SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I6X5H3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I6X5H3
Domain Number 1 Region: 5-244
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.74e-81
Family ABC transporter ATPase domain-like 0.000000278
Further Details:      
 
Domain Number 2 Region: 239-359
Classification Level Classification E-value
Superfamily MOP-like 7.29e-17
Family ABC-transporter additional domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I6X5H3
Sequence length 360
Comment (tr|I6X5H3|I6X5H3_MYCTU) Probable Sn-glycerol-3-phosphate transport ATP-binding protein ABC transporter UgpC {ECO:0000313|EMBL:CCP45633.1} KW=Complete proteome; Reference proteome OX=83332 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv). GN=Rv2832c OC=Mycobacterium; Mycobacterium tuberculosis complex.
Sequence
MANVQYSAVTQRYPGADAPTVDNLDLDIADGEFLVLVGPSGCGKSTTLRVLAGLEPIESG
RISIGDVDVTHLPPRARDVAMVFQNYALYPNMTVAANMGFALRNAGMSRADTRRRVLEVA
DMLELTDLLDRKPAKLSGGQRQRVAMGRAIVRRPRVFCMDEPLSNLDAKLRVSTRSQISG
LQRRLGTTTVYVTHDQVEAMTMGDRVAVLKDGVLQQVDTPRALYDDPVNTFVATFIGAPA
MNLIDAAVAHGVVRAPDLAIPVPDPAAERVLVGVRPESWDVASIGTPGSLTVHVELVEEL
GFESFVYATPVDQRGWSSRAPRIVFRTDRRTAVRVGESLAIVPHSQEVRLFNSRTETRLR
Download sequence
Identical sequences A0A045JEJ5 A0A083VWV4 A0A089QPL9 A0A0H3LCZ5 A0A109SZG0 A0A120IXZ4 A0A197IYX5 A0A1R3Y349 A0A1S1B6P5 A5U6I4 F8M458 I6X5H3 M8D339 P71620 R4MAB8
gi|385992095|ref|YP_005910393.1| gi|15609969|ref|NP_217348.1| gi|148662673|ref|YP_001284196.1| gi|197738470|ref|YP_002159785.1| MytuD.01568.a gi|506927373|ref|YP_008007823.1| gi|15609969|ref|NP_217348.1| gi|15842373|ref|NP_337410.1| gi|31794008|ref|NP_856501.1| gi|392387461|ref|YP_005309090.1| gi|148824022|ref|YP_001288776.1| 233413.Mb2856c 336982.TBFG_12847 419947.MRA_2855 478434.TBMG_01140 83331.MT2898 83332.Rv2832c gi|494693298|ref|YP_007958841.1| gi|253798082|ref|YP_003031083.1| gi|506927373|ref|YP_008007823.1| gi|525675347|ref|YP_008226927.1| gi|375295350|ref|YP_005099617.1| gi|339632841|ref|YP_004724483.1| gi|385999617|ref|YP_005917916.1| gi|479315789|ref|YP_007855841.1| gi|479056795|ref|YP_007352601.1| gi|471338849|ref|YP_007611562.1| NP_217348.1.84033 WP_003414499.1.100021 WP_003414499.1.100069 WP_003414499.1.100087 WP_003414499.1.10015 WP_003414499.1.100208 WP_003414499.1.100216 WP_003414499.1.10022 WP_003414499.1.100255 WP_003414499.1.100260 WP_003414499.1.100270 WP_003414499.1.100279 WP_003414499.1.100286 WP_003414499.1.100308 WP_003414499.1.100309 WP_003414499.1.100318 WP_003414499.1.100337 WP_003414499.1.10037 WP_003414499.1.100383 WP_003414499.1.100395 WP_003414499.1.100396 WP_003414499.1.1004 WP_003414499.1.100401 WP_003414499.1.100459 WP_003414499.1.100460 WP_003414499.1.100552 WP_003414499.1.100581 WP_003414499.1.100600 WP_003414499.1.100625 WP_003414499.1.10064 WP_003414499.1.100666 WP_003414499.1.100671 WP_003414499.1.100677 WP_003414499.1.100682 WP_003414499.1.100697 WP_003414499.1.100703 WP_003414499.1.100716 WP_003414499.1.100722 WP_003414499.1.100754 WP_003414499.1.100757 WP_003414499.1.100772 WP_003414499.1.1008 WP_003414499.1.100812 WP_003414499.1.100845 WP_003414499.1.100866 WP_003414499.1.10088 WP_003414499.1.100889 WP_003414499.1.10090 WP_003414499.1.100910 WP_003414499.1.100915 WP_003414499.1.100918 WP_003414499.1.100935 WP_003414499.1.100984 WP_003414499.1.100998 WP_003414499.1.101 WP_003414499.1.101025 WP_003414499.1.10104 WP_003414499.1.101048 WP_003414499.1.101054 WP_003414499.1.101075 WP_003414499.1.101143 WP_003414499.1.101146 WP_003414499.1.10116 WP_003414499.1.10117 WP_003414499.1.101209 WP_003414499.1.101290 WP_003414499.1.101323 WP_003414499.1.101324 WP_003414499.1.101350 WP_003414499.1.101403 WP_003414499.1.101421 WP_003414499.1.10144 WP_003414499.1.101442 WP_003414499.1.10145 WP_003414499.1.101452 WP_003414499.1.101456 WP_003414499.1.101481 WP_003414499.1.101493 WP_003414499.1.101496 WP_003414499.1.101525 WP_003414499.1.101533 WP_003414499.1.101535 WP_003414499.1.101553 WP_003414499.1.101558 WP_003414499.1.10156 WP_003414499.1.101573 WP_003414499.1.101576 WP_003414499.1.10159 WP_003414499.1.101592 WP_003414499.1.101604 WP_003414499.1.101607 WP_003414499.1.101622 WP_003414499.1.101644 WP_003414499.1.101671 WP_003414499.1.101687 WP_003414499.1.101698 WP_003414499.1.10170 WP_003414499.1.101713 WP_003414499.1.101722 WP_003414499.1.101733 WP_003414499.1.101743 WP_003414499.1.101753 WP_003414499.1.101754 WP_003414499.1.101764 WP_003414499.1.101773 WP_003414499.1.101795 WP_003414499.1.101797 WP_003414499.1.101798 WP_003414499.1.101802 WP_003414499.1.101826 WP_003414499.1.101836 WP_003414499.1.101858 WP_003414499.1.101859 WP_003414499.1.101862 WP_003414499.1.101888 WP_003414499.1.101894 WP_003414499.1.101899 WP_003414499.1.101923 WP_003414499.1.101925 WP_003414499.1.10193 WP_003414499.1.101996 WP_003414499.1.102 WP_003414499.1.102008 WP_003414499.1.102017 WP_003414499.1.102053 WP_003414499.1.102055 WP_003414499.1.102063 WP_003414499.1.102099 WP_003414499.1.1021 WP_003414499.1.10211 WP_003414499.1.102119 WP_003414499.1.102121 WP_003414499.1.102143 WP_003414499.1.10216 WP_003414499.1.10224 WP_003414499.1.10253 WP_003414499.1.10262 WP_003414499.1.10272 WP_003414499.1.10277 WP_003414499.1.1033 WP_003414499.1.10350 WP_003414499.1.10362 WP_003414499.1.10366 WP_003414499.1.10376 WP_003414499.1.10396 WP_003414499.1.10410 WP_003414499.1.10421 WP_003414499.1.10430 WP_003414499.1.1044 WP_003414499.1.10440 WP_003414499.1.10445 WP_003414499.1.10471 WP_003414499.1.10472 WP_003414499.1.105 WP_003414499.1.10518 WP_003414499.1.10523 WP_003414499.1.10545 WP_003414499.1.1057 WP_003414499.1.10594 WP_003414499.1.10603 WP_003414499.1.10606 WP_003414499.1.10615 WP_003414499.1.10623 WP_003414499.1.10635 WP_003414499.1.10643 WP_003414499.1.10648 WP_003414499.1.10662 WP_003414499.1.10735 WP_003414499.1.10740 WP_003414499.1.10756 WP_003414499.1.1078 WP_003414499.1.10791 WP_003414499.1.10799 WP_003414499.1.10825 WP_003414499.1.10848 WP_003414499.1.10863 WP_003414499.1.10879 WP_003414499.1.10927 WP_003414499.1.1095 WP_003414499.1.10956 WP_003414499.1.10962 WP_003414499.1.10980 WP_003414499.1.10981 WP_003414499.1.10993 WP_003414499.1.1100 WP_003414499.1.11040 WP_003414499.1.11061 WP_003414499.1.11070 WP_003414499.1.11141 WP_003414499.1.11171 WP_003414499.1.11175 WP_003414499.1.11176 WP_003414499.1.11222 WP_003414499.1.11236 WP_003414499.1.11329 WP_003414499.1.1133 WP_003414499.1.11342 WP_003414499.1.11373 WP_003414499.1.11376 WP_003414499.1.11390 WP_003414499.1.11402 WP_003414499.1.11481 WP_003414499.1.11487 WP_003414499.1.11489 WP_003414499.1.11491 WP_003414499.1.11514 WP_003414499.1.11589 WP_003414499.1.11596 WP_003414499.1.11604 WP_003414499.1.11610 WP_003414499.1.11697 WP_003414499.1.11707 WP_003414499.1.11752 WP_003414499.1.11758 WP_003414499.1.11761 WP_003414499.1.11775 WP_003414499.1.11804 WP_003414499.1.11822 WP_003414499.1.11826 WP_003414499.1.11856 WP_003414499.1.11898 WP_003414499.1.11906 WP_003414499.1.11939 WP_003414499.1.11960 WP_003414499.1.11961 WP_003414499.1.11972 WP_003414499.1.120 WP_003414499.1.12001 WP_003414499.1.12049 WP_003414499.1.12052 WP_003414499.1.12100 WP_003414499.1.12130 WP_003414499.1.12133 WP_003414499.1.12161 WP_003414499.1.12165 WP_003414499.1.12184 WP_003414499.1.12190 WP_003414499.1.12265 WP_003414499.1.12275 WP_003414499.1.12293 WP_003414499.1.12294 WP_003414499.1.123 WP_003414499.1.1231 WP_003414499.1.12314 WP_003414499.1.12327 WP_003414499.1.12338 WP_003414499.1.1236 WP_003414499.1.12371 WP_003414499.1.12372 WP_003414499.1.12389 WP_003414499.1.12406 WP_003414499.1.1241 WP_003414499.1.12421 WP_003414499.1.12424 WP_003414499.1.12446 WP_003414499.1.12464 WP_003414499.1.12479 WP_003414499.1.12519 WP_003414499.1.12523 WP_003414499.1.12526 WP_003414499.1.1255 WP_003414499.1.12550 WP_003414499.1.12551 WP_003414499.1.12563 WP_003414499.1.12611 WP_003414499.1.12669 WP_003414499.1.1267 WP_003414499.1.12672 WP_003414499.1.12692 WP_003414499.1.1271 WP_003414499.1.12710 WP_003414499.1.12768 WP_003414499.1.1279 WP_003414499.1.12794 WP_003414499.1.12801 WP_003414499.1.12804 WP_003414499.1.12821 WP_003414499.1.12841 WP_003414499.1.12854 WP_003414499.1.12871 WP_003414499.1.12901 WP_003414499.1.12941 WP_003414499.1.12947 WP_003414499.1.12957 WP_003414499.1.12972 WP_003414499.1.13028 WP_003414499.1.13043 WP_003414499.1.13086 WP_003414499.1.13087 WP_003414499.1.13090 WP_003414499.1.13096 WP_003414499.1.13163 WP_003414499.1.13175 WP_003414499.1.13183 WP_003414499.1.132 WP_003414499.1.13249 WP_003414499.1.13282 WP_003414499.1.13284 WP_003414499.1.13296 WP_003414499.1.13298 WP_003414499.1.13302 WP_003414499.1.13306 WP_003414499.1.13312 WP_003414499.1.13313 WP_003414499.1.13321 WP_003414499.1.13345 WP_003414499.1.13358 WP_003414499.1.13370 WP_003414499.1.13375 WP_003414499.1.1338 WP_003414499.1.13420 WP_003414499.1.13433 WP_003414499.1.13435 WP_003414499.1.13438 WP_003414499.1.13461 WP_003414499.1.13466 WP_003414499.1.13489 WP_003414499.1.13526 WP_003414499.1.13551 WP_003414499.1.13561 WP_003414499.1.13564 WP_003414499.1.13579 WP_003414499.1.13647 WP_003414499.1.13697 WP_003414499.1.13719 WP_003414499.1.13763 WP_003414499.1.1377 WP_003414499.1.13774 WP_003414499.1.13786 WP_003414499.1.13793 WP_003414499.1.13794 WP_003414499.1.13817 WP_003414499.1.13834 WP_003414499.1.13866 WP_003414499.1.13880 WP_003414499.1.13899 WP_003414499.1.13909 WP_003414499.1.13910 WP_003414499.1.13919 WP_003414499.1.13920 WP_003414499.1.13952 WP_003414499.1.13953 WP_003414499.1.13962 WP_003414499.1.1398 WP_003414499.1.13988 WP_003414499.1.14027 WP_003414499.1.14046 WP_003414499.1.14115 WP_003414499.1.1415 WP_003414499.1.14152 WP_003414499.1.14158 WP_003414499.1.14162 WP_003414499.1.14175 WP_003414499.1.14178 WP_003414499.1.14194 WP_003414499.1.14195 WP_003414499.1.14208 WP_003414499.1.14238 WP_003414499.1.14266 WP_003414499.1.14273 WP_003414499.1.14303 WP_003414499.1.14306 WP_003414499.1.14307 WP_003414499.1.14310 WP_003414499.1.14341 WP_003414499.1.14382 WP_003414499.1.14428 WP_003414499.1.14441 WP_003414499.1.14477 WP_003414499.1.14504 WP_003414499.1.14514 WP_003414499.1.1452 WP_003414499.1.14527 WP_003414499.1.1454 WP_003414499.1.14544 WP_003414499.1.14548 WP_003414499.1.14551 WP_003414499.1.14561 WP_003414499.1.14573 WP_003414499.1.1462 WP_003414499.1.14667 WP_003414499.1.14668 WP_003414499.1.14675 WP_003414499.1.14694 WP_003414499.1.14695 WP_003414499.1.14709 WP_003414499.1.14766 WP_003414499.1.14783 WP_003414499.1.14872 WP_003414499.1.14905 WP_003414499.1.14926 WP_003414499.1.14951 WP_003414499.1.14955 WP_003414499.1.15003 WP_003414499.1.15009 WP_003414499.1.15028 WP_003414499.1.15040 WP_003414499.1.15052 WP_003414499.1.15065 WP_003414499.1.15072 WP_003414499.1.15089 WP_003414499.1.1509 WP_003414499.1.15126 WP_003414499.1.15131 WP_003414499.1.15168 WP_003414499.1.15172 WP_003414499.1.15174 WP_003414499.1.15187 WP_003414499.1.15196 WP_003414499.1.15210 WP_003414499.1.15216 WP_003414499.1.15217 WP_003414499.1.1523 WP_003414499.1.15232 WP_003414499.1.15238 WP_003414499.1.15240 WP_003414499.1.15253 WP_003414499.1.15267 WP_003414499.1.15292 WP_003414499.1.15299 WP_003414499.1.15302 WP_003414499.1.15322 WP_003414499.1.1534 WP_003414499.1.15345 WP_003414499.1.15365 WP_003414499.1.15372 WP_003414499.1.15386 WP_003414499.1.15387 WP_003414499.1.15442 WP_003414499.1.15447 WP_003414499.1.15449 WP_003414499.1.15477 WP_003414499.1.15481 WP_003414499.1.15492 WP_003414499.1.15511 WP_003414499.1.15512 WP_003414499.1.15558 WP_003414499.1.15559 WP_003414499.1.15566 WP_003414499.1.15599 WP_003414499.1.1560 WP_003414499.1.15611 WP_003414499.1.1563 WP_003414499.1.15633 WP_003414499.1.15643 WP_003414499.1.15688 WP_003414499.1.15755 WP_003414499.1.15763 WP_003414499.1.15774 WP_003414499.1.1578 WP_003414499.1.15780 WP_003414499.1.15827 WP_003414499.1.15834 WP_003414499.1.15842 WP_003414499.1.15853 WP_003414499.1.15870 WP_003414499.1.15877 WP_003414499.1.15893 WP_003414499.1.15896 WP_003414499.1.15926 WP_003414499.1.15933 WP_003414499.1.15946 WP_003414499.1.15958 WP_003414499.1.15973 WP_003414499.1.15987 WP_003414499.1.15993 WP_003414499.1.16009 WP_003414499.1.16025 WP_003414499.1.16043 WP_003414499.1.16055 WP_003414499.1.16066 WP_003414499.1.16069 WP_003414499.1.16077 WP_003414499.1.16106 WP_003414499.1.16108 WP_003414499.1.16110 WP_003414499.1.16130 WP_003414499.1.16136 WP_003414499.1.16139 WP_003414499.1.16141 WP_003414499.1.16143 WP_003414499.1.1630 WP_003414499.1.16318 WP_003414499.1.1632 WP_003414499.1.16327 WP_003414499.1.16334 WP_003414499.1.16341 WP_003414499.1.16345 WP_003414499.1.16374 WP_003414499.1.16386 WP_003414499.1.164 WP_003414499.1.1642 WP_003414499.1.16424 WP_003414499.1.16431 WP_003414499.1.16438 WP_003414499.1.1644 WP_003414499.1.16442 WP_003414499.1.16448 WP_003414499.1.16476 WP_003414499.1.16480 WP_003414499.1.16494 WP_003414499.1.1652 WP_003414499.1.16549 WP_003414499.1.16560 WP_003414499.1.16598 WP_003414499.1.16609 WP_003414499.1.16619 WP_003414499.1.16620 WP_003414499.1.16622 WP_003414499.1.16637 WP_003414499.1.1669 WP_003414499.1.16707 WP_003414499.1.16724 WP_003414499.1.16731 WP_003414499.1.16743 WP_003414499.1.1683 WP_003414499.1.16837 WP_003414499.1.16852 WP_003414499.1.16937 WP_003414499.1.16940 WP_003414499.1.16959 WP_003414499.1.16968 WP_003414499.1.1697 WP_003414499.1.16977 WP_003414499.1.16987 WP_003414499.1.17005 WP_003414499.1.17006 WP_003414499.1.17010 WP_003414499.1.17015 WP_003414499.1.17019 WP_003414499.1.17039 WP_003414499.1.17041 WP_003414499.1.17052 WP_003414499.1.17057 WP_003414499.1.17062 WP_003414499.1.1707 WP_003414499.1.17094 WP_003414499.1.17130 WP_003414499.1.17147 WP_003414499.1.17167 