SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I6X5I7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I6X5I7
Domain Number 1 Region: 156-396
Classification Level Classification E-value
Superfamily Tetrapyrrole methylase 7.2e-70
Family Tetrapyrrole methylase 0.00000373
Further Details:      
 
Domain Number 2 Region: 7-104
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 2.06e-16
Family Siroheme synthase N-terminal domain-like 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I6X5I7
Sequence length 405
Comment (tr|I6X5I7|I6X5I7_MYCTU) Possible multifunctional enzyme siroheme synthase CysG: uroporphyrin-III C-methyltransferase (Urogen III methylase) (SUMT) (Uroporphyrinogen III methylase) (UROM) + precorrin-2 oxidase + ferrochelatas... {ECO:0000313|EMBL:CCP45648.1} KW=Complete proteome; Reference proteome OX=83332 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv). GN=Rv2847c OC=Mycobacterium; Mycobacterium tuberculosis complex.
Sequence
MTENPYLVGLRLAGKKVVVVGGGTVAQRRLPLLIASGADVHVIAPSVTPAVEAMDQITLS
VRDYRDGDLDGAWYAIAATDDARVNVAVVAEAERRRIFCVRADIAVEGTAVTPASFSYAG
LSVGVLAGGEHRRSAAIRSAIREALQQGVITAQSSDVLSGGVALVGGGPGDPELITVRGR
RLLAQADVVVADRLAPPELLAELPPHVEVIDAAKIPYGRAMAQDAINAVLIERARSGNFV
VRLKGGDPFVFARGYEEVLACAHAGIPVTVVPGVTSAIAVPAMAGVPVTHRAMTHEFVVV
SGHLAPGHPESLVNWDALAALTGTIVLLMAVERIELFVDVLLKGGRTADTPVLVVQHGTT
AAQQTLRATLADTPEKVRAAGIRPPAIIVIGAVVGLSGVRGLNNS
Download sequence
Identical sequences A0A045IEG0 A0A083VWW8 A0A0H3LH47 A0A0H3M9R7 A0A120IY00 A0A197J0Q3 A0A1R3Y2D0 A0A1S1B6N3 A5U6J9 G0TFE6 I6X5I7 L0TDJ1 M8D355 P95077
gi|253798067|ref|YP_003031068.1| gi|15842388|ref|NP_337425.1| gi|378772582|ref|YP_005172315.1| NP_215025.2.84033 WP_003414535.1.100000 WP_003414535.1.100021 WP_003414535.1.100069 WP_003414535.1.100087 WP_003414535.1.10015 WP_003414535.1.100208 WP_003414535.1.100216 WP_003414535.1.10022 WP_003414535.1.100255 WP_003414535.1.100260 WP_003414535.1.100270 WP_003414535.1.100279 WP_003414535.1.100286 WP_003414535.1.100308 WP_003414535.1.100309 WP_003414535.1.100318 WP_003414535.1.100337 WP_003414535.1.100338 WP_003414535.1.10037 WP_003414535.1.100383 WP_003414535.1.100395 WP_003414535.1.100396 WP_003414535.1.1004 WP_003414535.1.100401 WP_003414535.1.100459 WP_003414535.1.100460 WP_003414535.1.100552 WP_003414535.1.100581 WP_003414535.1.100600 WP_003414535.1.100625 WP_003414535.1.10064 WP_003414535.1.100666 WP_003414535.1.100671 WP_003414535.1.100677 WP_003414535.1.100682 WP_003414535.1.100697 WP_003414535.1.100703 WP_003414535.1.100716 WP_003414535.1.100722 WP_003414535.1.100754 WP_003414535.1.100757 WP_003414535.1.100772 WP_003414535.1.1008 WP_003414535.1.100812 WP_003414535.1.100845 WP_003414535.1.100866 WP_003414535.1.10088 WP_003414535.1.100889 WP_003414535.1.10090 WP_003414535.1.100910 WP_003414535.1.100915 WP_003414535.1.100918 