 WP_003414131.1.92881 WP_003414131.1.92892 WP_003414131.1.92907 WP_003414131.1.92908 WP_003414131.1.9291 WP_003414131.1.92917 WP_003414131.1.92996 WP_003414131.1.93006 WP_003414131.1.93008 WP_003414131.1.93009 WP_003414131.1.93015 WP_003414131.1.93043 WP_003414131.1.9307 WP_003414131.1.93083 WP_003414131.1.93097 WP_003414131.1.93137 WP_003414131.1.93192 WP_003414131.1.93199 WP_003414131.1.93203 WP_003414131.1.93212 WP_003414131.1.93234 WP_003414131.1.93245 WP_003414131.1.93257 WP_003414131.1.93265 WP_003414131.1.93297 WP_003414131.1.93320 WP_003414131.1.93328 WP_003414131.1.93337 WP_003414131.1.93343 WP_003414131.1.93349 WP_003414131.1.93377 WP_003414131.1.9338 WP_003414131.1.93407 WP_003414131.1.93417 WP_003414131.1.93419 WP_003414131.1.93426 WP_003414131.1.9344 WP_003414131.1.93443 WP_003414131.1.93447 WP_003414131.1.93470 WP_003414131.1.93483 WP_003414131.1.93487 WP_003414131.1.93495 WP_003414131.1.93499 WP_003414131.1.93516 WP_003414131.1.93544 WP_003414131.1.93555 WP_003414131.1.93560 WP_003414131.1.93564 WP_003414131.1.9357 WP_003414131.1.93573 WP_003414131.1.93576 WP_003414131.1.93588 WP_003414131.1.9363 WP_003414131.1.93645 WP_003414131.1.93649 WP_003414131.1.93659 WP_003414131.1.93677 WP_003414131.1.9368 WP_003414131.1.93689 WP_003414131.1.93693 WP_003414131.1.93698 WP_003414131.1.93706 WP_003414131.1.9371 WP_003414131.1.93792 WP_003414131.1.93823 WP_003414131.1.93871 WP_003414131.1.9388 WP_003414131.1.93894 WP_003414131.1.93903 WP_003414131.1.93907 WP_003414131.1.93913 WP_003414131.1.93946 WP_003414131.1.93950 WP_003414131.1.93953 WP_003414131.1.93954 WP_003414131.1.93988 WP_003414131.1.9407 WP_003414131.1.94143 WP_003414131.1.94154 WP_003414131.1.94184 WP_003414131.1.94204 WP_003414131.1.94205 WP_003414131.1.94226 WP_003414131.1.94231 WP_003414131.1.94256 WP_003414131.1.94261 WP_003414131.1.94281 WP_003414131.1.94292 WP_003414131.1.94297 WP_003414131.1.9431 WP_003414131.1.94326 WP_003414131.1.94339 WP_003414131.1.94416 WP_003414131.1.94421 WP_003414131.1.94456 WP_003414131.1.94470 WP_003414131.1.94480 WP_003414131.1.94495 WP_003414131.1.94511 WP_003414131.1.94512 WP_003414131.1.94525 WP_003414131.1.94528 WP_003414131.1.94564 WP_003414131.1.946 WP_003414131.1.94602 WP_003414131.1.94623 WP_003414131.1.94629 WP_003414131.1.9465 WP_003414131.1.94673 WP_003414131.1.94714 WP_003414131.1.94730 WP_003414131.1.94736 WP_003414131.1.94776 WP_003414131.1.9478 WP_003414131.1.94834 WP_003414131.1.94852 WP_003414131.1.94872 WP_003414131.1.9488 WP_003414131.1.94916 WP_003414131.1.94979 WP_003414131.1.94994 WP_003414131.1.94996 WP_003414131.1.94998 WP_003414131.1.95007 WP_003414131.1.95010 WP_003414131.1.95015 WP_003414131.1.95034 WP_003414131.1.95068 WP_003414131.1.95081 WP_003414131.1.95082 WP_003414131.1.9509 WP_003414131.1.95096 WP_003414131.1.95112 WP_003414131.1.95138 WP_003414131.1.95179 WP_003414131.1.95188 WP_003414131.1.95190 WP_003414131.1.95234 WP_003414131.1.95241 WP_003414131.1.95245 WP_003414131.1.95257 WP_003414131.1.95279 WP_003414131.1.9531 WP_003414131.1.95335 WP_003414131.1.95344 WP_003414131.1.9535 WP_003414131.1.95370 