WP_003414499.1.17224 WP_003414499.1.17251 WP_003414499.1.17288 WP_003414499.1.17314 WP_003414499.1.17345 WP_003414499.1.17381 WP_003414499.1.17391 WP_003414499.1.17412 WP_003414499.1.1743 WP_003414499.1.17440 WP_003414499.1.17466 WP_003414499.1.17477 WP_003414499.1.17483 WP_003414499.1.17505 WP_003414499.1.17527 WP_003414499.1.17535 WP_003414499.1.17540 WP_003414499.1.17553 WP_003414499.1.17558 WP_003414499.1.17599 WP_003414499.1.17635 WP_003414499.1.17655 WP_003414499.1.17679 WP_003414499.1.1768 WP_003414499.1.17687 WP_003414499.1.17700 WP_003414499.1.17710 WP_003414499.1.17713 WP_003414499.1.17746 WP_003414499.1.17788 WP_003414499.1.17798 WP_003414499.1.17803 WP_003414499.1.17816 WP_003414499.1.17821 WP_003414499.1.17830 WP_003414499.1.17868 WP_003414499.1.17878 WP_003414499.1.1792 WP_003414499.1.17923 WP_003414499.1.1795 WP_003414499.1.17955 WP_003414499.1.17973 WP_003414499.1.18013 WP_003414499.1.18033 WP_003414499.1.18057 WP_003414499.1.18065 WP_003414499.1.18070 WP_003414499.1.18116 WP_003414499.1.18120 WP_003414499.1.18126 WP_003414499.1.1817 WP_003414499.1.18170 WP_003414499.1.18206 WP_003414499.1.18216 WP_003414499.1.18240 WP_003414499.1.18257 WP_003414499.1.18297 WP_003414499.1.18306 WP_003414499.1.18364 WP_003414499.1.18399 WP_003414499.1.18411 WP_003414499.1.18444 WP_003414499.1.18448 WP_003414499.1.18467 WP_003414499.1.18476 WP_003414499.1.18522 WP_003414499.1.18580 WP_003414499.1.18582 WP_003414499.1.18587 WP_003414499.1.186 WP_003414499.1.18601 WP_003414499.1.18639 WP_003414499.1.18646 WP_003414499.1.1868 WP_003414499.1.18694 WP_003414499.1.18710 WP_003414499.1.18751 WP_003414499.1.18781 WP_003414499.1.18793 WP_003414499.1.18804 WP_003414499.1.18816 WP_003414499.1.18823 WP_003414499.1.18827 WP_003414499.1.18838 WP_003414499.1.18849 WP_003414499.1.18856 WP_003414499.1.18945 WP_003414499.1.1898 WP_003414499.1.19056 WP_003414499.1.19063 WP_003414499.1.19066 WP_003414499.1.19085 WP_003414499.1.19094 WP_003414499.1.19144 WP_003414499.1.19159 WP_003414499.1.19193 WP_003414499.1.19231 WP_003414499.1.19243 WP_003414499.1.19264 WP_003414499.1.19295 WP_003414499.1.19307 WP_003414499.1.19326 WP_003414499.1.1933 WP_003414499.1.19364 WP_003414499.1.19382 WP_003414499.1.19400 WP_003414499.1.19426 WP_003414499.1.19429 WP_003414499.1.19464 WP_003414499.1.19480 WP_003414499.1.19512 WP_003414499.1.19553 WP_003414499.1.19562 WP_003414499.1.19564 WP_003414499.1.19568 WP_003414499.1.19572 WP_003414499.1.19595 WP_003414499.1.19600 WP_003414499.1.19630 WP_003414499.1.1967 WP_003414499.1.19694 WP_003414499.1.1970 WP_003414499.1.19707 WP_003414499.1.19742 WP_003414499.1.19785 WP_003414499.1.19820 WP_003414499.1.19868 WP_003414499.1.19890 WP_003414499.1.19900 WP_003414499.1.19936 WP_003414499.1.19946 WP_003414499.1.19949 WP_003414499.1.19960 WP_003414499.1.19964 WP_003414499.1.20007 WP_003414499.1.20016 WP_003414499.1.20028 WP_003414499.1.2003 WP_003414499.1.20037 WP_003414499.1.20039 WP_003414499.1.20082 WP_003414499.1.20085 WP_003414499.1.20097 WP_003414499.1.20116 WP_003414499.1.20130 WP_003414499.1.20141 WP_003414499.1.20142 WP_003414499.1.20158 WP_003414499.1.20239 WP_003414499.1.20243 WP_003414499.1.20259 WP_003414499.1.20262 WP_003414499.1.20268 WP_003414499.1.20272 WP_003414499.1.20273 WP_003414499.1.20280 WP_003414499.1.20294 WP_003414499.1.20300 WP_003414499.1.20309 WP_003414499.1.20322 WP_003414499.1.2037 WP_003414499.1.20372 WP_003414499.1.20381 WP_003414499.1.204 WP_003414499.1.20427 WP_003414499.1.20432 WP_003414499.1.20457 WP_003414499.1.20459 WP_003414499.1.20460 WP_003414499.1.20542 WP_003414499.1.20578 WP_003414499.1.20608 WP_003414499.1.20624 WP_003414499.1.20628 WP_003414499.1.2066 WP_003414499.1.20707 WP_003414499.1.20722 WP_003414499.1.20729 WP_003414499.1.20742 WP_003414499.1.20751 WP_003414499.1.20776 WP_003414499.1.20843 WP_003414499.1.20850 WP_003414499.1.2086 WP_003414499.1.20868 WP_003414499.1.20876 WP_003414499.1.20897 WP_003414499.1.20898 WP_003414499.1.2090 WP_003414499.1.20911 WP_003414499.1.20916 WP_003414499.1.20921 WP_003414499.1.20926 WP_003414499.1.20927 WP_003414499.1.20951 WP_003414499.1.20970 WP_003414499.1.2104 WP_003414499.1.21070 WP_003414499.1.21127 WP_003414499.1.21135 WP_003414499.1.21173 WP_003414499.1.21187 WP_003414499.1.212 WP_003414499.1.21218 WP_003414499.1.21219 WP_003414499.1.2123 WP_003414499.1.21231 WP_003414499.1.21234 WP_003414499.1.2126 WP_003414499.1.21292 WP_003414499.1.21307 WP_003414499.1.2131 WP_003414499.1.21311 WP_003414499.1.21321 WP_003414499.1.21365 WP_003414499.1.2137 WP_003414499.1.21392 WP_003414499.1.21397 WP_003414499.1.21403 WP_003414499.1.21415 WP_003414499.1.21418 WP_003414499.1.21430 WP_003414499.1.21444 WP_003414499.1.21468 WP_003414499.1.21498 WP_003414499.1.21509 WP_003414499.1.21513 WP_003414499.1.21560 WP_003414499.1.21565 WP_003414499.1.21586 WP_003414499.1.21591 WP_003414499.1.21594 WP_003414499.1.21602 WP_003414499.1.21615 WP_003414499.1.21638 WP_003414499.1.21639 WP_003414499.1.21655 WP_003414499.1.21658 WP_003414499.1.2168 WP_003414499.1.2174 WP_003414499.1.21741 WP_003414499.1.21742 WP_003414499.1.21777 WP_003414499.1.21786 WP_003414499.1.21795 WP_003414499.1.218 WP_003414499.1.21826 WP_003414499.1.21829 WP_003414499.1.21840 WP_003414499.1.21843 WP_003414499.1.21872 WP_003414499.1.21873 WP_003414499.1.2188 WP_003414499.1.21882 WP_003414499.1.21906 WP_003414499.1.21912 WP_003414499.1.2194 WP_003414499.1.21941 WP_003414499.1.21956 WP_003414499.1.21958 WP_003414499.1.21960 WP_003414499.1.21971 WP_003414499.1.21973 WP_003414499.1.21983 WP_003414499.1.22003 WP_003414499.1.22013 WP_003414499.1.22025 WP_003414499.1.22036 WP_003414499.1.22075 WP_003414499.1.22092 WP_003414499.1.2212 WP_003414499.1.22127 WP_003414499.1.22140 WP_003414499.1.22233 WP_003414499.1.22255 WP_003414499.1.22277 WP_003414499.1.22305 WP_003414499.1.22348 WP_003414499.1.22366 WP_003414499.1.2238 WP_003414499.1.22380 WP_003414499.1.22437 WP_003414499.1.22438 WP_003414499.1.22490 WP_003414499.1.22511 WP_003414499.1.22524 WP_003414499.1.2253 WP_003414499.1.22585 WP_003414499.1.22608 WP_003414499.1.22609 WP_003414499.1.22618 WP_003414499.1.2262 WP_003414499.1.22624 WP_003414499.1.22629 WP_003414499.1.22647 WP_003414499.1.22664 WP_003414499.1.22665 WP_003414499.1.22670 WP_003414499.1.22674 WP_003414499.1.22680 WP_003414499.1.22725 WP_003414499.1.22728 WP_003414499.1.22733 WP_003414499.1.22754 WP_003414499.1.22797 WP_003414499.1.22800 WP_003414499.1.22804 WP_003414499.1.22829 WP_003414499.1.22840 WP_003414499.1.22844 WP_003414499.1.22963 WP_003414499.1.22970 WP_003414499.1.22996 WP_003414499.1.22997 WP_003414499.1.22999 WP_003414499.1.23015 WP_003414499.1.23032 WP_003414499.1.231 WP_003414499.1.23101 WP_003414499.1.2312 WP_003414499.1.23140 WP_003414499.1.23153 WP_003414499.1.23171 WP_003414499.1.23199 WP_003414499.1.2320 WP_003414499.1.23204 WP_003414499.1.23216 WP_003414499.1.23229 WP_003414499.1.23233 WP_003414499.1.2326 WP_003414499.1.23261 WP_003414499.1.23272 WP_003414499.1.23289 WP_003414499.1.2329 WP_003414499.1.23308 WP_003414499.1.23316 WP_003414499.1.23321 WP_003414499.1.23325 WP_003414499.1.2339 WP_003414499.1.23406 WP_003414499.1.23438 WP_003414499.1.23445 WP_003414499.1.23447 WP_003414499.1.23452 WP_003414499.1.23461 WP_003414499.1.2349 WP_003414499.1.23496 WP_003414499.1.23506 WP_003414499.1.23530 WP_003414499.1.23539 WP_003414499.1.23546 WP_003414499.1.23551 WP_003414499.1.23573 WP_003414499.1.23583 WP_003414499.1.23588 WP_003414499.1.23628 WP_003414499.1.23677 WP_003414499.1.23683 WP_003414499.1.23692 WP_003414499.1.23694 WP_003414499.1.23699 WP_003414499.1.2371 WP_003414499.1.23803 WP_003414499.1.23807 WP_003414499.1.23825 WP_003414499.1.23832 WP_003414499.1.2384 WP_003414499.1.23843 WP_003414499.1.23863 WP_003414499.1.2387 WP_003414499.1.23894 WP_003414499.1.23993 WP_003414499.1.2400 WP_003414499.1.24007 WP_003414499.1.24008 WP_003414499.1.24046 WP_003414499.1.24057 WP_003414499.1.24062 WP_003414499.1.24113 WP_003414499.1.24119 WP_003414499.1.24128 WP_003414499.1.24140 WP_003414499.1.24176 WP_003414499.1.24190 WP_003414499.1.24202 WP_003414499.1.24244 WP_003414499.1.24261 WP_003414499.1.24284 WP_003414499.1.24294 WP_003414499.1.24357 WP_003414499.1.24396 WP_003414499.1.24414 WP_003414499.1.24423 WP_003414499.1.2443 WP_003414499.1.24446 WP_003414499.1.24461 WP_003414499.1.24500 WP_003414499.1.24507 WP_003414499.1.24509 WP_003414499.1.24529 WP_003414499.1.24553 WP_003414499.1.24629 WP_003414499.1.24638 WP_003414499.1.24648 WP_003414499.1.2466 WP_003414499.1.24767 WP_003414499.1.24824 WP_003414499.1.24831 WP_003414499.1.24840 WP_003414499.1.24848 WP_003414499.1.24857 WP_003414499.1.2487 WP_003414499.1.24893 WP_003414499.1.24933 WP_003414499.1.24956 WP_003414499.1.24958 WP_003414499.1.24985 WP_003414499.1.2499 WP_003414499.1.25051 WP_003414499.1.2507 WP_003414499.1.25096 WP_003414499.1.25103 WP_003414499.1.25129 WP_003414499.1.25171 WP_003414499.1.25184 WP_003414499.1.25247 WP_003414499.1.25252 WP_003414499.1.25278 WP_003414499.1.25283 WP_003414499.1.25309 WP_003414499.1.25313 WP_003414499.1.25338 WP_003414499.1.25342 WP_003414499.1.25343 WP_003414499.1.25367 WP_003414499.1.25393 WP_003414499.1.25406 WP_003414499.1.25435 WP_003414499.1.25437 WP_003414499.1.25445 WP_003414499.1.25455 WP_003414499.1.25473 WP_003414499.1.25513 WP_003414499.1.25542 WP_003414499.1.25579 WP_003414499.1.25594 WP_003414499.1.25606 WP_003414499.1.25645 WP_003414499.1.2566 WP_003414499.1.25673 WP_003414499.1.25674 WP_003414499.1.25699 WP_003414499.1.25727 WP_003414499.1.25736 WP_003414499.1.25738 WP_003414499.1.25756 WP_003414499.1.25759 WP_003414499.1.2580 WP_003414499.1.25813 WP_003414499.1.25853 WP_003414499.1.25854 WP_003414499.1.25874 WP_003414499.1.25885 WP_003414499.1.25892 WP_003414499.1.25906 WP_003414499.1.25914 WP_003414499.1.25916 WP_003414499.1.2594 WP_003414499.1.25954 WP_003414499.1.25972 WP_003414499.1.26017 WP_003414499.1.26032 WP_003414499.1.26038 WP_003414499.1.26072 WP_003414499.1.26089 WP_003414499.1.26097 WP_003414499.1.26098 WP_003414499.1.26108 WP_003414499.1.26109 WP_003414499.1.26118 WP_003414499.1.26126 WP_003414499.1.2614 WP_003414499.1.26168 WP_003414499.1.26182 WP_003414499.1.26190 WP_003414499.1.2620 WP_003414499.1.26234 WP_003414499.1.26243 WP_003414499.1.26267 WP_003414499.1.26292 WP_003414499.1.26310 WP_003414499.1.26328 WP_003414499.1.26349 WP_003414499.1.26366 WP_003414499.1.26374 WP_003414499.1.26407 WP_003414499.1.26454 WP_003414499.1.26464 WP_003414499.1.26560 WP_003414499.1.26571 WP_003414499.1.2659 WP_003414499.1.26597 WP_003414499.1.26629 WP_003414499.1.26651 WP_003414499.1.26702 WP_003414499.1.26707 WP_003414499.1.26710 WP_003414499.1.26719 WP_003414499.1.26737 WP_003414499.1.26738 WP_003414499.1.26745 WP_003414499.1.26756 WP_003414499.1.2676 WP_003414499.1.2677 WP_003414499.1.26779 WP_003414499.1.26780 WP_003414499.1.26798 WP_003414499.1.26854 WP_003414499.1.26868 WP_003414499.1.26876 WP_003414499.1.26888 WP_003414499.1.26914 WP_003414499.1.26945 WP_003414499.1.26959 WP_003414499.1.26969 WP_003414499.1.26984 WP_003414499.1.26992 WP_003414499.1.27004 WP_003414499.1.27017 WP_003414499.1.27045 WP_003414499.1.27074 WP_003414499.1.27075 WP_003414499.1.27128 WP_003414499.1.27130 WP_003414499.1.27139 WP_003414499.1.27152 WP_003414499.1.27162 WP_003414499.1.27164 WP_003414499.1.27193 WP_003414499.1.27235 WP_003414499.1.27278 WP_003414499.1.27343 WP_003414499.1.27352 WP_003414499.1.27369 WP_003414499.1.27391 WP_003414499.1.27398 WP_003414499.1.27402 WP_003414499.1.27410 WP_003414499.1.27411 WP_003414499.1.27449 WP_003414499.1.27460 WP_003414499.1.27463 WP_003414499.1.27492 WP_003414499.1.27528 WP_003414499.1.27541 WP_003414499.1.27576 WP_003414499.1.27582 WP_003414499.1.27596 WP_003414499.1.27607 WP_003414499.1.2766 WP_003414499.1.277 WP_003414499.1.27724 WP_003414499.1.27730 WP_003414499.1.27736 WP_003414499.1.27743 WP_003414499.1.27771 WP_003414499.1.27779 WP_003414499.1.27795 WP_003414499.1.27803 WP_003414499.1.27819 WP_003414499.1.27835 WP_003414499.1.27915 WP_003414499.1.27935 WP_003414499.1.27962 WP_003414499.1.28053 WP_003414499.1.28092 WP_003414499.1.28106 WP_003414499.1.28131 WP_003414499.1.28142 WP_003414499.1.28159 WP_003414499.1.2816 WP_003414499.1.28161 WP_003414499.1.28192 WP_003414499.1.28202 WP_003414499.1.28241 WP_003414499.1.28251 WP_003414499.1.28255 WP_003414499.1.28269 WP_003414499.1.28276 WP_003414499.1.28293 WP_003414499.1.28331 WP_003414499.1.28367 WP_003414499.1.28378 WP_003414499.1.28391 WP_003414499.1.2842 WP_003414499.1.28448 WP_003414499.1.2847 WP_003414499.1.28471 WP_003414499.1.28473 WP_003414499.1.28493 WP_003414499.1.28497 WP_003414499.1.28530 WP_003414499.1.28545 WP_003414499.1.28561 WP_003414499.1.28567 WP_003414499.1.28585 WP_003414499.1.286 WP_003414499.1.28610 WP_003414499.1.28617 WP_003414499.1.28634 WP_003414499.1.28642 WP_003414499.1.28671 WP_003414499.1.28698 WP_003414499.1.28703 WP_003414499.1.28739 WP_003414499.1.28758 WP_003414499.1.28781 WP_003414499.1.28787 WP_003414499.1.28827 WP_003414499.1.28839 WP_003414499.1.28847 WP_003414499.1.28850 WP_003414499.1.28851 WP_003414499.1.28865 WP_003414499.1.28897 WP_003414499.1.28914 WP_003414499.1.28935 WP_003414499.1.28936 WP_003414499.1.28939 WP_003414499.1.28943 WP_003414499.1.28952 WP_003414499.1.28975 WP_003414499.1.2899 WP_003414499.1.28993 WP_003414499.1.29000 WP_003414499.1.2901 WP_003414499.1.29028 WP_003414499.1.29033 WP_003414499.1.29058 WP_003414499.1.29078 WP_003414499.1.29102 WP_003414499.1.29115 WP_003414499.1.2916 WP_003414499.1.29217 WP_003414499.1.29234 WP_003414499.1.29264 WP_003414499.1.29275 WP_003414499.1.29306 