WP_003414535.1.100935 WP_003414535.1.100984 WP_003414535.1.100992 WP_003414535.1.100998 WP_003414535.1.101 WP_003414535.1.101025 WP_003414535.1.101028 WP_003414535.1.10104 WP_003414535.1.101048 WP_003414535.1.101054 WP_003414535.1.101075 WP_003414535.1.101143 WP_003414535.1.101146 WP_003414535.1.10116 WP_003414535.1.10117 WP_003414535.1.101209 WP_003414535.1.10125 WP_003414535.1.101290 WP_003414535.1.101323 WP_003414535.1.101324 WP_003414535.1.101350 WP_003414535.1.101367 WP_003414535.1.101398 WP_003414535.1.101403 WP_003414535.1.101421 WP_003414535.1.10144 WP_003414535.1.101442 WP_003414535.1.10145 WP_003414535.1.101452 WP_003414535.1.101456 WP_003414535.1.101481 WP_003414535.1.101493 WP_003414535.1.101496 WP_003414535.1.101525 WP_003414535.1.101533 WP_003414535.1.101535 WP_003414535.1.101553 WP_003414535.1.101558 WP_003414535.1.10156 WP_003414535.1.101573 WP_003414535.1.101576 WP_003414535.1.10159 WP_003414535.1.101592 WP_003414535.1.101604 WP_003414535.1.101607 WP_003414535.1.101622 WP_003414535.1.101644 WP_003414535.1.101659 WP_003414535.1.101671 WP_003414535.1.101687 WP_003414535.1.101698 WP_003414535.1.10170 WP_003414535.1.101713 WP_003414535.1.101722 WP_003414535.1.101733 WP_003414535.1.101743 WP_003414535.1.101754 WP_003414535.1.101764 WP_003414535.1.101797 WP_003414535.1.101798 WP_003414535.1.101802 WP_003414535.1.101826 WP_003414535.1.101836 WP_003414535.1.101858 WP_003414535.1.101859 WP_003414535.1.101862 WP_003414535.1.101888 WP_003414535.1.101894 WP_003414535.1.101899 WP_003414535.1.1019 WP_003414535.1.101923 WP_003414535.1.101925 WP_003414535.1.10193 WP_003414535.1.101996 WP_003414535.1.102 WP_003414535.1.102008 WP_003414535.1.102017 WP_003414535.1.102053 WP_003414535.1.102055 WP_003414535.1.102063 WP_003414535.1.102099 WP_003414535.1.1021 WP_003414535.1.10211 WP_003414535.1.102119 WP_003414535.1.102121 WP_003414535.1.102143 WP_003414535.1.10216 WP_003414535.1.10224 WP_003414535.1.10253 WP_003414535.1.10262 WP_003414535.1.10272 WP_003414535.1.10277 WP_003414535.1.1033 WP_003414535.1.10350 WP_003414535.1.10362 WP_003414535.1.10366 WP_003414535.1.10376 WP_003414535.1.10396 WP_003414535.1.10410 WP_003414535.1.10414 WP_003414535.1.10421 WP_003414535.1.10430 WP_003414535.1.1044 WP_003414535.1.10440 WP_003414535.1.10445 WP_003414535.1.10471 WP_003414535.1.10472 WP_003414535.1.10489 WP_003414535.1.105 WP_003414535.1.10518 WP_003414535.1.10523 WP_003414535.1.10545 WP_003414535.1.1057 WP_003414535.1.10594 WP_003414535.1.10603 WP_003414535.1.10606 WP_003414535.1.10615 WP_003414535.1.10623 WP_003414535.1.10635 WP_003414535.1.10643 WP_003414535.1.10648 WP_003414535.1.10662 WP_003414535.1.10709 WP_003414535.1.10735 WP_003414535.1.10740 WP_003414535.1.10756 WP_003414535.1.1078 WP_003414535.1.10791 WP_003414535.1.10799 WP_003414535.1.10825 WP_003414535.1.10848 WP_003414535.1.10863 