WP_003414131.1.95392 WP_003414131.1.95416 WP_003414131.1.95417 WP_003414131.1.95454 WP_003414131.1.95455 WP_003414131.1.95491 WP_003414131.1.95497 WP_003414131.1.95508 WP_003414131.1.95509 WP_003414131.1.95529 WP_003414131.1.95556 WP_003414131.1.95557 WP_003414131.1.95578 WP_003414131.1.95580 WP_003414131.1.95585 WP_003414131.1.95643 WP_003414131.1.95679 WP_003414131.1.95685 WP_003414131.1.957 WP_003414131.1.95727 WP_003414131.1.95730 WP_003414131.1.95735 WP_003414131.1.95758 WP_003414131.1.95772 WP_003414131.1.95797 WP_003414131.1.9585 WP_003414131.1.9590 WP_003414131.1.95902 WP_003414131.1.95908 WP_003414131.1.95924 WP_003414131.1.95926 WP_003414131.1.95953 WP_003414131.1.95958 WP_003414131.1.95973 WP_003414131.1.96006 WP_003414131.1.9602 WP_003414131.1.96036 WP_003414131.1.96062 WP_003414131.1.96065 WP_003414131.1.96098 WP_003414131.1.96146 WP_003414131.1.96166 WP_003414131.1.96171 WP_003414131.1.96182 WP_003414131.1.96204 WP_003414131.1.96230 WP_003414131.1.96235 WP_003414131.1.96242 WP_003414131.1.96245 WP_003414131.1.96259 WP_003414131.1.96286 WP_003414131.1.96313 WP_003414131.1.96318 WP_003414131.1.96345 WP_003414131.1.96360 WP_003414131.1.96373 WP_003414131.1.96456 WP_003414131.1.96486 WP_003414131.1.96569 WP_003414131.1.96573 WP_003414131.1.96575 WP_003414131.1.96576 WP_003414131.1.96611 WP_003414131.1.96621 WP_003414131.1.9667 WP_003414131.1.96681 WP_003414131.1.96726 WP_003414131.1.96733 WP_003414131.1.96742 WP_003414131.1.96754 WP_003414131.1.9685 WP_003414131.1.97008 WP_003414131.1.97009 WP_003414131.1.97056 WP_003414131.1.97084 WP_003414131.1.97087 WP_003414131.1.97094 WP_003414131.1.97096 WP_003414131.1.97099 WP_003414131.1.97108 WP_003414131.1.97113 WP_003414131.1.97122 WP_003414131.1.97127 WP_003414131.1.97129 WP_003414131.1.97136 WP_003414131.1.9716 WP_003414131.1.97176 WP_003414131.1.97222 WP_003414131.1.97223 WP_003414131.1.97237 WP_003414131.1.97242 WP_003414131.1.97270 WP_003414131.1.97283 WP_003414131.1.97296 WP_003414131.1.97321 WP_003414131.1.97325 WP_003414131.1.97330 WP_003414131.1.97366 WP_003414131.1.97376 WP_003414131.1.97380 WP_003414131.1.9739 WP_003414131.1.97462 WP_003414131.1.97517 WP_003414131.1.97519 WP_003414131.1.97540 WP_003414131.1.97545 WP_003414131.1.97546 WP_003414131.1.97550 WP_003414131.1.97568 WP_003414131.1.97577 WP_003414131.1.97584 WP_003414131.1.9759 WP_003414131.1.97591 WP_003414131.1.97596 WP_003414131.1.97609 WP_003414131.1.9763 WP_003414131.1.97669 WP_003414131.1.97673 WP_003414131.1.97700 WP_003414131.1.97701 WP_003414131.1.9773 WP_003414131.1.97730 WP_003414131.1.97740 WP_003414131.1.97751 WP_003414131.1.97754 WP_003414131.1.97797 WP_003414131.1.9782 WP_003414131.1.9784 WP_003414131.1.97888 WP_003414131.1.9790 WP_003414131.1.9795 WP_003414131.1.97958 WP_003414131.1.97966 WP_003414131.1.97977 WP_003414131.1.97979 WP_003414131.1.97995 WP_003414131.1.98018 WP_003414131.1.98034 WP_003414131.1.98052 WP_003414131.1.98071 WP_003414131.1.98072 WP_003414131.1.98113 WP_003414131.1.98114 WP_003414131.1.98128 WP_003414131.1.98181 WP_003414131.1.98188 WP_003414131.1.98189 WP_003414131.1.98213 