WP_003414499.1.29339 WP_003414499.1.29348 WP_003414499.1.29364 WP_003414499.1.29367 WP_003414499.1.2938 WP_003414499.1.29399 WP_003414499.1.29426 WP_003414499.1.2944 WP_003414499.1.29449 WP_003414499.1.29450 WP_003414499.1.29452 WP_003414499.1.2949 WP_003414499.1.29510 WP_003414499.1.29515 WP_003414499.1.29525 WP_003414499.1.2953 WP_003414499.1.29559 WP_003414499.1.29587 WP_003414499.1.2959 WP_003414499.1.29592 WP_003414499.1.29599 WP_003414499.1.29632 WP_003414499.1.29649 WP_003414499.1.2965 WP_003414499.1.29659 WP_003414499.1.2969 WP_003414499.1.29698 WP_003414499.1.29718 WP_003414499.1.29742 WP_003414499.1.29745 WP_003414499.1.29747 WP_003414499.1.29769 WP_003414499.1.29825 WP_003414499.1.29830 WP_003414499.1.29861 WP_003414499.1.29869 WP_003414499.1.29883 WP_003414499.1.29890 WP_003414499.1.299 WP_003414499.1.29931 WP_003414499.1.30014 WP_003414499.1.3004 WP_003414499.1.30040 WP_003414499.1.30043 WP_003414499.1.30074 WP_003414499.1.30097 WP_003414499.1.30101 WP_003414499.1.30106 WP_003414499.1.30114 WP_003414499.1.30126 WP_003414499.1.30131 WP_003414499.1.30139 WP_003414499.1.30145 WP_003414499.1.30211 WP_003414499.1.30224 WP_003414499.1.30235 WP_003414499.1.30237 WP_003414499.1.3027 WP_003414499.1.30279 WP_003414499.1.30283 WP_003414499.1.30291 WP_003414499.1.30363 WP_003414499.1.30374 WP_003414499.1.30404 WP_003414499.1.3043 WP_003414499.1.30438 WP_003414499.1.30462 WP_003414499.1.30464 WP_003414499.1.30468 WP_003414499.1.30500 WP_003414499.1.3057 WP_003414499.1.30574 WP_003414499.1.30628 WP_003414499.1.30641 WP_003414499.1.30642 WP_003414499.1.30661 WP_003414499.1.30669 WP_003414499.1.30683 WP_003414499.1.30699 WP_003414499.1.30709 WP_003414499.1.30713 WP_003414499.1.30716 WP_003414499.1.30719 WP_003414499.1.30730 WP_003414499.1.30736 WP_003414499.1.30745 WP_003414499.1.30760 WP_003414499.1.30791 WP_003414499.1.308 WP_003414499.1.30807 WP_003414499.1.30818 WP_003414499.1.30824 WP_003414499.1.30848 WP_003414499.1.30877 WP_003414499.1.30888 WP_003414499.1.30901 WP_003414499.1.30903 WP_003414499.1.30912 WP_003414499.1.30913 WP_003414499.1.30914 WP_003414499.1.30919 WP_003414499.1.30977 WP_003414499.1.3100 WP_003414499.1.31002 WP_003414499.1.3101 WP_003414499.1.31034 WP_003414499.1.31070 WP_003414499.1.31074 WP_003414499.1.31102 WP_003414499.1.31127 WP_003414499.1.31199 WP_003414499.1.31230 WP_003414499.1.31233 WP_003414499.1.31263 WP_003414499.1.31264 WP_003414499.1.31270 WP_003414499.1.31287 WP_003414499.1.31290 WP_003414499.1.31304 WP_003414499.1.31346 WP_003414499.1.31348 WP_003414499.1.31354 WP_003414499.1.31390 WP_003414499.1.31414 WP_003414499.1.31417 WP_003414499.1.31428 WP_003414499.1.3143 WP_003414499.1.31458 WP_003414499.1.31483 WP_003414499.1.3149 WP_003414499.1.31498 WP_003414499.1.31507 WP_003414499.1.31537 WP_003414499.1.31548 WP_003414499.1.31569 WP_003414499.1.31573 WP_003414499.1.316 WP_003414499.1.31629 WP_003414499.1.31666 WP_003414499.1.31693 WP_003414499.1.31703 WP_003414499.1.31770 WP_003414499.1.31776 WP_003414499.1.31783 WP_003414499.1.318 WP_003414499.1.3184 WP_003414499.1.31840 WP_003414499.1.31880 WP_003414499.1.31911 WP_003414499.1.31930 WP_003414499.1.31932 WP_003414499.1.31955 WP_003414499.1.31985 WP_003414499.1.31991 WP_003414499.1.31995 WP_003414499.1.32004 WP_003414499.1.32039 WP_003414499.1.3204 WP_003414499.1.32045 WP_003414499.1.32071 WP_003414499.1.32098 WP_003414499.1.32132 WP_003414499.1.32157 WP_003414499.1.32164 WP_003414499.1.32179 WP_003414499.1.32198 WP_003414499.1.32297 WP_003414499.1.32317 WP_003414499.1.32383 WP_003414499.1.32400 WP_003414499.1.32403 WP_003414499.1.32416 WP_003414499.1.32421 WP_003414499.1.32433 WP_003414499.1.32461 WP_003414499.1.32482 WP_003414499.1.32503 WP_003414499.1.32556 WP_003414499.1.32562 WP_003414499.1.32569 WP_003414499.1.32592 WP_003414499.1.32620 WP_003414499.1.32647 WP_003414499.1.32654 WP_003414499.1.3268 WP_003414499.1.32695 WP_003414499.1.32706 WP_003414499.1.32716 WP_003414499.1.32738 WP_003414499.1.32752 WP_003414499.1.32780 WP_003414499.1.32781 WP_003414499.1.32793 WP_003414499.1.32799 WP_003414499.1.32833 WP_003414499.1.32862 WP_003414499.1.32880 WP_003414499.1.32897 WP_003414499.1.32909 WP_003414499.1.32935 WP_003414499.1.32974 WP_003414499.1.33007 WP_003414499.1.3302 WP_003414499.1.33028 WP_003414499.1.33035 WP_003414499.1.33044 WP_003414499.1.33054 WP_003414499.1.33082 WP_003414499.1.33141 WP_003414499.1.33148 WP_003414499.1.33155 WP_003414499.1.33168 WP_003414499.1.3321 WP_003414499.1.33215 WP_003414499.1.3325 WP_003414499.1.3327 WP_003414499.1.33278 WP_003414499.1.33288 WP_003414499.1.33305 WP_003414499.1.3331 WP_003414499.1.33319 WP_003414499.1.3333 WP_003414499.1.33393 WP_003414499.1.33403 WP_003414499.1.33452 WP_003414499.1.33467 WP_003414499.1.33477 WP_003414499.1.3349 WP_003414499.1.33519 WP_003414499.1.33542 WP_003414499.1.33601 WP_003414499.1.33602 WP_003414499.1.33633 WP_003414499.1.33646 WP_003414499.1.33673 WP_003414499.1.3369 WP_003414499.1.33705 WP_003414499.1.33762 WP_003414499.1.33783 WP_003414499.1.33789 WP_003414499.1.3383 WP_003414499.1.33832 WP_003414499.1.33839 WP_003414499.1.33848 WP_003414499.1.3387 WP_003414499.1.33886 WP_003414499.1.33895 WP_003414499.1.33906 WP_003414499.1.33912 WP_003414499.1.33954 WP_003414499.1.3399 WP_003414499.1.34042 WP_003414499.1.3405 WP_003414499.1.34055 WP_003414499.1.34056 WP_003414499.1.34065 WP_003414499.1.3408 WP_003414499.1.34109 WP_003414499.1.34131 WP_003414499.1.34152 WP_003414499.1.34153 WP_003414499.1.34163 WP_003414499.1.34181 WP_003414499.1.34197 WP_003414499.1.34198 WP_003414499.1.34215 WP_003414499.1.34219 WP_003414499.1.34255 WP_003414499.1.34260 WP_003414499.1.34275 WP_003414499.1.343 WP_003414499.1.34347 WP_003414499.1.34358 WP_003414499.1.34392 WP_003414499.1.344 WP_003414499.1.34428 WP_003414499.1.3443 WP_003414499.1.34435 WP_003414499.1.34446 WP_003414499.1.34499 WP_003414499.1.34505 WP_003414499.1.34529 WP_003414499.1.34551 WP_003414499.1.34563 WP_003414499.1.34576 WP_003414499.1.34581 WP_003414499.1.34588 WP_003414499.1.34596 WP_003414499.1.34599 WP_003414499.1.34639 WP_003414499.1.34673 WP_003414499.1.34724 WP_003414499.1.34740 WP_003414499.1.34755 WP_003414499.1.34841 WP_003414499.1.34908 WP_003414499.1.34919 WP_003414499.1.3492 WP_003414499.1.34933 WP_003414499.1.34945 WP_003414499.1.34946 WP_003414499.1.34954 WP_003414499.1.34960 WP_003414499.1.34961 WP_003414499.1.34963 WP_003414499.1.34965 WP_003414499.1.34968 WP_003414499.1.35023 WP_003414499.1.35069 WP_003414499.1.35072 WP_003414499.1.35078 WP_003414499.1.35100 WP_003414499.1.35146 WP_003414499.1.35156 WP_003414499.1.35160 WP_003414499.1.35162 WP_003414499.1.35173 WP_003414499.1.35176 WP_003414499.1.3520 WP_003414499.1.35213 WP_003414499.1.35221 WP_003414499.1.35246 WP_003414499.1.35278 WP_003414499.1.35301 WP_003414499.1.35311 WP_003414499.1.35312 WP_003414499.1.35317 WP_003414499.1.35319 WP_003414499.1.35347 WP_003414499.1.35363 WP_003414499.1.35382 WP_003414499.1.35385 WP_003414499.1.35396 WP_003414499.1.35397 WP_003414499.1.35426 WP_003414499.1.35455 WP_003414499.1.3548 WP_003414499.1.35484 WP_003414499.1.35492 WP_003414499.1.3553 WP_003414499.1.35553 WP_003414499.1.35555 WP_003414499.1.35561 WP_003414499.1.35602 WP_003414499.1.35610 WP_003414499.1.35635 WP_003414499.1.35657 WP_003414499.1.35687 WP_003414499.1.35689 WP_003414499.1.35707 WP_003414499.1.35732 WP_003414499.1.35754 WP_003414499.1.35767 WP_003414499.1.35770 WP_003414499.1.35771 WP_003414499.1.35780 WP_003414499.1.35805 WP_003414499.1.35821 WP_003414499.1.3584 WP_003414499.1.35848 WP_003414499.1.35864 WP_003414499.1.35874 WP_003414499.1.35876 WP_003414499.1.35897 WP_003414499.1.35923 WP_003414499.1.3593 WP_003414499.1.35954 WP_003414499.1.36005 WP_003414499.1.36014 WP_003414499.1.36023 WP_003414499.1.36051 WP_003414499.1.36053 WP_003414499.1.36075 WP_003414499.1.36089 WP_003414499.1.36097 WP_003414499.1.36098 WP_003414499.1.36116 WP_003414499.1.36145 WP_003414499.1.36156 WP_003414499.1.36205 WP_003414499.1.36228 WP_003414499.1.36246 WP_003414499.1.36252 WP_003414499.1.36260 WP_003414499.1.36270 WP_003414499.1.36271 WP_003414499.1.36303 WP_003414499.1.36309 WP_003414499.1.36315 WP_003414499.1.36319 WP_003414499.1.36321 WP_003414499.1.36326 WP_003414499.1.3634 WP_003414499.1.36356 WP_003414499.1.36357 WP_003414499.1.3636 WP_003414499.1.36385 WP_003414499.1.36399 WP_003414499.1.36436 WP_003414499.1.36465 WP_003414499.1.36469 WP_003414499.1.36473 WP_003414499.1.36485 WP_003414499.1.36508 WP_003414499.1.36540 WP_003414499.1.36561 WP_003414499.1.36571 WP_003414499.1.36573 WP_003414499.1.36578 WP_003414499.1.36585 WP_003414499.1.36597 WP_003414499.1.36614 WP_003414499.1.36657 WP_003414499.1.36674 WP_003414499.1.36720 WP_003414499.1.36727 WP_003414499.1.36733 WP_003414499.1.36810 WP_003414499.1.36844 WP_003414499.1.36851 WP_003414499.1.36862 WP_003414499.1.36893 WP_003414499.1.36901 WP_003414499.1.36921 WP_003414499.1.36935 WP_003414499.1.36941 WP_003414499.1.3695 WP_003414499.1.36951 WP_003414499.1.36968 WP_003414499.1.3700 WP_003414499.1.37004 WP_003414499.1.37012 WP_003414499.1.37071 WP_003414499.1.37088 WP_003414499.1.37131 WP_003414499.1.37157 WP_003414499.1.37175 WP_003414499.1.37188 WP_003414499.1.37213 WP_003414499.1.37229 WP_003414499.1.3724 WP_003414499.1.37277 WP_003414499.1.37305 WP_003414499.1.37330 WP_003414499.1.37389 WP_003414499.1.37400 WP_003414499.1.37440 WP_003414499.1.37459 WP_003414499.1.37468 WP_003414499.1.37475 WP_003414499.1.37484 WP_003414499.1.37601 WP_003414499.1.37612 WP_003414499.1.37632 WP_003414499.1.37643 WP_003414499.1.37655 WP_003414499.1.37660 WP_003414499.1.37674 WP_003414499.1.37700 WP_003414499.1.37701 WP_003414499.1.37709 WP_003414499.1.37711 WP_003414499.1.37721 WP_003414499.1.37722 WP_003414499.1.37747 WP_003414499.1.37765 WP_003414499.1.37772 WP_003414499.1.37804 WP_003414499.1.37809 WP_003414499.1.37859 WP_003414499.1.37877 WP_003414499.1.37912 WP_003414499.1.37913 WP_003414499.1.37943 WP_003414499.1.37950 WP_003414499.1.37973 WP_003414499.1.37975 WP_003414499.1.37983 WP_003414499.1.38 WP_003414499.1.38002 WP_003414499.1.3802 WP_003414499.1.38039 WP_003414499.1.38040 WP_003414499.1.38067 WP_003414499.1.38068 WP_003414499.1.38135 WP_003414499.1.38138 WP_003414499.1.38144 WP_003414499.1.38158 WP_003414499.1.38159 WP_003414499.1.38210 WP_003414499.1.38233 WP_003414499.1.38240 WP_003414499.1.38299 WP_003414499.1.38332 WP_003414499.1.38347 WP_003414499.1.38354 WP_003414499.1.38380 WP_003414499.1.38384 WP_003414499.1.38389 WP_003414499.1.38398 WP_003414499.1.38402 WP_003414499.1.38418 WP_003414499.1.38421 WP_003414499.1.38466 WP_003414499.1.38477 WP_003414499.1.38483 WP_003414499.1.385 WP_003414499.1.38530 WP_003414499.1.38539 WP_003414499.1.38594 WP_003414499.1.38601 WP_003414499.1.38611 WP_003414499.1.38638 WP_003414499.1.38639 WP_003414499.1.38646 WP_003414499.1.38648 WP_003414499.1.38654 WP_003414499.1.38659 WP_003414499.1.38660 WP_003414499.1.38666 WP_003414499.1.38671 WP_003414499.1.38672 WP_003414499.1.38677 WP_003414499.1.38750 WP_003414499.1.38772 WP_003414499.1.38812 WP_003414499.1.38821 WP_003414499.1.38844 WP_003414499.1.38863 WP_003414499.1.38865 WP_003414499.1.38873 WP_003414499.1.3889 WP_003414499.1.38909 WP_003414499.1.38939 WP_003414499.1.38975 WP_003414499.1.38991 WP_003414499.1.39025 WP_003414499.1.39070 WP_003414499.1.39072 WP_003414499.1.39095 WP_003414499.1.39106 WP_003414499.1.39165 WP_003414499.1.39174 WP_003414499.1.39176 WP_003414499.1.39178 WP_003414499.1.39190 WP_003414499.1.39201 WP_003414499.1.39207 WP_003414499.1.39211 WP_003414499.1.39236 WP_003414499.1.39239 WP_003414499.1.39252 WP_003414499.1.39288 WP_003414499.1.39306 WP_003414499.1.39359 WP_003414499.1.39364 WP_003414499.1.39400 WP_003414499.1.39447 WP_003414499.1.3945 WP_003414499.1.39450 WP_003414499.1.39455 WP_003414499.1.3949 WP_003414499.1.39521 WP_003414499.1.39560 WP_003414499.1.39592 WP_003414499.1.39593 WP_003414499.1.396 WP_003414499.1.3960 WP_003414499.1.39616 WP_003414499.1.39654 WP_003414499.1.39657 WP_003414499.1.39661 WP_003414499.1.39674 WP_003414499.1.39678 WP_003414499.1.3968 WP_003414499.1.39694 WP_003414499.1.3971 WP_003414499.1.39728 WP_003414499.1.39739 WP_003414499.1.39748 WP_003414499.1.39751 WP_003414499.1.39759 WP_003414499.1.39801 WP_003414499.1.39804 WP_003414499.1.39848 WP_003414499.1.39877 WP_003414499.1.39925 WP_003414499.1.3994 WP_003414499.1.39959 WP_003414499.1.3996 WP_003414499.1.39960 WP_003414499.1.3997 WP_003414499.1.39980 WP_003414499.1.40000 WP_003414499.1.40028 WP_003414499.1.40029 WP_003414499.1.4003 WP_003414499.1.40094 WP_003414499.1.40096 WP_003414499.1.40150 WP_003414499.1.40156 WP_003414499.1.40174 WP_003414499.1.40186 WP_003414499.1.40276 WP_003414499.1.40277 WP_003414499.1.40323 WP_003414499.1.40336 WP_003414499.1.40353 WP_003414499.1.4036 WP_003414499.1.40372 WP_003414499.1.40402 WP_003414499.1.40413 WP_003414499.1.40440 WP_003414499.1.40446 WP_003414499.1.40451 WP_003414499.1.40455 WP_003414499.1.40523 WP_003414499.1.40543 WP_003414499.1.40641 WP_003414499.1.40646 WP_003414499.1.40651 WP_003414499.1.40653 WP_003414499.1.4067 WP_003414499.1.40705 WP_003414499.1.40723 WP_003414499.1.40731 WP_003414499.1.40735 WP_003414499.1.40852 WP_003414499.1.40876 WP_003414499.1.40881 WP_003414499.1.40922 WP_003414499.1.40948 WP_003414499.1.4095 WP_003414499.1.40956 WP_003414499.1.40957 WP_003414499.1.40964 WP_003414499.1.4097 WP_003414499.1.410 WP_003414499.1.41000 WP_003414499.1.41055 WP_003414499.1.41108 WP_003414499.1.41123 WP_003414499.1.41177 WP_003414499.1.41202 WP_003414499.1.41219 WP_003414499.1.41231 WP_003414499.1.41249 WP_003414499.1.4127 WP_003414499.1.41296 WP_003414499.1.41355 WP_003414499.1.41376 WP_003414499.1.41430 WP_003414499.1.41447 WP_003414499.1.41469 WP_003414499.1.41504 WP_003414499.1.41553 WP_003414499.1.41564 WP_003414499.1.41616 WP_003414499.1.41632 WP_003414499.1.41635 WP_003414499.1.41636 WP_003414499.1.41648 WP_003414499.1.41660 WP_003414499.1.41685 WP_003414499.1.41695 WP_003414499.1.41704 WP_003414499.1.4171 WP_003414499.1.41719 WP_003414499.1.41733 WP_003414499.1.41774 WP_003414499.1.41791 WP_003414499.1.41820 WP_003414499.1.41828 WP_003414499.1.41829 WP_003414499.1.41860 WP_003414499.1.41912 WP_003414499.1.41921 WP_003414499.1.41933 WP_003414499.1.41944 WP_003414499.1.42043 WP_003414499.1.42078 WP_003414499.1.42094 WP_003414499.1.42112 WP_003414499.1.4212 WP_003414499.1.42122 WP_003414499.1.42134 WP_003414499.1.42183 WP_003414499.1.42188 WP_003414499.1.42201 WP_003414499.1.42202 WP_003414499.1.42247 WP_003414499.1.42255 WP_003414499.1.42273 WP_003414499.1.42278 WP_003414499.1.42304 WP_003414499.1.42309 WP_003414499.1.42370 WP_003414499.1.42385 WP_003414499.1.42400 WP_003414499.1.42409 WP_003414499.1.42414 WP_003414499.1.42430 WP_003414499.1.42461 WP_003414499.1.42465 WP_003414499.1.42473 WP_003414499.1.42474 WP_003414499.1.4248 WP_003414499.1.42494 WP_003414499.1.42519 WP_003414499.1.42524 WP_003414499.1.42534 WP_003414499.1.42562 WP_003414499.1.42568 WP_003414499.1.42570 WP_003414499.1.42695 WP_003414499.1.42704 WP_003414499.1.42705 WP_003414499.1.42722 WP_003414499.1.42777 WP_003414499.1.42782 WP_003414499.1.42835 WP_003414499.1.42839 WP_003414499.1.42842 WP_003414499.1.42905 WP_003414499.1.42916 WP_003414499.1.42930 WP_003414499.1.42971 WP_003414499.1.43005 WP_003414499.1.43009 WP_003414499.1.43053 WP_003414499.1.43082 WP_003414499.1.43087 WP_003414499.1.43098 WP_003414499.1.43208 WP_003414499.1.43236 WP_003414499.1.43246 WP_003414499.1.43255 WP_003414499.1.43266 WP_003414499.1.43269 WP_003414499.1.43273 WP_003414499.1.43296 WP_003414499.1.43306 WP_003414499.1.4335 WP_003414499.1.43368 WP_003414499.1.43395 WP_003414499.1.43457 WP_003414499.1.43462 WP_003414499.1.43475 WP_003414499.1.43478 WP_003414499.1.43484 WP_003414499.1.43557 WP_003414499.1.43578 WP_003414499.1.43588 WP_003414499.1.43643 WP_003414499.1.43664 WP_003414499.1.43684 WP_003414499.1.43686 WP_003414499.1.43706 WP_003414499.1.4377 WP_003414499.1.43781 WP_003414499.1.43794 WP_003414499.1.43815 WP_003414499.1.43846 WP_003414499.1.43861 WP_003414499.1.43863 WP_003414499.1.43866 WP_003414499.1.43872 WP_003414499.1.43885 WP_003414499.1.43897 WP_003414499.1.4390 WP_003414499.1.43902 WP_003414499.1.43921 WP_003414499.1.43936 WP_003414499.1.43937 WP_003414499.1.43960 WP_003414499.1.43965 WP_003414499.1.4399 WP_003414499.1.43993 WP_003414499.1.43996 WP_003414499.1.44 WP_003414499.1.44001 WP_003414499.1.44008 WP_003414499.1.44016 WP_003414499.1.44033 WP_003414499.1.44041 WP_003414499.1.44070 WP_003414499.1.44071 WP_003414499.1.44076 WP_003414499.1.44104 WP_003414499.1.44111 WP_003414499.1.44124 WP_003414499.1.44169 WP_003414499.1.44219 WP_003414499.1.44237 WP_003414499.1.44277 WP_003414499.1.44279 WP_003414499.1.44336 WP_003414499.1.44355 WP_003414499.1.44358 WP_003414499.1.4438 WP_003414499.1.44390 WP_003414499.1.44392 WP_003414499.1.4441 WP_003414499.1.44415 WP_003414499.1.44464 WP_003414499.1.44466 WP_003414499.1.44489 WP_003414499.1.44492 WP_003414499.1.44494 WP_003414499.1.44500 WP_003414499.1.44519 WP_003414499.1.44526 WP_003414499.1.44534 WP_003414499.1.44562 WP_003414499.1.44589 WP_003414499.1.44597 WP_003414499.1.44600 WP_003414499.1.44602 WP_003414499.1.44615 WP_003414499.1.4464 WP_003414499.1.44651 WP_003414499.1.44659 WP_003414499.1.44665 WP_003414499.1.44694 WP_003414499.1.44700 WP_003414499.1.44713 WP_003414499.1.44735 WP_003414499.1.44740 WP_003414499.1.44757 WP_003414499.1.44761 WP_003414499.1.44776 WP_003414499.1.44779 WP_003414499.1.44786 WP_003414499.1.44808 WP_003414499.1.44864 WP_003414499.1.44901 WP_003414499.1.44913 WP_003414499.1.4492 WP_003414499.1.44939 WP_003414499.1.44979 WP_003414499.1.44981 WP_003414499.1.45002 WP_003414499.1.4504 WP_003414499.1.45066 WP_003414499.1.45081 WP_003414499.1.45113 WP_003414499.1.45135 WP_003414499.1.45147 WP_003414499.1.4517 WP_003414499.1.45181 WP_003414499.1.45185 WP_003414499.1.45192 WP_003414499.1.45200 WP_003414499.1.45205 WP_003414499.1.45211 WP_003414499.1.45249 WP_003414499.1.4526 WP_003414499.1.45286 WP_003414499.1.45326 WP_003414499.1.45347 WP_003414499.1.45374 WP_003414499.1.45390 WP_003414499.1.454 WP_003414499.1.45407 WP_003414499.1.45451 WP_003414499.1.45453 WP_003414499.1.45460 WP_003414499.1.45463 WP_003414499.1.45470 WP_003414499.1.45474 WP_003414499.1.45491 WP_003414499.1.45510 WP_003414499.1.45563 WP_003414499.1.45584 WP_003414499.1.45590 WP_003414499.1.45619 WP_003414499.1.45626 WP_003414499.1.45631 WP_003414499.1.45666 WP_003414499.1.45697 WP_003414499.1.4571 WP_003414499.1.45731 WP_003414499.1.45743 WP_003414499.1.45765 WP_003414499.1.45776 WP_003414499.1.45783 WP_003414499.1.45805 WP_003414499.1.45815 WP_003414499.1.45849 WP_003414499.1.45867 WP_003414499.1.45884 WP_003414499.1.4590 WP_003414499.1.45923 WP_003414499.1.45926 WP_003414499.1.45963 WP_003414499.1.45989 WP_003414499.1.46025 WP_003414499.1.46083 WP_003414499.1.46090 WP_003414499.1.46092 WP_003414499.1.46100 WP_003414499.1.46101 WP_003414499.1.46103 WP_003414499.1.46107 WP_003414499.1.46127 WP_003414499.1.46128 WP_003414499.1.46129 WP_003414499.1.46141 WP_003414499.1.46150 WP_003414499.1.46226 WP_003414499.1.4624 WP_003414499.1.46253 WP_003414499.1.46268 WP_003414499.1.46285 WP_003414499.1.46300 WP_003414499.1.46313 WP_003414499.1.46336 WP_003414499.1.46365 WP_003414499.1.46370 WP_003414499.1.46381 WP_003414499.1.46402 WP_003414499.1.46411 WP_003414499.1.4644 WP_003414499.1.46442 WP_003414499.1.46453 WP_003414499.1.46463 WP_003414499.1.46478 WP_003414499.1.46492 WP_003414499.1.46521 WP_003414499.1.4653 WP_003414499.1.46532 WP_003414499.1.46539 WP_003414499.1.46568 WP_003414499.1.46585 WP_003414499.1.46609 WP_003414499.1.46613 WP_003414499.1.46642 WP_003414499.1.46647 WP_003414499.1.46674 WP_003414499.1.46724 WP_003414499.1.46758 WP_003414499.1.46773 WP_003414499.1.46777 WP_003414499.1.46786 WP_003414499.1.46792 WP_003414499.1.46847 WP_003414499.1.46851 WP_003414499.1.4687 WP_003414499.1.46897 WP_003414499.1.46980 WP_003414499.1.47011 WP_003414499.1.47012 WP_003414499.1.47066 WP_003414499.1.47083 WP_003414499.1.47106 WP_003414499.1.47142 WP_003414499.1.47147 WP_003414499.1.47166 WP_003414499.1.47178 WP_003414499.1.47179 WP_003414499.1.47194 WP_003414499.1.47207 WP_003414499.1.47210 WP_003414499.1.47261 WP_003414499.1.47262 WP_003414499.1.47402 WP_003414499.1.47423 WP_003414499.1.47467 WP_003414499.1.47502 WP_003414499.1.4751 WP_003414499.1.47511 WP_003414499.1.47537 WP_003414499.1.47540 WP_003414499.1.47568 WP_003414499.1.47572 WP_003414499.1.47588 WP_003414499.1.47636 WP_003414499.1.4764 WP_003414499.1.47653 WP_003414499.1.47679 WP_003414499.1.47681 WP_003414499.1.47690 WP_003414499.1.4771 WP_003414499.1.47717 WP_003414499.1.47743 WP_003414499.1.47754 WP_003414499.1.47773 WP_003414499.1.47776 WP_003414499.1.47780 WP_003414499.1.47805 WP_003414499.1.47832 WP_003414499.1.47847 WP_003414499.1.47858 WP_003414499.1.47861 WP_003414499.1.47868 WP_003414499.1.47893 WP_003414499.1.479 WP_003414499.1.47912 WP_003414499.1.47913 WP_003414499.1.47926 WP_003414499.1.4794 WP_003414499.1.47943 WP_003414499.1.47944 WP_003414499.1.47959 WP_003414499.1.47974 WP_003414499.1.47993 WP_003414499.1.48004 WP_003414499.1.48039 WP_003414499.1.48050 WP_003414499.1.48084 WP_003414499.1.48097 WP_003414499.1.48101 WP_003414499.1.48109 WP_003414499.1.4813 WP_003414499.1.48130 WP_003414499.1.48135 WP_003414499.1.48143 WP_003414499.1.48152 WP_003414499.1.48155 WP_003414499.1.48170 WP_003414499.1.48173 WP_003414499.1.48177 WP_003414499.1.48185 WP_003414499.1.48219 WP_003414499.1.4823 WP_003414499.1.48240 WP_003414499.1.48256 WP_003414499.1.48264 WP_003414499.1.48287 WP_003414499.1.48330 WP_003414499.1.48333 WP_003414499.1.48348 WP_003414499.1.48354 WP_003414499.1.48372 WP_003414499.1.48383 WP_003414499.1.48388 WP_003414499.1.48419 WP_003414499.1.48423 WP_003414499.1.48443 WP_003414499.1.48543 WP_003414499.1.48550 WP_003414499.1.48618 WP_003414499.1.4863 WP_003414499.1.48648 WP_003414499.1.48658 WP_003414499.1.48666 WP_003414499.1.48687 WP_003414499.1.48779 WP_003414499.1.4878 WP_003414499.1.48798 WP_003414499.1.48826 WP_003414499.1.48843 WP_003414499.1.48857 WP_003414499.1.4890 WP_003414499.1.48946 WP_003414499.1.48979 WP_003414499.1.49017 WP_003414499.1.49048 WP_003414499.1.49059 WP_003414499.1.4906 WP_003414499.1.4907 WP_003414499.1.49103 WP_003414499.1.49110 WP_003414499.1.49112 WP_003414499.1.4919 WP_003414499.1.49251 WP_003414499.1.49254 WP_003414499.1.49263 WP_003414499.1.49291 WP_003414499.1.49296 WP_003414499.1.49335 WP_003414499.1.49337 WP_003414499.1.49419 WP_003414499.1.49426 WP_003414499.1.49437 WP_003414499.1.49474 WP_003414499.1.49506 WP_003414499.1.49516 WP_003414499.1.49523 WP_003414499.1.49526 WP_003414499.1.49532 WP_003414499.1.49588 WP_003414499.1.4959 WP_003414499.1.49678 WP_003414499.1.49687 WP_003414499.1.49699 WP_003414499.1.49709 WP_003414499.1.4971 WP_003414499.1.4972 WP_003414499.1.49736 WP_003414499.1.49746 WP_003414499.1.49764 WP_003414499.1.49773 WP_003414499.1.49796 WP_003414499.1.49814 WP_003414499.1.49815 WP_003414499.1.49816 WP_003414499.1.49839 WP_003414499.1.49857 WP_003414499.1.49878 WP_003414499.1.49880 WP_003414499.1.49944 WP_003414499.1.4999 WP_003414499.1.49990 WP_003414499.1.50068 WP_003414499.1.50077 WP_003414499.1.5008 WP_003414499.1.50081 WP_003414499.1.50122 WP_003414499.1.50126 WP_003414499.1.50149 WP_003414499.1.50162 WP_003414499.1.5018 WP_003414499.1.50194 WP_003414499.1.50218 WP_003414499.1.50235 WP_003414499.1.50249 WP_003414499.1.50265 WP_003414499.1.50271 WP_003414499.1.50324 WP_003414499.1.50347 WP_003414499.1.50372 WP_003414499.1.50398 WP_003414499.1.50407 WP_003414499.1.50444 WP_003414499.1.50466 WP_003414499.1.50472 WP_003414499.1.5048 WP_003414499.1.50498 WP_003414499.1.5050 WP_003414499.1.50540 WP_003414499.1.50554 WP_003414499.1.50557 WP_003414499.1.50601 WP_003414499.1.50610 WP_003414499.1.50632 WP_003414499.1.50633 WP_003414499.1.50642 WP_003414499.1.50655 WP_003414499.1.50659 WP_003414499.1.50683 WP_003414499.1.50689 WP_003414499.1.50692 WP_003414499.1.50714 WP_003414499.1.50729 WP_003414499.1.50756 WP_003414499.1.50794 WP_003414499.1.50841 WP_003414499.1.50860 WP_003414499.1.50868 WP_003414499.1.50877 WP_003414499.1.5096 WP_003414499.1.50981 WP_003414499.1.50987 WP_003414499.1.51003 WP_003414499.1.51009 WP_003414499.1.51037 WP_003414499.1.51074 WP_003414499.1.51082 WP_003414499.1.51101 WP_003414499.1.51116 WP_003414499.1.51149 WP_003414499.1.51157 WP_003414499.1.51213 WP_003414499.1.51232 WP_003414499.1.51247 WP_003414499.1.51266 WP_003414499.1.51279 WP_003414499.1.51291 WP_003414499.1.51294 WP_003414499.1.51301 WP_003414499.1.51329 WP_003414499.1.51391 WP_003414499.1.51422 WP_003414499.1.51445 WP_003414499.1.51455 WP_003414499.1.51466 WP_003414499.1.51478 WP_003414499.1.51497 WP_003414499.1.51520 WP_003414499.1.51593 WP_003414499.1.51628 WP_003414499.1.5164 WP_003414499.1.51647 WP_003414499.1.51660 WP_003414499.1.51696 WP_003414499.1.51721 WP_003414499.1.51788 WP_003414499.1.51795 WP_003414499.1.51801 WP_003414499.1.51817 WP_003414499.1.51819 WP_003414499.1.51854 WP_003414499.1.51923 WP_003414499.1.51942 WP_003414499.1.51948 WP_003414499.1.51963 WP_003414499.1.51969 WP_003414499.1.52000 WP_003414499.1.52001 WP_003414499.1.52003 WP_003414499.1.52006 WP_003414499.1.52036 WP_003414499.1.52038 WP_003414499.1.52046 WP_003414499.1.52059 WP_003414499.1.52069 WP_003414499.1.52082 WP_003414499.1.52102 WP_003414499.1.52106 WP_003414499.1.52166 WP_003414499.1.52168 WP_003414499.1.52178 WP_003414499.1.52206 WP_003414499.1.52216 WP_003414499.1.52238 WP_003414499.1.52241 WP_003414499.1.52280 WP_003414499.1.52314 WP_003414499.1.52385 WP_003414499.1.52390 WP_003414499.1.524 WP_003414499.1.52460 WP_003414499.1.52485 WP_003414499.1.52486 WP_003414499.1.52495 WP_003414499.1.52504 WP_003414499.1.52522 WP_003414499.1.52531 WP_003414499.1.52533 WP_003414499.1.52545 WP_003414499.1.52553 WP_003414499.1.52563 WP_003414499.1.52564 WP_003414499.1.52574 WP_003414499.1.52641 WP_003414499.1.52673 WP_003414499.1.52674 WP_003414499.1.52708 WP_003414499.1.52713 WP_003414499.1.52761 WP_003414499.1.52778 WP_003414499.1.52791 WP_003414499.1.52797 WP_003414499.1.52818 WP_003414499.1.52872 WP_003414499.1.52873 WP_003414499.1.52891 WP_003414499.1.52892 WP_003414499.1.52909 WP_003414499.1.52970 WP_003414499.1.52998 WP_003414499.1.53056 WP_003414499.1.5306 WP_003414499.1.53088 WP_003414499.1.5309 WP_003414499.1.53117 WP_003414499.1.53118 WP_003414499.1.53142 WP_003414499.1.53143 WP_003414499.1.53157 WP_003414499.1.53167 WP_003414499.1.53200 WP_003414499.1.53204 WP_003414499.1.53213 WP_003414499.1.53217 WP_003414499.1.53226 WP_003414499.1.53229 WP_003414499.1.53230 WP_003414499.1.53237 WP_003414499.1.53254 WP_003414499.1.53257 WP_003414499.1.5327 WP_003414499.1.53276 WP_003414499.1.53278 WP_003414499.1.533 WP_003414499.1.53302 WP_003414499.1.53306 WP_003414499.1.5334 WP_003414499.1.5335 WP_003414499.1.53353 WP_003414499.1.53381 WP_003414499.1.53413 WP_003414499.1.53458 WP_003414499.1.53460 WP_003414499.1.53480 WP_003414499.1.53517 WP_003414499.1.53522 WP_003414499.1.53525 WP_003414499.1.53526 WP_003414499.1.53553 WP_003414499.1.53606 WP_003414499.1.53628 WP_003414499.1.53643 