WP_003414131.1.98225 WP_003414131.1.98291 WP_003414131.1.98335 WP_003414131.1.98350 WP_003414131.1.98395 WP_003414131.1.98412 WP_003414131.1.98441 WP_003414131.1.98443 WP_003414131.1.98462 WP_003414131.1.9848 WP_003414131.1.98482 WP_003414131.1.98486 WP_003414131.1.98488 WP_003414131.1.98503 WP_003414131.1.98516 WP_003414131.1.98524 WP_003414131.1.98536 WP_003414131.1.98541 WP_003414131.1.98566 WP_003414131.1.98576 WP_003414131.1.98590 WP_003414131.1.98594 WP_003414131.1.98599 WP_003414131.1.98629 WP_003414131.1.98645 WP_003414131.1.98646 WP_003414131.1.98649 WP_003414131.1.98656 WP_003414131.1.9867 WP_003414131.1.98674 WP_003414131.1.98697 WP_003414131.1.98701 WP_003414131.1.98739 WP_003414131.1.98749 WP_003414131.1.98765 WP_003414131.1.98777 WP_003414131.1.98778 WP_003414131.1.98802 WP_003414131.1.98838 WP_003414131.1.98850 WP_003414131.1.98906 WP_003414131.1.98935 WP_003414131.1.98948 WP_003414131.1.98953 WP_003414131.1.98984 WP_003414131.1.99000 WP_003414131.1.99023 WP_003414131.1.99030 WP_003414131.1.99037 WP_003414131.1.99055 WP_003414131.1.99062 WP_003414131.1.99086 WP_003414131.1.99115 WP_003414131.1.99117 WP_003414131.1.99161 WP_003414131.1.99176 WP_003414131.1.99205 WP_003414131.1.99211 WP_003414131.1.99216 WP_003414131.1.99222 WP_003414131.1.99251 WP_003414131.1.99269 WP_003414131.1.99294 WP_003414131.1.99312 WP_003414131.1.99315 WP_003414131.1.99316 WP_003414131.1.99322 WP_003414131.1.99328 WP_003414131.1.99365 WP_003414131.1.99368 WP_003414131.1.99379 WP_003414131.1.99396 WP_003414131.1.99402 WP_003414131.1.99404 WP_003414131.1.99419 WP_003414131.1.99438 WP_003414131.1.99460 WP_003414131.1.99468 WP_003414131.1.99473 WP_003414131.1.99529 WP_003414131.1.99548 WP_003414131.1.99572 WP_003414131.1.99575 WP_003414131.1.99578 WP_003414131.1.99605 WP_003414131.1.99617 WP_003414131.1.99635 WP_003414131.1.99650 WP_003414131.1.99672 WP_003414131.1.99701 WP_003414131.1.99711 WP_003414131.1.99716 WP_003414131.1.99740 WP_003414131.1.99745 WP_003414131.1.99749 WP_003414131.1.9976 WP_003414131.1.99798 WP_003414131.1.99817 WP_003414131.1.99832 WP_003414131.1.99847 WP_003414131.1.99852 WP_003414131.1.99886 WP_003414131.1.99899 WP_003414131.1.99915 WP_003414131.1.9993 WP_003414131.1.99982 WP_003414131.1.99991 gi|494701219|ref|YP_007966701.1| gi|479315742|ref|YP_007855794.1| gi|385999567|ref|YP_005917866.1| gi|197738428|ref|YP_002159743.1| gi|224991158|ref|YP_002645847.1| gi|479056750|ref|YP_007352556.1| gi|392387418|ref|YP_005309047.1| gi|15609923|ref|NP_217302.1| gi|525675307|ref|YP_008226880.1| gi|148662628|ref|YP_001284151.1| gi|392431606|ref|YP_006472650.1| gi|449064858|ref|YP_007431941.1| gi|31793962|ref|NP_856455.1| gi|383308543|ref|YP_005361354.1| gi|433635846|ref|YP_007269473.1| gi|15842324|ref|NP_337361.1| gi|339632797|ref|YP_004724439.1| gi|148823974|ref|YP_001288728.1| 233413.Mb2809c 336982.TBFG_12799 410289.BCG_2804c 419947.MRA_2810 478434.TBMG_01188 561275.JTY_2798 83331.MT2856 83332.Rv2786c gi|375295398|ref|YP_005099665.1| gi|378772521|ref|YP_005172254.1| gi|15609923|ref|NP_217302.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]