WP_003414499.1.53667 WP_003414499.1.53679 WP_003414499.1.53715 WP_003414499.1.53730 WP_003414499.1.53742 WP_003414499.1.53743 WP_003414499.1.53754 WP_003414499.1.53775 WP_003414499.1.53787 WP_003414499.1.53803 WP_003414499.1.53818 WP_003414499.1.53822 WP_003414499.1.53853 WP_003414499.1.53865 WP_003414499.1.53888 WP_003414499.1.53900 WP_003414499.1.53912 WP_003414499.1.53914 WP_003414499.1.53952 WP_003414499.1.5398 WP_003414499.1.5408 WP_003414499.1.54089 WP_003414499.1.54093 WP_003414499.1.54099 WP_003414499.1.54125 WP_003414499.1.54141 WP_003414499.1.54162 WP_003414499.1.54179 WP_003414499.1.54206 WP_003414499.1.54218 WP_003414499.1.54225 WP_003414499.1.54227 WP_003414499.1.54232 WP_003414499.1.54241 WP_003414499.1.54245 WP_003414499.1.54247 WP_003414499.1.54260 WP_003414499.1.54275 WP_003414499.1.54280 WP_003414499.1.5429 WP_003414499.1.54294 WP_003414499.1.54314 WP_003414499.1.54347 WP_003414499.1.54351 WP_003414499.1.54370 WP_003414499.1.54428 WP_003414499.1.54449 WP_003414499.1.54494 WP_003414499.1.54502 WP_003414499.1.54514 WP_003414499.1.5452 WP_003414499.1.54531 WP_003414499.1.54537 WP_003414499.1.54553 WP_003414499.1.54555 WP_003414499.1.54575 WP_003414499.1.54633 WP_003414499.1.54686 WP_003414499.1.54687 WP_003414499.1.54705 WP_003414499.1.54730 WP_003414499.1.54732 WP_003414499.1.5475 WP_003414499.1.54797 WP_003414499.1.54807 WP_003414499.1.54836 WP_003414499.1.54838 WP_003414499.1.54860 WP_003414499.1.54888 WP_003414499.1.54905 WP_003414499.1.54909 WP_003414499.1.54937 WP_003414499.1.54939 WP_003414499.1.54944 WP_003414499.1.54945 WP_003414499.1.54953 WP_003414499.1.54964 WP_003414499.1.55015 WP_003414499.1.55022 WP_003414499.1.55023 WP_003414499.1.55051 WP_003414499.1.55088 WP_003414499.1.55106 WP_003414499.1.55126 WP_003414499.1.55128 WP_003414499.1.55140 WP_003414499.1.55150 WP_003414499.1.55210 WP_003414499.1.55227 WP_003414499.1.55248 WP_003414499.1.55257 WP_003414499.1.55258 WP_003414499.1.55267 WP_003414499.1.55279 WP_003414499.1.55307 WP_003414499.1.55326 WP_003414499.1.55328 WP_003414499.1.5533 WP_003414499.1.55345 WP_003414499.1.55396 WP_003414499.1.55398 WP_003414499.1.55441 WP_003414499.1.55459 WP_003414499.1.55501 WP_003414499.1.55578 WP_003414499.1.55626 WP_003414499.1.55641 WP_003414499.1.5569 WP_003414499.1.55723 WP_003414499.1.55735 WP_003414499.1.5574 WP_003414499.1.55772 WP_003414499.1.55802 WP_003414499.1.55807 WP_003414499.1.55819 WP_003414499.1.55821 WP_003414499.1.5583 WP_003414499.1.55849 WP_003414499.1.55856 WP_003414499.1.55860 WP_003414499.1.55882 WP_003414499.1.55883 WP_003414499.1.55894 WP_003414499.1.55902 WP_003414499.1.55908 WP_003414499.1.55909 WP_003414499.1.5591 WP_003414499.1.55961 WP_003414499.1.55977 WP_003414499.1.55983 WP_003414499.1.56028 WP_003414499.1.56057 WP_003414499.1.56060 WP_003414499.1.56107 WP_003414499.1.56132 WP_003414499.1.56163 WP_003414499.1.56167 WP_003414499.1.56178 WP_003414499.1.56287 WP_003414499.1.56292 WP_003414499.1.56327 WP_003414499.1.56341 WP_003414499.1.56359 WP_003414499.1.56365 WP_003414499.1.56394 WP_003414499.1.56443 WP_003414499.1.56473 WP_003414499.1.56478 WP_003414499.1.56500 WP_003414499.1.56517 WP_003414499.1.5656 WP_003414499.1.56577 WP_003414499.1.56593 WP_003414499.1.56625 WP_003414499.1.56637 WP_003414499.1.56670 WP_003414499.1.56697 WP_003414499.1.567 WP_003414499.1.56701 WP_003414499.1.56743 WP_003414499.1.56755 WP_003414499.1.56764 WP_003414499.1.56769 WP_003414499.1.56770 WP_003414499.1.56795 WP_003414499.1.5681 WP_003414499.1.56827 WP_003414499.1.56839 WP_003414499.1.56863 WP_003414499.1.56868 WP_003414499.1.56869 WP_003414499.1.56915 WP_003414499.1.56926 WP_003414499.1.56961 WP_003414499.1.56971 WP_003414499.1.56972 WP_003414499.1.57023 WP_003414499.1.57077 WP_003414499.1.57087 WP_003414499.1.57094 WP_003414499.1.57134 WP_003414499.1.57151 WP_003414499.1.57169 WP_003414499.1.57208 WP_003414499.1.57212 WP_003414499.1.57230 WP_003414499.1.5724 WP_003414499.1.5725 WP_003414499.1.5727 WP_003414499.1.57273 WP_003414499.1.573 WP_003414499.1.57314 WP_003414499.1.57326 WP_003414499.1.57328 WP_003414499.1.57331 WP_003414499.1.57340 WP_003414499.1.57351 WP_003414499.1.57380 WP_003414499.1.57430 WP_003414499.1.5744 WP_003414499.1.57440 WP_003414499.1.5745 WP_003414499.1.57461 WP_003414499.1.57469 WP_003414499.1.57489 WP_003414499.1.575 WP_003414499.1.57509 WP_003414499.1.57519 WP_003414499.1.57525 WP_003414499.1.57551 WP_003414499.1.5758 WP_003414499.1.57604 WP_003414499.1.57617 WP_003414499.1.57619 WP_003414499.1.57627 WP_003414499.1.57642 WP_003414499.1.57658 WP_003414499.1.57667 WP_003414499.1.57675 WP_003414499.1.57689 WP_003414499.1.57708 WP_003414499.1.57794 WP_003414499.1.57821 WP_003414499.1.57825 WP_003414499.1.57843 WP_003414499.1.57906 WP_003414499.1.57924 WP_003414499.1.57926 WP_003414499.1.57930 WP_003414499.1.57957 WP_003414499.1.57960 WP_003414499.1.57964 WP_003414499.1.57991 WP_003414499.1.58086 WP_003414499.1.58101 WP_003414499.1.58103 WP_003414499.1.58108 WP_003414499.1.5811 WP_003414499.1.58121 WP_003414499.1.58145 WP_003414499.1.58164 WP_003414499.1.58174 WP_003414499.1.582 WP_003414499.1.58202 WP_003414499.1.58209 WP_003414499.1.58215 WP_003414499.1.5824 WP_003414499.1.58250 WP_003414499.1.58259 WP_003414499.1.58283 WP_003414499.1.58288 WP_003414499.1.5830 WP_003414499.1.58303 WP_003414499.1.58311 WP_003414499.1.58330 WP_003414499.1.58359 WP_003414499.1.58386 WP_003414499.1.58393 WP_003414499.1.58431 WP_003414499.1.5844 WP_003414499.1.58457 WP_003414499.1.58488 WP_003414499.1.58518 WP_003414499.1.58534 WP_003414499.1.58559 WP_003414499.1.58567 WP_003414499.1.58573 WP_003414499.1.58602 WP_003414499.1.58612 WP_003414499.1.58619 WP_003414499.1.58630 WP_003414499.1.5865 WP_003414499.1.58671 WP_003414499.1.58690 WP_003414499.1.58702 WP_003414499.1.58743 WP_003414499.1.58754 WP_003414499.1.5879 WP_003414499.1.5881 WP_003414499.1.58824 WP_003414499.1.58848 WP_003414499.1.58857 WP_003414499.1.58891 WP_003414499.1.58892 WP_003414499.1.5890 WP_003414499.1.58904 WP_003414499.1.58921 WP_003414499.1.58930 WP_003414499.1.58939 WP_003414499.1.58941 WP_003414499.1.58961 WP_003414499.1.5898 WP_003414499.1.59025 WP_003414499.1.59029 WP_003414499.1.59037 WP_003414499.1.59044 WP_003414499.1.59085 WP_003414499.1.59088 WP_003414499.1.59112 WP_003414499.1.59130 WP_003414499.1.5914 WP_003414499.1.59147 WP_003414499.1.59166 WP_003414499.1.59205 WP_003414499.1.59209 WP_003414499.1.59237 WP_003414499.1.59240 WP_003414499.1.59253 WP_003414499.1.59254 WP_003414499.1.59262 WP_003414499.1.59270 WP_003414499.1.5928 WP_003414499.1.59304 WP_003414499.1.59305 WP_003414499.1.59309 WP_003414499.1.59316 WP_003414499.1.59326 WP_003414499.1.59328 WP_003414499.1.59333 WP_003414499.1.59338 WP_003414499.1.59388 WP_003414499.1.59428 WP_003414499.1.59487 WP_003414499.1.59537 WP_003414499.1.59561 WP_003414499.1.59677 WP_003414499.1.59722 WP_003414499.1.59732 WP_003414499.1.59738 WP_003414499.1.59750 WP_003414499.1.59757 WP_003414499.1.59761 WP_003414499.1.59808 WP_003414499.1.59850 WP_003414499.1.59856 WP_003414499.1.59860 WP_003414499.1.59861 WP_003414499.1.5987 WP_003414499.1.59878 WP_003414499.1.59952 WP_003414499.1.5996 WP_003414499.1.59961 WP_003414499.1.59974 WP_003414499.1.6000 WP_003414499.1.60007 WP_003414499.1.60016 WP_003414499.1.6003 WP_003414499.1.60047 WP_003414499.1.6007 WP_003414499.1.60121 WP_003414499.1.60125 WP_003414499.1.60135 WP_003414499.1.60139 WP_003414499.1.60152 WP_003414499.1.60171 WP_003414499.1.60197 WP_003414499.1.6020 WP_003414499.1.60205 WP_003414499.1.60207 WP_003414499.1.60215 WP_003414499.1.60217 WP_003414499.1.60267 WP_003414499.1.60288 WP_003414499.1.60291 WP_003414499.1.60301 WP_003414499.1.60305 WP_003414499.1.60312 WP_003414499.1.60313 WP_003414499.1.60314 WP_003414499.1.60367 WP_003414499.1.60403 WP_003414499.1.60413 WP_003414499.1.60421 WP_003414499.1.60451 WP_003414499.1.60460 WP_003414499.1.60479 WP_003414499.1.60487 WP_003414499.1.60512 WP_003414499.1.60573 WP_003414499.1.60583 WP_003414499.1.60632 WP_003414499.1.60657 WP_003414499.1.60687 WP_003414499.1.60689 WP_003414499.1.60727 WP_003414499.1.60738 WP_003414499.1.60763 WP_003414499.1.6077 WP_003414499.1.60791 WP_003414499.1.60834 WP_003414499.1.60878 WP_003414499.1.60879 WP_003414499.1.60913 WP_003414499.1.60978 WP_003414499.1.61000 WP_003414499.1.61001 WP_003414499.1.61012 WP_003414499.1.61014 WP_003414499.1.61015 WP_003414499.1.61037 WP_003414499.1.61052 WP_003414499.1.61065 WP_003414499.1.61100 WP_003414499.1.61101 WP_003414499.1.61138 WP_003414499.1.61142 WP_003414499.1.612 WP_003414499.1.61234 WP_003414499.1.61281 WP_003414499.1.61314 WP_003414499.1.61321 WP_003414499.1.61326 WP_003414499.1.61328 WP_003414499.1.61368 WP_003414499.1.61391 WP_003414499.1.61406 WP_003414499.1.61409 WP_003414499.1.61420 WP_003414499.1.61422 WP_003414499.1.61425 WP_003414499.1.61428 WP_003414499.1.61469 WP_003414499.1.61522 WP_003414499.1.61552 WP_003414499.1.61557 WP_003414499.1.61567 WP_003414499.1.61571 WP_003414499.1.61573 WP_003414499.1.61584 WP_003414499.1.61586 WP_003414499.1.6159 WP_003414499.1.61592 WP_003414499.1.6160 WP_003414499.1.61614 WP_003414499.1.6163 WP_003414499.1.61655 WP_003414499.1.61665 WP_003414499.1.61669 WP_003414499.1.61682 WP_003414499.1.61692 WP_003414499.1.61719 WP_003414499.1.61728 WP_003414499.1.61750 WP_003414499.1.61754 WP_003414499.1.61755 WP_003414499.1.61757 WP_003414499.1.6179 WP_003414499.1.61793 WP_003414499.1.61816 WP_003414499.1.61842 WP_003414499.1.61850 WP_003414499.1.61862 WP_003414499.1.61865 WP_003414499.1.61868 WP_003414499.1.61911 WP_003414499.1.61925 WP_003414499.1.61941 WP_003414499.1.61986 WP_003414499.1.61987 WP_003414499.1.61998 WP_003414499.1.62021 WP_003414499.1.62087 WP_003414499.1.62089 WP_003414499.1.62101 WP_003414499.1.62104 WP_003414499.1.6211 WP_003414499.1.62132 WP_003414499.1.62162 WP_003414499.1.62225 WP_003414499.1.62230 WP_003414499.1.62238 WP_003414499.1.62249 WP_003414499.1.62270 WP_003414499.1.62281 WP_003414499.1.62307 WP_003414499.1.6231 WP_003414499.1.62359 WP_003414499.1.62360 WP_003414499.1.62371 WP_003414499.1.62379 WP_003414499.1.62395 WP_003414499.1.62408 WP_003414499.1.62449 WP_003414499.1.62468 WP_003414499.1.6248 WP_003414499.1.62508 WP_003414499.1.62565 WP_003414499.1.62594 WP_003414499.1.62606 WP_003414499.1.62616 WP_003414499.1.62666 WP_003414499.1.62687 WP_003414499.1.62715 WP_003414499.1.62730 WP_003414499.1.62738 WP_003414499.1.62761 WP_003414499.1.62766 WP_003414499.1.62786 WP_003414499.1.62813 WP_003414499.1.62839 WP_003414499.1.62841 WP_003414499.1.62909 WP_003414499.1.62936 WP_003414499.1.6294 WP_003414499.1.6295 WP_003414499.1.62962 WP_003414499.1.63007 WP_003414499.1.63019 WP_003414499.1.63032 WP_003414499.1.63037 WP_003414499.1.63064 WP_003414499.1.63066 WP_003414499.1.63072 WP_003414499.1.6308 WP_003414499.1.63081 WP_003414499.1.63096 WP_003414499.1.63106 WP_003414499.1.63144 WP_003414499.1.63160 WP_003414499.1.63166 WP_003414499.1.63175 WP_003414499.1.63194 WP_003414499.1.6322 WP_003414499.1.63222 WP_003414499.1.63247 WP_003414499.1.6328 WP_003414499.1.63291 WP_003414499.1.63317 WP_003414499.1.63331 WP_003414499.1.63373 WP_003414499.1.63384 WP_003414499.1.63403 WP_003414499.1.63424 WP_003414499.1.63428 WP_003414499.1.6345 WP_003414499.1.63464 WP_003414499.1.63483 WP_003414499.1.63502 WP_003414499.1.63504 WP_003414499.1.63522 WP_003414499.1.63538 WP_003414499.1.63564 WP_003414499.1.63567 WP_003414499.1.63596 WP_003414499.1.63600 WP_003414499.1.63623 WP_003414499.1.63624 WP_003414499.1.63625 WP_003414499.1.63627 WP_003414499.1.63654 WP_003414499.1.63662 WP_003414499.1.63711 WP_003414499.1.63807 WP_003414499.1.63819 WP_003414499.1.63844 WP_003414499.1.63888 WP_003414499.1.63913 WP_003414499.1.63918 WP_003414499.1.63961 WP_003414499.1.63970 WP_003414499.1.64000 WP_003414499.1.64058 WP_003414499.1.64065 WP_003414499.1.6407 WP_003414499.1.64082 WP_003414499.1.64091 WP_003414499.1.64102 WP_003414499.1.64104 WP_003414499.1.64119 WP_003414499.1.64169 WP_003414499.1.64219 WP_003414499.1.6422 WP_003414499.1.64222 WP_003414499.1.64223 WP_003414499.1.64228 WP_003414499.1.64235 WP_003414499.1.64249 WP_003414499.1.6427 WP_003414499.1.64278 WP_003414499.1.64287 WP_003414499.1.64414 WP_003414499.1.64419 WP_003414499.1.6443 WP_003414499.1.64463 WP_003414499.1.64480 WP_003414499.1.64497 WP_003414499.1.64506 WP_003414499.1.64513 WP_003414499.1.64515 WP_003414499.1.64522 WP_003414499.1.64526 WP_003414499.1.64543 WP_003414499.1.6456 WP_003414499.1.64567 WP_003414499.1.64588 WP_003414499.1.64589 WP_003414499.1.64594 WP_003414499.1.64608 WP_003414499.1.64619 WP_003414499.1.64629 WP_003414499.1.6464 WP_003414499.1.64664 WP_003414499.1.64669 WP_003414499.1.64672 WP_003414499.1.64680 WP_003414499.1.64682 WP_003414499.1.64727 WP_003414499.1.64729 WP_003414499.1.64774 WP_003414499.1.64776 WP_003414499.1.64802 WP_003414499.1.64832 WP_003414499.1.6486 WP_003414499.1.64870 WP_003414499.1.64898 WP_003414499.1.64922 WP_003414499.1.64924 WP_003414499.1.6493 WP_003414499.1.64937 WP_003414499.1.64966 WP_003414499.1.64973 WP_003414499.1.65001 WP_003414499.1.65026 WP_003414499.1.65053 WP_003414499.1.65070 WP_003414499.1.65079 WP_003414499.1.65102 WP_003414499.1.65157 WP_003414499.1.65181 WP_003414499.1.65212 WP_003414499.1.65229 WP_003414499.1.6523 WP_003414499.1.65253 WP_003414499.1.65289 WP_003414499.1.65291 WP_003414499.1.65315 WP_003414499.1.65329 WP_003414499.1.65359 WP_003414499.1.6536 WP_003414499.1.65374 WP_003414499.1.65386 WP_003414499.1.65414 WP_003414499.1.65416 WP_003414499.1.65433 WP_003414499.1.65455 WP_003414499.1.65467 WP_003414499.1.65488 WP_003414499.1.65529 WP_003414499.1.65539 WP_003414499.1.65583 WP_003414499.1.65612 WP_003414499.1.65623 WP_003414499.1.65635 WP_003414499.1.65637 WP_003414499.1.65648 WP_003414499.1.65683 WP_003414499.1.65686 WP_003414499.1.65688 WP_003414499.1.65707 WP_003414499.1.65733 WP_003414499.1.65746 WP_003414499.1.65747 WP_003414499.1.65759 WP_003414499.1.65816 WP_003414499.1.65830 WP_003414499.1.65858 WP_003414499.1.65862 WP_003414499.1.65869 WP_003414499.1.65893 WP_003414499.1.65929 WP_003414499.1.65958 WP_003414499.1.65974 WP_003414499.1.66004 WP_003414499.1.6606 WP_003414499.1.66089 WP_003414499.1.66149 WP_003414499.1.66151 WP_003414499.1.66229 WP_003414499.1.66276 WP_003414499.1.66293 WP_003414499.1.66297 WP_003414499.1.66323 WP_003414499.1.66325 WP_003414499.1.6633 WP_003414499.1.66334 WP_003414499.1.66355 WP_003414499.1.66367 WP_003414499.1.66394 WP_003414499.1.66396 WP_003414499.1.66451 WP_003414499.1.66455 WP_003414499.1.66457 WP_003414499.1.66460 WP_003414499.1.66464 WP_003414499.1.66466 WP_003414499.1.66487 WP_003414499.1.66504 WP_003414499.1.66544 WP_003414499.1.66558 WP_003414499.1.66580 WP_003414499.1.66582 WP_003414499.1.66612 WP_003414499.1.66615 WP_003414499.1.66617 WP_003414499.1.66635 WP_003414499.1.66656 WP_003414499.1.66663 WP_003414499.1.66675 WP_003414499.1.66715 WP_003414499.1.66718 WP_003414499.1.66762 WP_003414499.1.66776 WP_003414499.1.66808 WP_003414499.1.66817 WP_003414499.1.66819 WP_003414499.1.66826 WP_003414499.1.66842 WP_003414499.1.66868 WP_003414499.1.66878 WP_003414499.1.66880 WP_003414499.1.66893 WP_003414499.1.66961 WP_003414499.1.67005 WP_003414499.1.6704 WP_003414499.1.67044 WP_003414499.1.67061 WP_003414499.1.67089 WP_003414499.1.67098 WP_003414499.1.67146 WP_003414499.1.67170 WP_003414499.1.67197 WP_003414499.1.67198 WP_003414499.1.6720 WP_003414499.1.67207 WP_003414499.1.67218 WP_003414499.1.67220 WP_003414499.1.67225 WP_003414499.1.67231 WP_003414499.1.6724 WP_003414499.1.67257 WP_003414499.1.67298 WP_003414499.1.67307 WP_003414499.1.67324 WP_003414499.1.67332 WP_003414499.1.67346 WP_003414499.1.67354 WP_003414499.1.67360 WP_003414499.1.67381 WP_003414499.1.67396 WP_003414499.1.67417 WP_003414499.1.67422 WP_003414499.1.67453 WP_003414499.1.67459 WP_003414499.1.67473 WP_003414499.1.67481 WP_003414499.1.67482 WP_003414499.1.67496 WP_003414499.1.67499 WP_003414499.1.67516 WP_003414499.1.67523 WP_003414499.1.67536 WP_003414499.1.67575 WP_003414499.1.67587 WP_003414499.1.67598 WP_003414499.1.67600 WP_003414499.1.67602 WP_003414499.1.67679 WP_003414499.1.67692 WP_003414499.1.67744 WP_003414499.1.6775 WP_003414499.1.6777 WP_003414499.1.67809 WP_003414499.1.67816 WP_003414499.1.67844 WP_003414499.1.67848 WP_003414499.1.67870 WP_003414499.1.67888 WP_003414499.1.67915 WP_003414499.1.67945 WP_003414499.1.67949 WP_003414499.1.67980 WP_003414499.1.67982 WP_003414499.1.68022 WP_003414499.1.68029 WP_003414499.1.68037 WP_003414499.1.68038 WP_003414499.1.68045 WP_003414499.1.68057 WP_003414499.1.68088 WP_003414499.1.68106 WP_003414499.1.68110 WP_003414499.1.68153 WP_003414499.1.68164 WP_003414499.1.68169 WP_003414499.1.68193 WP_003414499.1.68212 WP_003414499.1.68227 WP_003414499.1.68243 WP_003414499.1.6825 WP_003414499.1.68297 WP_003414499.1.68309 WP_003414499.1.68325 WP_003414499.1.68329 WP_003414499.1.68340 WP_003414499.1.68384 WP_003414499.1.68388 WP_003414499.1.68429 WP_003414499.1.6843 WP_003414499.1.68433 WP_003414499.1.68444 WP_003414499.1.68465 WP_003414499.1.68518 WP_003414499.1.68569 WP_003414499.1.68576 WP_003414499.1.68580 WP_003414499.1.68586 WP_003414499.1.68623 WP_003414499.1.68624 WP_003414499.1.68637 WP_003414499.1.68646 WP_003414499.1.68667 WP_003414499.1.68672 WP_003414499.1.68684 WP_003414499.1.68704 WP_003414499.1.68708 WP_003414499.1.6872 WP_003414499.1.68730 WP_003414499.1.68734 WP_003414499.1.68748 WP_003414499.1.68754 WP_003414499.1.6876 WP_003414499.1.68761 WP_003414499.1.68763 WP_003414499.1.68766 WP_003414499.1.68774 WP_003414499.1.68796 WP_003414499.1.68824 WP_003414499.1.68832 WP_003414499.1.68833 WP_003414499.1.68841 WP_003414499.1.68859 WP_003414499.1.68876 WP_003414499.1.68916 WP_003414499.1.68923 WP_003414499.1.68945 WP_003414499.1.6896 WP_003414499.1.68981 WP_003414499.1.68984 WP_003414499.1.68997 WP_003414499.1.69076 WP_003414499.1.69079 WP_003414499.1.6908 WP_003414499.1.69082 WP_003414499.1.69178 WP_003414499.1.69181 WP_003414499.1.69208 WP_003414499.1.69231 WP_003414499.1.69256 WP_003414499.1.69311 WP_003414499.1.69315 WP_003414499.1.69322 WP_003414499.1.69342 WP_003414499.1.6935 WP_003414499.1.6936 WP_003414499.1.69369 WP_003414499.1.69374 WP_003414499.1.69398 WP_003414499.1.69401 WP_003414499.1.69426 WP_003414499.1.69427 WP_003414499.1.69429 WP_003414499.1.6949 WP_003414499.1.6951 WP_003414499.1.69511 WP_003414499.1.69526 WP_003414499.1.69528 WP_003414499.1.69547 WP_003414499.1.69573 WP_003414499.1.69581 WP_003414499.1.6960 WP_003414499.1.69617 WP_003414499.1.69634 WP_003414499.1.69647 WP_003414499.1.69659 WP_003414499.1.69673 WP_003414499.1.69682 WP_003414499.1.69684 WP_003414499.1.69707 WP_003414499.1.69709 WP_003414499.1.69723 WP_003414499.1.69736 WP_003414499.1.69778 WP_003414499.1.69800 WP_003414499.1.69802 WP_003414499.1.69845 WP_003414499.1.69870 WP_003414499.1.69873 WP_003414499.1.69898 WP_003414499.1.69913 WP_003414499.1.69925 WP_003414499.1.69931 WP_003414499.1.69938 WP_003414499.1.69955 WP_003414499.1.69957 WP_003414499.1.69981 WP_003414499.1.69990 WP_003414499.1.70 WP_003414499.1.70000 WP_003414499.1.70017 WP_003414499.1.70032 WP_003414499.1.70055 WP_003414499.1.70062 WP_003414499.1.70072 WP_003414499.1.70131 WP_003414499.1.70132 WP_003414499.1.7022 WP_003414499.1.70227 WP_003414499.1.70255 WP_003414499.1.70271 WP_003414499.1.70274 WP_003414499.1.7029 WP_003414499.1.70325 WP_003414499.1.70328 WP_003414499.1.70356 WP_003414499.1.70364 WP_003414499.1.70368 WP_003414499.1.70369 WP_003414499.1.70418 WP_003414499.1.70422 WP_003414499.1.70435 WP_003414499.1.70444 WP_003414499.1.70463 WP_003414499.1.70471 WP_003414499.1.70480 WP_003414499.1.70494 WP_003414499.1.70498 WP_003414499.1.70505 WP_003414499.1.70525 WP_003414499.1.70573 WP_003414499.1.70577 WP_003414499.1.70610 WP_003414499.1.70615 WP_003414499.1.70618 WP_003414499.1.70622 WP_003414499.1.70626 WP_003414499.1.70668 WP_003414499.1.70699 WP_003414499.1.70704 WP_003414499.1.70729 WP_003414499.1.70757 WP_003414499.1.70782 WP_003414499.1.70796 WP_003414499.1.70834 WP_003414499.1.7084 WP_003414499.1.70840 WP_003414499.1.70864 WP_003414499.1.70871 WP_003414499.1.70915 WP_003414499.1.70955 WP_003414499.1.70958 WP_003414499.1.70964 WP_003414499.1.70976 WP_003414499.1.71015 WP_003414499.1.71026 WP_003414499.1.71063 WP_003414499.1.71076 WP_003414499.1.71083 WP_003414499.1.7111 WP_003414499.1.71118 WP_003414499.1.71128 WP_003414499.1.7113 WP_003414499.1.71187 WP_003414499.1.71191 WP_003414499.1.71255 WP_003414499.1.71258 WP_003414499.1.71259 WP_003414499.1.71289 WP_003414499.1.71326 WP_003414499.1.71329 WP_003414499.1.71331 WP_003414499.1.71344 WP_003414499.1.71390 WP_003414499.1.71414 WP_003414499.1.71440 WP_003414499.1.71457 WP_003414499.1.7146 WP_003414499.1.71464 WP_003414499.1.71490 WP_003414499.1.71492 WP_003414499.1.71509 WP_003414499.1.71516 WP_003414499.1.71517 WP_003414499.1.71527 WP_003414499.1.71532 WP_003414499.1.71545 WP_003414499.1.71546 WP_003414499.1.71569 WP_003414499.1.71604 WP_003414499.1.71621 WP_003414499.1.71630 WP_003414499.1.71654 WP_003414499.1.71664 WP_003414499.1.71665 WP_003414499.1.71683 WP_003414499.1.71701 WP_003414499.1.71718 WP_003414499.1.71731 WP_003414499.1.71778 WP_003414499.1.71781 WP_003414499.1.71803 WP_003414499.1.71820 WP_003414499.1.71847 WP_003414499.1.7185 WP_003414499.1.71851 WP_003414499.1.71871 WP_003414499.1.71909 WP_003414499.1.71957 WP_003414499.1.72047 WP_003414499.1.72061 WP_003414499.1.72062 WP_003414499.1.72072 WP_003414499.1.72111 WP_003414499.1.72122 WP_003414499.1.72143 WP_003414499.1.7216 WP_003414499.1.72168 WP_003414499.1.72179 WP_003414499.1.72209 WP_003414499.1.72219 WP_003414499.1.72227 WP_003414499.1.7224 WP_003414499.1.72268 WP_003414499.1.72332 WP_003414499.1.72380 WP_003414499.1.72401 WP_003414499.1.72405 WP_003414499.1.72420 WP_003414499.1.72441 WP_003414499.1.72451 WP_003414499.1.72452 WP_003414499.1.72457 WP_003414499.1.72459 WP_003414499.1.72460 WP_003414499.1.72466 WP_003414499.1.72487 WP_003414499.1.72488 WP_003414499.1.72492 WP_003414499.1.72506 WP_003414499.1.72543 WP_003414499.1.7256 WP_003414499.1.72576 WP_003414499.1.72578 WP_003414499.1.72585 WP_003414499.1.72591 WP_003414499.1.72592 WP_003414499.1.72640 WP_003414499.1.72661 WP_003414499.1.72684 WP_003414499.1.72739 WP_003414499.1.72744 WP_003414499.1.72755 WP_003414499.1.72759 WP_003414499.1.72784 WP_003414499.1.72792 WP_003414499.1.72826 WP_003414499.1.72831 WP_003414499.1.72852 WP_003414499.1.72853 WP_003414499.1.72880 WP_003414499.1.72938 WP_003414499.1.72954 WP_003414499.1.72957 WP_003414499.1.72959 WP_003414499.1.72973 WP_003414499.1.7298 WP_003414499.1.72982 WP_003414499.1.72988 WP_003414499.1.72993 WP_003414499.1.73006 WP_003414499.1.73013 WP_003414499.1.73025 WP_003414499.1.73028 WP_003414499.1.73042 WP_003414499.1.73045 WP_003414499.1.73092 WP_003414499.1.73118 WP_003414499.1.7312 WP_003414499.1.73127 WP_003414499.1.73134 WP_003414499.1.73150 WP_003414499.1.73154 WP_003414499.1.73163 WP_003414499.1.73182 WP_003414499.1.73205 WP_003414499.1.7321 WP_003414499.1.73310 WP_003414499.1.73365 WP_003414499.1.73391 WP_003414499.1.73404 WP_003414499.1.73424 WP_003414499.1.73436 WP_003414499.1.73445 WP_003414499.1.73453 WP_003414499.1.73465 WP_003414499.1.73466 WP_003414499.1.73470 WP_003414499.1.73471 WP_003414499.1.73482 WP_003414499.1.73507 WP_003414499.1.73532 WP_003414499.1.73550 WP_003414499.1.73564 WP_003414499.1.73623 WP_003414499.1.73629 WP_003414499.1.73644 WP_003414499.1.7366 WP_003414499.1.73661 WP_003414499.1.7368 WP_003414499.1.73688 WP_003414499.1.73744 WP_003414499.1.73750 WP_003414499.1.73760 WP_003414499.1.73774 WP_003414499.1.7379 WP_003414499.1.73813 WP_003414499.1.73840 WP_003414499.1.73876 WP_003414499.1.7389 WP_003414499.1.73986 WP_003414499.1.74016 WP_003414499.1.74039 WP_003414499.1.74083 WP_003414499.1.74101 WP_003414499.1.74107 WP_003414499.1.74120 WP_003414499.1.74129 WP_003414499.1.7417 WP_003414499.1.74190 WP_003414499.1.74210 WP_003414499.1.74259 WP_003414499.1.74262 WP_003414499.1.74269 WP_003414499.1.74282 WP_003414499.1.74291 WP_003414499.1.74296 WP_003414499.1.74304 WP_003414499.1.7432 WP_003414499.1.74347 WP_003414499.1.7436 WP_003414499.1.74378 WP_003414499.1.74400 WP_003414499.1.74401 WP_003414499.1.74432 WP_003414499.1.74442 WP_003414499.1.74487 WP_003414499.1.74499 WP_003414499.1.74504 WP_003414499.1.74511 WP_003414499.1.74523 WP_003414499.1.74525 WP_003414499.1.74551 WP_003414499.1.74555 WP_003414499.1.74628 WP_003414499.1.74641 WP_003414499.1.74653 WP_003414499.1.74660 WP_003414499.1.74683 WP_003414499.1.7469 WP_003414499.1.74760 WP_003414499.1.74809 WP_003414499.1.74820 WP_003414499.1.74870 WP_003414499.1.74881 WP_003414499.1.74888 WP_003414499.1.74952 WP_003414499.1.7496 WP_003414499.1.74988 WP_003414499.1.75043 WP_003414499.1.75045 WP_003414499.1.75055 WP_003414499.1.75078 WP_003414499.1.75081 WP_003414499.1.75120 WP_003414499.1.75163 WP_003414499.1.75188 WP_003414499.1.75200 WP_003414499.1.75202 WP_003414499.1.75234 WP_003414499.1.75239 WP_003414499.1.75250 WP_003414499.1.75263 WP_003414499.1.75281 WP_003414499.1.75342 WP_003414499.1.7535 WP_003414499.1.75376 WP_003414499.1.75391 WP_003414499.1.75395 WP_003414499.1.75441 WP_003414499.1.75510 WP_003414499.1.75581 WP_003414499.1.75598 WP_003414499.1.75635 WP_003414499.1.75645 WP_003414499.1.75665 WP_003414499.1.75671 WP_003414499.1.75741 WP_003414499.1.75749 WP_003414499.1.75772 WP_003414499.1.75774 WP_003414499.1.75811 WP_003414499.1.75833 WP_003414499.1.7585 WP_003414499.1.75864 WP_003414499.1.75868 WP_003414499.1.75878 WP_003414499.1.75927 WP_003414499.1.75946 WP_003414499.1.75968 WP_003414499.1.75974 WP_003414499.1.76007 WP_003414499.1.76016 WP_003414499.1.76032 WP_003414499.1.76037 WP_003414499.1.7604 WP_003414499.1.76045 WP_003414499.1.76052 WP_003414499.1.76058 WP_003414499.1.76064 WP_003414499.1.76110 WP_003414499.1.76126 WP_003414499.1.76133 WP_003414499.1.76138 WP_003414499.1.76157 WP_003414499.1.76172 WP_003414499.1.76177 WP_003414499.1.76183 WP_003414499.1.76209 WP_003414499.1.76239 WP_003414499.1.76272 WP_003414499.1.76277 WP_003414499.1.76280 WP_003414499.1.76281 WP_003414499.1.76291 WP_003414499.1.76297 WP_003414499.1.76360 WP_003414499.1.76379 WP_003414499.1.76403 WP_003414499.1.76413 WP_003414499.1.76414 WP_003414499.1.76427 WP_003414499.1.76436 WP_003414499.1.76442 WP_003414499.1.76443 WP_003414499.1.76456 WP_003414499.1.76533 WP_003414499.1.76616 WP_003414499.1.76625 WP_003414499.1.76629 WP_003414499.1.76635 WP_003414499.1.76638 WP_003414499.1.76639 WP_003414499.1.76640 WP_003414499.1.76644 WP_003414499.1.76677 WP_003414499.1.76678 WP_003414499.1.76679 WP_003414499.1.76734 WP_003414499.1.76744 WP_003414499.1.76750 WP_003414499.1.76754 WP_003414499.1.76757 WP_003414499.1.76781 WP_003414499.1.76818 WP_003414499.1.76824 WP_003414499.1.76835 WP_003414499.1.76873 WP_003414499.1.76881 WP_003414499.1.76888 WP_003414499.1.76900 WP_003414499.1.7691 WP_003414499.1.76947 WP_003414499.1.76954 WP_003414499.1.76955 WP_003414499.1.76963 WP_003414499.1.76976 WP_003414499.1.770 WP_003414499.1.77000 WP_003414499.1.77008 WP_003414499.1.77021 WP_003414499.1.77056 WP_003414499.1.77065 WP_003414499.1.77075 WP_003414499.1.77107 WP_003414499.1.77115 WP_003414499.1.77118 WP_003414499.1.77125 WP_003414499.1.77141 WP_003414499.1.77142 WP_003414499.1.77166 WP_003414499.1.77250 WP_003414499.1.77252 WP_003414499.1.77260 WP_003414499.1.77266 WP_003414499.1.77280 WP_003414499.1.77285 WP_003414499.1.77312 WP_003414499.1.77348 WP_003414499.1.77351 WP_003414499.1.77352 WP_003414499.1.77361 WP_003414499.1.774 WP_003414499.1.7740 WP_003414499.1.77404 WP_003414499.1.77425 WP_003414499.1.77463 WP_003414499.1.77474 WP_003414499.1.7748 WP_003414499.1.77484 WP_003414499.1.77491 WP_003414499.1.77499 WP_003414499.1.77510 WP_003414499.1.77530 WP_003414499.1.77554 WP_003414499.1.77559 WP_003414499.1.77599 WP_003414499.1.77605 WP_003414499.1.7762 WP_003414499.1.77627 WP_003414499.1.77649 WP_003414499.1.77654 WP_003414499.1.7766 WP_003414499.1.77667 WP_003414499.1.77704 WP_003414499.1.77706 WP_003414499.1.77726 WP_003414499.1.77774 WP_003414499.1.7778 WP_003414499.1.77790 WP_003414499.1.77809 WP_003414499.1.77820 WP_003414499.1.77843 WP_003414499.1.77855 WP_003414499.1.77865 WP_003414499.1.77868 WP_003414499.1.77890 WP_003414499.1.77909 WP_003414499.1.77911 WP_003414499.1.77931 WP_003414499.1.77984 WP_003414499.1.78020 WP_003414499.1.78024 WP_003414499.1.78075 WP_003414499.1.78084 WP_003414499.1.78086 WP_003414499.1.7809 WP_003414499.1.78098 WP_003414499.1.78105 WP_003414499.1.78113 WP_003414499.1.78136 WP_003414499.1.78162 WP_003414499.1.7817 WP_003414499.1.78200 WP_003414499.1.78216 WP_003414499.1.78236 WP_003414499.1.78238 WP_003414499.1.78338 WP_003414499.1.7836 WP_003414499.1.78360 WP_003414499.1.78386 WP_003414499.1.78429 WP_003414499.1.78435 WP_003414499.1.7844 WP_003414499.1.78459 WP_003414499.1.78488 WP_003414499.1.7849 WP_003414499.1.78499 WP_003414499.1.785 WP_003414499.1.78516 WP_003414499.1.78524 WP_003414499.1.78526 WP_003414499.1.78538 WP_003414499.1.78544 WP_003414499.1.78545 WP_003414499.1.78547 WP_003414499.1.78574 WP_003414499.1.78580 WP_003414499.1.7860 WP_003414499.1.78620 WP_003414499.1.78646 WP_003414499.1.78648 WP_003414499.1.78649 WP_003414499.1.78655 WP_003414499.1.78657 WP_003414499.1.78659 WP_003414499.1.7869 WP_003414499.1.78692 WP_003414499.1.78760 WP_003414499.1.78766 WP_003414499.1.78776 WP_003414499.1.78778 WP_003414499.1.78784 WP_003414499.1.78788 WP_003414499.1.78790 WP_003414499.1.78793 WP_003414499.1.78860 WP_003414499.1.7887 WP_003414499.1.78884 WP_003414499.1.78932 WP_003414499.1.78969 WP_003414499.1.78977 WP_003414499.1.78980 WP_003414499.1.79005 WP_003414499.1.79016 WP_003414499.1.79033 WP_003414499.1.79064 WP_003414499.1.79066 WP_003414499.1.79068 WP_003414499.1.79077 WP_003414499.1.79095 WP_003414499.1.79112 WP_003414499.1.79122 WP_003414499.1.79145 WP_003414499.1.79152 WP_003414499.1.79163 WP_003414499.1.79182 WP_003414499.1.79213 WP_003414499.1.79218 WP_003414499.1.79273 WP_003414499.1.79278 WP_003414499.1.79290 WP_003414499.1.79319 WP_003414499.1.79325 WP_003414499.1.79326 WP_003414499.1.79330 WP_003414499.1.79339 WP_003414499.1.79394 WP_003414499.1.79399 WP_003414499.1.79413 WP_003414499.1.79422 WP_003414499.1.79445 WP_003414499.1.79447 WP_003414499.1.79455 WP_003414499.1.79471 WP_003414499.1.79480 WP_003414499.1.79488 WP_003414499.1.79500 WP_003414499.1.79502 WP_003414499.1.79514 WP_003414499.1.79561 WP_003414499.1.79565 WP_003414499.1.79578 WP_003414499.1.79588 WP_003414499.1.79598 WP_003414499.1.79615 WP_003414499.1.79684 WP_003414499.1.79698 WP_003414499.1.797 WP_003414499.1.79744 WP_003414499.1.79784 WP_003414499.1.79802 WP_003414499.1.79806 WP_003414499.1.79819 WP_003414499.1.79826 WP_003414499.1.79828 WP_003414499.1.79851 WP_003414499.1.79853 WP_003414499.1.79863 WP_003414499.1.79881 WP_003414499.1.79885 WP_003414499.1.79898 WP_003414499.1.7990 WP_003414499.1.79913 WP_003414499.1.79918 WP_003414499.1.79948 WP_003414499.1.7995 WP_003414499.1.7997 WP_003414499.1.80004 WP_003414499.1.80022 WP_003414499.1.80030 WP_003414499.1.80054 WP_003414499.1.80084 WP_003414499.1.80099 WP_003414499.1.80129 WP_003414499.1.80177 WP_003414499.1.80234 WP_003414499.1.8026 WP_003414499.1.80275 WP_003414499.1.8029 WP_003414499.1.80299 WP_003414499.1.80300 WP_003414499.1.80304 WP_003414499.1.80326 WP_003414499.1.8037 WP_003414499.1.80370 WP_003414499.1.80387 WP_003414499.1.8044 WP_003414499.1.80451 WP_003414499.1.80461 WP_003414499.1.80503 WP_003414499.1.80507 WP_003414499.1.80552 WP_003414499.1.80576 WP_003414499.1.80588 WP_003414499.1.80599 WP_003414499.1.8060 WP_003414499.1.80624 WP_003414499.1.80636 WP_003414499.1.80673 WP_003414499.1.80711 WP_003414499.1.80714 WP_003414499.1.80743 WP_003414499.1.80784 WP_003414499.1.80815 WP_003414499.1.80853 WP_003414499.1.80918 WP_003414499.1.8093 WP_003414499.1.80967 WP_003414499.1.8097 WP_003414499.1.80988 WP_003414499.1.81007 WP_003414499.1.81013 WP_003414499.1.8105 WP_003414499.1.81066 WP_003414499.1.81075 WP_003414499.1.81091 WP_003414499.1.81119 WP_003414499.1.81125 WP_003414499.1.81136 WP_003414499.1.8114 WP_003414499.1.81189 WP_003414499.1.812 WP_003414499.1.81230 WP_003414499.1.81249 WP_003414499.1.81250 WP_003414499.1.81264 WP_003414499.1.8128 WP_003414499.1.81287 WP_003414499.1.81297 WP_003414499.1.8138 WP_003414499.1.81407 WP_003414499.1.8143 WP_003414499.1.81439 WP_003414499.1.81465 WP_003414499.1.81505 WP_003414499.1.81529 WP_003414499.1.81538 WP_003414499.1.81541 WP_003414499.1.81560 WP_003414499.1.81561 WP_003414499.1.81567 WP_003414499.1.81583 WP_003414499.1.81686 WP_003414499.1.81712 WP_003414499.1.81720 WP_003414499.1.81731 WP_003414499.1.81774 WP_003414499.1.81788 WP_003414499.1.81809 WP_003414499.1.81820 WP_003414499.1.81850 WP_003414499.1.81883 WP_003414499.1.81911 WP_003414499.1.81918 WP_003414499.1.82011 WP_003414499.1.82048 WP_003414499.1.82069 WP_003414499.1.82071 WP_003414499.1.82108 WP_003414499.1.82136 WP_003414499.1.82142 WP_003414499.1.8215 WP_003414499.1.82158 WP_003414499.1.8217 WP_003414499.1.82209 WP_003414499.1.82210 WP_003414499.1.82228 WP_003414499.1.82236 WP_003414499.1.82251 WP_003414499.1.82271 WP_003414499.1.82305 WP_003414499.1.82307 WP_003414499.1.82309 WP_003414499.1.82317 WP_003414499.1.8232 WP_003414499.1.82346 WP_003414499.1.82374 WP_003414499.1.82385 WP_003414499.1.82429 WP_003414499.1.82460 WP_003414499.1.82462 WP_003414499.1.82483 WP_003414499.1.82494 WP_003414499.1.82531 WP_003414499.1.82546 WP_003414499.1.82547 WP_003414499.1.82549 WP_003414499.1.82577 WP_003414499.1.82592 WP_003414499.1.82597 WP_003414499.1.82598 WP_003414499.1.82625 WP_003414499.1.82642 WP_003414499.1.82651 WP_003414499.1.82653 WP_003414499.1.82681 WP_003414499.1.82685 WP_003414499.1.8271 WP_003414499.1.82712 WP_003414499.1.8273 WP_003414499.1.82743 WP_003414499.1.82757 WP_003414499.1.82774 WP_003414499.1.82803 WP_003414499.1.82836 WP_003414499.1.82860 WP_003414499.1.82871 WP_003414499.1.82892 WP_003414499.1.82935 WP_003414499.1.82957 WP_003414499.1.82973 WP_003414499.1.82981 WP_003414499.1.82983 WP_003414499.1.83004 WP_003414499.1.83009 WP_003414499.1.83044 WP_003414499.1.83065 WP_003414499.1.83074 WP_003414499.1.83110 WP_003414499.1.83146 WP_003414499.1.83149 WP_003414499.1.83159 WP_003414499.1.8317 WP_003414499.1.83173 WP_003414499.1.83181 WP_003414499.1.83182 WP_003414499.1.83191 WP_003414499.1.83197 WP_003414499.1.83212 WP_003414499.1.8326 WP_003414499.1.83262 WP_003414499.1.83268 WP_003414499.1.83273 WP_003414499.1.83309 WP_003414499.1.83332 WP_003414499.1.83334 WP_003414499.1.83341 WP_003414499.1.83349 WP_003414499.1.8335 WP_003414499.1.83353 WP_003414499.1.83367 WP_003414499.1.83380 WP_003414499.1.83381 WP_003414499.1.83389 WP_003414499.1.83408 WP_003414499.1.83409 WP_003414499.1.83435 WP_003414499.1.83470 WP_003414499.1.83524 WP_003414499.1.83526 WP_003414499.1.8358 WP_003414499.1.83589 WP_003414499.1.83601 WP_003414499.1.83611 WP_003414499.1.83638 WP_003414499.1.83648 WP_003414499.1.83656 WP_003414499.1.83667 WP_003414499.1.83692 WP_003414499.1.83705 WP_003414499.1.83766 WP_003414499.1.83793 WP_003414499.1.83794 WP_003414499.1.83802 WP_003414499.1.83805 WP_003414499.1.83839 WP_003414499.1.83842 WP_003414499.1.83850 WP_003414499.1.83861 WP_003414499.1.83884 WP_003414499.1.83920 WP_003414499.1.83929 WP_003414499.1.83930 WP_003414499.1.83975 WP_003414499.1.83991 WP_003414499.1.8400 WP_003414499.1.84027 WP_003414499.1.8404 WP_003414499.1.84057 WP_003414499.1.84070 WP_003414499.1.8409 WP_003414499.1.84112 WP_003414499.1.84146 WP_003414499.1.8415 WP_003414499.1.84176 WP_003414499.1.84186 WP_003414499.1.84192 WP_003414499.1.84228 WP_003414499.1.8424 WP_003414499.1.84244 WP_003414499.1.84259 WP_003414499.1.8426 WP_003414499.1.84277 WP_003414499.1.84287 WP_003414499.1.8434 WP_003414499.1.84388 WP_003414499.1.84408 WP_003414499.1.84409 WP_003414499.1.84438 WP_003414499.1.84460 WP_003414499.1.84488 WP_003414499.1.84504 WP_003414499.1.84525 WP_003414499.1.84620 WP_003414499.1.84641 WP_003414499.1.84655 WP_003414499.1.84666 WP_003414499.1.84670 WP_003414499.1.84739 WP_003414499.1.84748 WP_003414499.1.84766 WP_003414499.1.84772 WP_003414499.1.84774 WP_003414499.1.848 WP_003414499.1.84812 WP_003414499.1.84836 WP_003414499.1.84839 WP_003414499.1.84846 WP_003414499.1.84873 WP_003414499.1.84938 WP_003414499.1.84968 WP_003414499.1.84973 WP_003414499.1.84981 WP_003414499.1.84985 WP_003414499.1.8503 WP_003414499.1.85038 WP_003414499.1.85041 WP_003414499.1.85043 WP_003414499.1.8505 WP_003414499.1.85074 WP_003414499.1.8509 WP_003414499.1.8512 WP_003414499.1.85148 WP_003414499.1.8518 WP_003414499.1.8522 WP_003414499.1.85242 WP_003414499.1.85281 WP_003414499.1.85284 WP_003414499.1.85314 WP_003414499.1.85319 WP_003414499.1.85330 WP_003414499.1.85341 WP_003414499.1.85346 WP_003414499.1.8535 WP_003414499.1.85363 WP_003414499.1.85371 WP_003414499.1.85377 WP_003414499.1.85387 WP_003414499.1.85399 WP_003414499.1.8546 WP_003414499.1.85464 WP_003414499.1.85478 WP_003414499.1.85488 WP_003414499.1.85495 WP_003414499.1.85551 WP_003414499.1.85557 WP_003414499.1.85577 WP_003414499.1.85597 WP_003414499.1.85599 WP_003414499.1.85610 WP_003414499.1.8563 WP_003414499.1.85648 WP_003414499.1.85679 WP_003414499.1.85704 WP_003414499.1.85727 WP_003414499.1.85737 WP_003414499.1.85763 WP_003414499.1.85808 WP_003414499.1.85819 WP_003414499.1.85820 WP_003414499.1.85823 WP_003414499.1.8586 WP_003414499.1.85894 WP_003414499.1.85913 WP_003414499.1.85953 WP_003414499.1.85986 WP_003414499.1.86000 WP_003414499.1.86025 WP_003414499.1.86032 WP_003414499.1.86048 WP_003414499.1.86052 WP_003414499.1.86067 WP_003414499.1.86122 WP_003414499.1.86124 WP_003414499.1.86160 WP_003414499.1.86164 WP_003414499.1.86168 WP_003414499.1.86190 WP_003414499.1.86204 WP_003414499.1.86208 WP_003414499.1.86235 WP_003414499.1.86249 WP_003414499.1.86260 WP_003414499.1.86290 WP_003414499.1.863 WP_003414499.1.86327 WP_003414499.1.86334 WP_003414499.1.86337 WP_003414499.1.86368 WP_003414499.1.86377 WP_003414499.1.86425 WP_003414499.1.86459 WP_003414499.1.8649 WP_003414499.1.86499 WP_003414499.1.86520 WP_003414499.1.86561 WP_003414499.1.86568 WP_003414499.1.86575 WP_003414499.1.86584 WP_003414499.1.86605 WP_003414499.1.86626 WP_003414499.1.86648 WP_003414499.1.86684 WP_003414499.1.86705 WP_003414499.1.86718 WP_003414499.1.86725 WP_003414499.1.86757 WP_003414499.1.86766 WP_003414499.1.86801 WP_003414499.1.86814 WP_003414499.1.86820 WP_003414499.1.86825 WP_003414499.1.86834 WP_003414499.1.8685 WP_003414499.1.86851 WP_003414499.1.86855 WP_003414499.1.86867 WP_003414499.1.86877 WP_003414499.1.86883 WP_003414499.1.8689 WP_003414499.1.86892 WP_003414499.1.86933 WP_003414499.1.86941 WP_003414499.1.86950 WP_003414499.1.86962 WP_003414499.1.86979 WP_003414499.1.8700 WP_003414499.1.87001 WP_003414499.1.87002 WP_003414499.1.87031 WP_003414499.1.87116 WP_003414499.1.87117 WP_003414499.1.8714 WP_003414499.1.87162 WP_003414499.1.87178 WP_003414499.1.87191 WP_003414499.1.87201 WP_003414499.1.87209 WP_003414499.1.87240 WP_003414499.1.87266 WP_003414499.1.87273 WP_003414499.1.87275 WP_003414499.1.8733 WP_003414499.1.87345 WP_003414499.1.87369 WP_003414499.1.8737 WP_003414499.1.87401 WP_003414499.1.87406 WP_003414499.1.87409 WP_003414499.1.87444 WP_003414499.1.87446 WP_003414499.1.87459 WP_003414499.1.87472 WP_003414499.1.87489 WP_003414499.1.87494 WP_003414499.1.87496 WP_003414499.1.87582 WP_003414499.1.87588 WP_003414499.1.87617 WP_003414499.1.87619 WP_003414499.1.87620 WP_003414499.1.87634 WP_003414499.1.87643 WP_003414499.1.8765 WP_003414499.1.87650 WP_003414499.1.87654 WP_003414499.1.87658 WP_003414499.1.87665 WP_003414499.1.87676 WP_003414499.1.87677 WP_003414499.1.87684 WP_003414499.1.87692 WP_003414499.1.87707 WP_003414499.1.87732 WP_003414499.1.87784 WP_003414499.1.87796 WP_003414499.1.87809 WP_003414499.1.87817 WP_003414499.1.87827 WP_003414499.1.87831 WP_003414499.1.87835 WP_003414499.1.87837 WP_003414499.1.87866 WP_003414499.1.8789 WP_003414499.1.87911 WP_003414499.1.87924 WP_003414499.1.87951 WP_003414499.1.87955 WP_003414499.1.87956 WP_003414499.1.87991 WP_003414499.1.88 WP_003414499.1.88002 WP_003414499.1.88037 WP_003414499.1.88039 WP_003414499.1.88072 WP_003414499.1.88077 WP_003414499.1.88121 WP_003414499.1.88180 WP_003414499.1.88191 WP_003414499.1.88205 WP_003414499.1.88217 WP_003414499.1.88219 WP_003414499.1.88245 WP_003414499.1.88253 WP_003414499.1.88294 WP_003414499.1.88315 WP_003414499.1.88316 WP_003414499.1.88320 WP_003414499.1.88338 WP_003414499.1.8840 WP_003414499.1.88437 WP_003414499.1.88453 WP_003414499.1.88469 WP_003414499.1.88489 WP_003414499.1.88507 WP_003414499.1.88530 WP_003414499.1.88537 WP_003414499.1.88541 WP_003414499.1.88592 WP_003414499.1.88616 WP_003414499.1.88618 WP_003414499.1.8862 WP_003414499.1.88625 WP_003414499.1.88634 WP_003414499.1.88649 WP_003414499.1.8870 WP_003414499.1.88737 WP_003414499.1.88756 WP_003414499.1.888 WP_003414499.1.88824 WP_003414499.1.88886 WP_003414499.1.88965 WP_003414499.1.88985 WP_003414499.1.8902 WP_003414499.1.89025 WP_003414499.1.89041 WP_003414499.1.89046 WP_003414499.1.89082 WP_003414499.1.89162 WP_003414499.1.89168 WP_003414499.1.8917 WP_003414499.1.89193 WP_003414499.1.89205 WP_003414499.1.89207 WP_003414499.1.89225 WP_003414499.1.8925 WP_003414499.1.89277 WP_003414499.1.89286 WP_003414499.1.89320 WP_003414499.1.8935 WP_003414499.1.89371 WP_003414499.1.89378 WP_003414499.1.89392 WP_003414499.1.89406 WP_003414499.1.8943 WP_003414499.1.89451 WP_003414499.1.89453 WP_003414499.1.89473 WP_003414499.1.89475 WP_003414499.1.89483 WP_003414499.1.895 WP_003414499.1.89513 WP_003414499.1.89517 WP_003414499.1.89522 WP_003414499.1.8954 WP_003414499.1.89543 WP_003414499.1.89567 WP_003414499.1.8957 WP_003414499.1.89572 WP_003414499.1.89589 WP_003414499.1.89607 WP_003414499.1.89613 WP_003414499.1.89625 WP_003414499.1.89648 WP_003414499.1.8967 WP_003414499.1.89670 WP_003414499.1.89676 WP_003414499.1.89729 WP_003414499.1.89739 WP_003414499.1.89762 WP_003414499.1.8977 WP_003414499.1.89808 WP_003414499.1.8982 WP_003414499.1.89829 WP_003414499.1.89831 WP_003414499.1.89844 WP_003414499.1.89849 WP_003414499.1.8989 WP_003414499.1.89901 WP_003414499.1.89903 WP_003414499.1.89909 WP_003414499.1.89922 WP_003414499.1.89926 WP_003414499.1.89963 WP_003414499.1.89971 WP_003414499.1.8998 WP_003414499.1.900 WP_003414499.1.90048 WP_003414499.1.9007 WP_003414499.1.90080 WP_003414499.1.90130 WP_003414499.1.90134 WP_003414499.1.90137 WP_003414499.1.90157 WP_003414499.1.90184 WP_003414499.1.90199 WP_003414499.1.90231 WP_003414499.1.90245 WP_003414499.1.90308 WP_003414499.1.90322 WP_003414499.1.90372 WP_003414499.1.90439 WP_003414499.1.90481 WP_003414499.1.90499 WP_003414499.1.9050 WP_003414499.1.90527 WP_003414499.1.90550 WP_003414499.1.90560 WP_003414499.1.90612 WP_003414499.1.90640 WP_003414499.1.90672 WP_003414499.1.90687 WP_003414499.1.90691 WP_003414499.1.90711 WP_003414499.1.90722 WP_003414499.1.90744 WP_003414499.1.9075 WP_003414499.1.90756 WP_003414499.1.90767 WP_003414499.1.90771 WP_003414499.1.90785 WP_003414499.1.90788 WP_003414499.1.90800 WP_003414499.1.90810 WP_003414499.1.90816 WP_003414499.1.90819 WP_003414499.1.9082 WP_003414499.1.90831 WP_003414499.1.90884 WP_003414499.1.90899 WP_003414499.1.90906 WP_003414499.1.90958 WP_003414499.1.90976 WP_003414499.1.90977 WP_003414499.1.90987 WP_003414499.1.9102 WP_003414499.1.91026 WP_003414499.1.91032 WP_003414499.1.91043 WP_003414499.1.91053 WP_003414499.1.91082 WP_003414499.1.91106 WP_003414499.1.91112 WP_003414499.1.91144 WP_003414499.1.91151 WP_003414499.1.91157 WP_003414499.1.91167 WP_003414499.1.91169 WP_003414499.1.91192 WP_003414499.1.91201 WP_003414499.1.91208 WP_003414499.1.91211 WP_003414499.1.91214 WP_003414499.1.91230 WP_003414499.1.91244 WP_003414499.1.91251 WP_003414499.1.91260 WP_003414499.1.91284 WP_003414499.1.91294 WP_003414499.1.91303 WP_003414499.1.91322 WP_003414499.1.91352 WP_003414499.1.91386 WP_003414499.1.9139 WP_003414499.1.91398 WP_003414499.1.91430 WP_003414499.1.91436 WP_003414499.1.91483 WP_003414499.1.91496 WP_003414499.1.91507 WP_003414499.1.91576 WP_003414499.1.91589 WP_003414499.1.91694 WP_003414499.1.91713 WP_003414499.1.91716 WP_003414499.1.91717 WP_003414499.1.91743 WP_003414499.1.91784 WP_003414499.1.91785 WP_003414499.1.91786 WP_003414499.1.91802 WP_003414499.1.91822 WP_003414499.1.91828 WP_003414499.1.9189 WP_003414499.1.91896 WP_003414499.1.9190 WP_003414499.1.91915 WP_003414499.1.91931 WP_003414499.1.91937 WP_003414499.1.91944 WP_003414499.1.91953 WP_003414499.1.91957 WP_003414499.1.91976 WP_003414499.1.91978 WP_003414499.1.92021 WP_003414499.1.92083 WP_003414499.1.92127 WP_003414499.1.92144 WP_003414499.1.92150 WP_003414499.1.92153 WP_003414499.1.92190 WP_003414499.1.92192 WP_003414499.1.92200 WP_003414499.1.92220 WP_003414499.1.92221 WP_003414499.1.92222 WP_003414499.1.92273 WP_003414499.1.92289 WP_003414499.1.9229 WP_003414499.1.92294 WP_003414499.1.92300 WP_003414499.1.92317 WP_003414499.1.92334 WP_003414499.1.92338 WP_003414499.1.92345 WP_003414499.1.92356 WP_003414499.1.92364 WP_003414499.1.92380 WP_003414499.1.92416 WP_003414499.1.92428 WP_003414499.1.92447 WP_003414499.1.92456 WP_003414499.1.92467 WP_003414499.1.92471 WP_003414499.1.92490 WP_003414499.1.9251 WP_003414499.1.92511 WP_003414499.1.92523 WP_003414499.1.92527 WP_003414499.1.92536 WP_003414499.1.92592 WP_003414499.1.92597 WP_003414499.1.92603 WP_003414499.1.92606 WP_003414499.1.92610 WP_003414499.1.92613 WP_003414499.1.9263 WP_003414499.1.92650 WP_003414499.1.92660 WP_003414499.1.92677 WP_003414499.1.92685 WP_003414499.1.92689 WP_003414499.1.92690 WP_003414499.1.92706 WP_003414499.1.92714 WP_003414499.1.92736 WP_003414499.1.9274 WP_003414499.1.92752 WP_003414499.1.92760 WP_003414499.1.92777 WP_003414499.1.92803 WP_003414499.1.92833 WP_003414499.1.92856 WP_003414499.1.92881 WP_003414499.1.92892 WP_003414499.1.92907 WP_003414499.1.92908 WP_003414499.1.9291 WP_003414499.1.92917 WP_003414499.1.92996 WP_003414499.1.93006 WP_003414499.1.93008 WP_003414499.1.93009 WP_003414499.1.93015 WP_003414499.1.93043 WP_003414499.1.9307 WP_003414499.1.93083 WP_003414499.1.93097 WP_003414499.1.93137 WP_003414499.1.93192 WP_003414499.1.93203 WP_003414499.1.93212 WP_003414499.1.93234 WP_003414499.1.93245 WP_003414499.1.93257 WP_003414499.1.93297 WP_003414499.1.93320 WP_003414499.1.93328 WP_003414499.1.93337 WP_003414499.1.93343 WP_003414499.1.93349 WP_003414499.1.93363 WP_003414499.1.93377 WP_003414499.1.9338 WP_003414499.1.93407 WP_003414499.1.93417 WP_003414499.1.93419 WP_003414499.1.93426 WP_003414499.1.9344 WP_003414499.1.93443 WP_003414499.1.93447 WP_003414499.1.93470 WP_003414499.1.93483 WP_003414499.1.93487 WP_003414499.1.93495 WP_003414499.1.93499 WP_003414499.1.93516 WP_003414499.1.93536 WP_003414499.1.93544 WP_003414499.1.93555 WP_003414499.1.93560 WP_003414499.1.93564 WP_003414499.1.9357 WP_003414499.1.93573 WP_003414499.1.93576 WP_003414499.1.93588 WP_003414499.1.9363 WP_003414499.1.93645 WP_003414499.1.93659 WP_003414499.1.93677 WP_003414499.1.9368 WP_003414499.1.93689 WP_003414499.1.93698 WP_003414499.1.93706 WP_003414499.1.9371 WP_003414499.1.93792 WP_003414499.1.93823 WP_003414499.1.93871 WP_003414499.1.9388 WP_003414499.1.93894 WP_003414499.1.93903 WP_003414499.1.93907 WP_003414499.1.93913 WP_003414499.1.93946 WP_003414499.1.93950 WP_003414499.1.93953 WP_003414499.1.93954 WP_003414499.1.94143 WP_003414499.1.94154 WP_003414499.1.94184 WP_003414499.1.94204 WP_003414499.1.94205 WP_003414499.1.94226 WP_003414499.1.94231 WP_003414499.1.94256 WP_003414499.1.94261 WP_003414499.1.94281 WP_003414499.1.94292 WP_003414499.1.94297 WP_003414499.1.9431 WP_003414499.1.94326 WP_003414499.1.94339 WP_003414499.1.94392 WP_003414499.1.94416 WP_003414499.1.94421 WP_003414499.1.94456 WP_003414499.1.94470 WP_003414499.1.94480 WP_003414499.1.94495 WP_003414499.1.94511 WP_003414499.1.94512 WP_003414499.1.94525 WP_003414499.1.94528 WP_003414499.1.94564 WP_003414499.1.946 WP_003414499.1.94602 WP_003414499.1.94623 WP_003414499.1.94629 WP_003414499.1.9465 WP_003414499.1.94673 WP_003414499.1.94714 WP_003414499.1.94730 WP_003414499.1.94736 WP_003414499.1.94776 WP_003414499.1.9478 WP_003414499.1.94834 WP_003414499.1.94852 WP_003414499.1.94872 WP_003414499.1.9488 WP_003414499.1.94902 WP_003414499.1.94916 WP_003414499.1.94979 WP_003414499.1.94994 WP_003414499.1.94996 WP_003414499.1.94998 WP_003414499.1.95007 WP_003414499.1.95015 WP_003414499.1.95034 WP_003414499.1.95068 WP_003414499.1.95081 WP_003414499.1.95082 WP_003414499.1.9509 WP_003414499.1.95096 WP_003414499.1.95112 WP_003414499.1.95138 WP_003414499.1.9514 WP_003414499.1.95179 WP_003414499.1.95188 WP_003414499.1.95190 WP_003414499.1.95234 WP_003414499.1.95241 WP_003414499.1.95245 WP_003414499.1.95257 WP_003414499.1.95279 WP_003414499.1.9531 WP_003414499.1.95335 WP_003414499.1.95344 WP_003414499.1.9535 WP_003414499.1.95370 WP_003414499.1.95392 WP_003414499.1.95416 WP_003414499.1.95417 WP_003414499.1.95454 WP_003414499.1.95455 WP_003414499.1.95491 WP_003414499.1.95497 WP_003414499.1.95509 WP_003414499.1.95529 WP_003414499.1.95556 WP_003414499.1.95557 WP_003414499.1.95565 WP_003414499.1.95578 WP_003414499.1.95580 WP_003414499.1.95585 WP_003414499.1.95643 WP_003414499.1.95679 WP_003414499.1.95685 WP_003414499.1.957 WP_003414499.1.95724 WP_003414499.1.95727 WP_003414499.1.95730 WP_003414499.1.95735 WP_003414499.1.95758 WP_003414499.1.95772 WP_003414499.1.95797 WP_003414499.1.95839 WP_003414499.1.9585 WP_003414499.1.9590 WP_003414499.1.95902 WP_003414499.1.95924 WP_003414499.1.95926 WP_003414499.1.95953 WP_003414499.1.95958 WP_003414499.1.95964 WP_003414499.1.95973 WP_003414499.1.96006 WP_003414499.1.9602 WP_003414499.1.96036 WP_003414499.1.96062 WP_003414499.1.96065 WP_003414499.1.96098 WP_003414499.1.96146 WP_003414499.1.96166 WP_003414499.1.96171 WP_003414499.1.96182 WP_003414499.1.96204 WP_003414499.1.96230 WP_003414499.1.96235 WP_003414499.1.96242 WP_003414499.1.96245 WP_003414499.1.96254 WP_003414499.1.96259 WP_003414499.1.96286 WP_003414499.1.96313 WP_003414499.1.96318 WP_003414499.1.96345 WP_003414499.1.96360 WP_003414499.1.96373 WP_003414499.1.96456 WP_003414499.1.96486 WP_003414499.1.96560 WP_003414499.1.96569 WP_003414499.1.96573 WP_003414499.1.96575 WP_003414499.1.96576 WP_003414499.1.96611 WP_003414499.1.96621 WP_003414499.1.9667 WP_003414499.1.96681 WP_003414499.1.96726 WP_003414499.1.96733 WP_003414499.1.96742 WP_003414499.1.96754 WP_003414499.1.9678 WP_003414499.1.96832 WP_003414499.1.9685 WP_003414499.1.97008 WP_003414499.1.97009 WP_003414499.1.97056 WP_003414499.1.97084 WP_003414499.1.97087 WP_003414499.1.97096 WP_003414499.1.97099 WP_003414499.1.97108 WP_003414499.1.97113 WP_003414499.1.97122 WP_003414499.1.97127 WP_003414499.1.97129 WP_003414499.1.97136 WP_003414499.1.9716 WP_003414499.1.97176 WP_003414499.1.97222 WP_003414499.1.97237 WP_003414499.1.97242 WP_003414499.1.97270 WP_003414499.1.97283 WP_003414499.1.97296 WP_003414499.1.97321 WP_003414499.1.97325 WP_003414499.1.97330 WP_003414499.1.97366 WP_003414499.1.97376 WP_003414499.1.97380 WP_003414499.1.9739 WP_003414499.1.97462 WP_003414499.1.97517 WP_003414499.1.97519 WP_003414499.1.97535 WP_003414499.1.97540 WP_003414499.1.97545 WP_003414499.1.97546 WP_003414499.1.97550 WP_003414499.1.97577 WP_003414499.1.97584 WP_003414499.1.9759 WP_003414499.1.97591 WP_003414499.1.97609 WP_003414499.1.97618 WP_003414499.1.9763 WP_003414499.1.97669 WP_003414499.1.97673 WP_003414499.1.97700 WP_003414499.1.97701 WP_003414499.1.9773 WP_003414499.1.97730 WP_003414499.1.97740 WP_003414499.1.97751 WP_003414499.1.97754 WP_003414499.1.97797 WP_003414499.1.9782 WP_003414499.1.97888 WP_003414499.1.9790 WP_003414499.1.9795 WP_003414499.1.97951 WP_003414499.1.97958 WP_003414499.1.97966 WP_003414499.1.97977 WP_003414499.1.97979 WP_003414499.1.97995 WP_003414499.1.98018 WP_003414499.1.98034 WP_003414499.1.98052 WP_003414499.1.98071 WP_003414499.1.98072 WP_003414499.1.98113 WP_003414499.1.98114 WP_003414499.1.98128 WP_003414499.1.98181 WP_003414499.1.98188 WP_003414499.1.98189 WP_003414499.1.98213 WP_003414499.1.98225 WP_003414499.1.98291 WP_003414499.1.98335 WP_003414499.1.98350 WP_003414499.1.98395 WP_003414499.1.98412 WP_003414499.1.98441 WP_003414499.1.98462 WP_003414499.1.9848 WP_003414499.1.98482 WP_003414499.1.98486 WP_003414499.1.98488 WP_003414499.1.98503 WP_003414499.1.98516 WP_003414499.1.98524 WP_003414499.1.98536 WP_003414499.1.98541 WP_003414499.1.98566 WP_003414499.1.98576 WP_003414499.1.98590 WP_003414499.1.98594 WP_003414499.1.98599 WP_003414499.1.98645 WP_003414499.1.98646 WP_003414499.1.98649 WP_003414499.1.98656 WP_003414499.1.9867 WP_003414499.1.98674 WP_003414499.1.98697 WP_003414499.1.98701 WP_003414499.1.98739 WP_003414499.1.98749 WP_003414499.1.98765 WP_003414499.1.98770 WP_003414499.1.98777 WP_003414499.1.98778 WP_003414499.1.98802 WP_003414499.1.98838 WP_003414499.1.98850 WP_003414499.1.98906 WP_003414499.1.98935 WP_003414499.1.98948 WP_003414499.1.98953 WP_003414499.1.98984 WP_003414499.1.99000 WP_003414499.1.99023 WP_003414499.1.99030 WP_003414499.1.99055 WP_003414499.1.99062 WP_003414499.1.99086 WP_003414499.1.99115 WP_003414499.1.99117 WP_003414499.1.99161 WP_003414499.1.99176 WP_003414499.1.99205 WP_003414499.1.99211 WP_003414499.1.99222 WP_003414499.1.99251 WP_003414499.1.99294 WP_003414499.1.99312 WP_003414499.1.99315 WP_003414499.1.99316 WP_003414499.1.99322 WP_003414499.1.99328 WP_003414499.1.99365 WP_003414499.1.99368 WP_003414499.1.99379 WP_003414499.1.99396 WP_003414499.1.99402 WP_003414499.1.99419 WP_003414499.1.99438 WP_003414499.1.99460 WP_003414499.1.99468 WP_003414499.1.99473 WP_003414499.1.99513 WP_003414499.1.99529 WP_003414499.1.99548 WP_003414499.1.99572 WP_003414499.1.99575 WP_003414499.1.99578 WP_003414499.1.99605 WP_003414499.1.99609 WP_003414499.1.99617 WP_003414499.1.99635 WP_003414499.1.99650 WP_003414499.1.99672 WP_003414499.1.99701 WP_003414499.1.99711 WP_003414499.1.99716 WP_003414499.1.99740 WP_003414499.1.99745 WP_003414499.1.99749 WP_003414499.1.9976 WP_003414499.1.99798 WP_003414499.1.99817 WP_003414499.1.99832 WP_003414499.1.99847 WP_003414499.1.99852 WP_003414499.1.99886 WP_003414499.1.99897 WP_003414499.1.99899 WP_003414499.1.99915 WP_003414499.1.99982 WP_003414499.1.99991 gi|494701266|ref|YP_007966748.1| gi|383308585|ref|YP_005361396.1| gi|392431558|ref|YP_006472602.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]