WP_003414535.1.10879 WP_003414535.1.10912 WP_003414535.1.10916 WP_003414535.1.10923 WP_003414535.1.10927 WP_003414535.1.1095 WP_003414535.1.10956 WP_003414535.1.10958 WP_003414535.1.10962 WP_003414535.1.10980 WP_003414535.1.10981 WP_003414535.1.10993 WP_003414535.1.1100 WP_003414535.1.11040 WP_003414535.1.11061 WP_003414535.1.11070 WP_003414535.1.11171 WP_003414535.1.11175 WP_003414535.1.11176 WP_003414535.1.11222 WP_003414535.1.11236 WP_003414535.1.11329 WP_003414535.1.1133 WP_003414535.1.11342 WP_003414535.1.11373 WP_003414535.1.11376 WP_003414535.1.11390 WP_003414535.1.11402 WP_003414535.1.11487 WP_003414535.1.11489 WP_003414535.1.11491 WP_003414535.1.11514 WP_003414535.1.11587 WP_003414535.1.11589 WP_003414535.1.11596 WP_003414535.1.11604 WP_003414535.1.11610 WP_003414535.1.11697 WP_003414535.1.11707 WP_003414535.1.11752 WP_003414535.1.11758 WP_003414535.1.11761 WP_003414535.1.11775 WP_003414535.1.11822 WP_003414535.1.11826 WP_003414535.1.11856 WP_003414535.1.11898 WP_003414535.1.11906 WP_003414535.1.11939 WP_003414535.1.11960 WP_003414535.1.11961 WP_003414535.1.11972 WP_003414535.1.11984 WP_003414535.1.120 WP_003414535.1.12001 WP_003414535.1.12049 WP_003414535.1.12052 WP_003414535.1.12100 WP_003414535.1.12116 WP_003414535.1.12130 WP_003414535.1.12133 WP_003414535.1.12161 WP_003414535.1.12165 WP_003414535.1.12184 WP_003414535.1.12187 WP_003414535.1.12190 WP_003414535.1.12216 WP_003414535.1.12265 WP_003414535.1.12293 WP_003414535.1.12294 WP_003414535.1.123 WP_003414535.1.1231 WP_003414535.1.12314 WP_003414535.1.12327 WP_003414535.1.12338 WP_003414535.1.1236 WP_003414535.1.12371 WP_003414535.1.12372 WP_003414535.1.12389 WP_003414535.1.12406 WP_003414535.1.1241 WP_003414535.1.12421 WP_003414535.1.12424 WP_003414535.1.12446 WP_003414535.1.12464 WP_003414535.1.12479 WP_003414535.1.12519 WP_003414535.1.12523 WP_003414535.1.12526 WP_003414535.1.1255 WP_003414535.1.12550 WP_003414535.1.12551 WP_003414535.1.12563 WP_003414535.1.12611 WP_003414535.1.12669 WP_003414535.1.1267 WP_003414535.1.12672 WP_003414535.1.12692 WP_003414535.1.1271 WP_003414535.1.12710 WP_003414535.1.12768 WP_003414535.1.1279 WP_003414535.1.12794 WP_003414535.1.12801 WP_003414535.1.12804 WP_003414535.1.12821 WP_003414535.1.12841 WP_003414535.1.12854 WP_003414535.1.12871 WP_003414535.1.12901 WP_003414535.1.12941 WP_003414535.1.12947 WP_003414535.1.12957 WP_003414535.1.12972 WP_003414535.1.13028 WP_003414535.1.13043 WP_003414535.1.13086 WP_003414535.1.13087 WP_003414535.1.13090 WP_003414535.1.13096 WP_003414535.1.13163 WP_003414535.1.13175 WP_003414535.1.13183 WP_003414535.1.132 WP_003414535.1.13249 WP_003414535.1.13282 WP_003414535.1.13284 WP_003414535.1.13296 WP_003414535.1.13298 WP_003414535.1.13302 WP_003414535.1.13306 WP_003414535.1.13312 WP_003414535.1.13313 WP_003414535.1.13321 WP_003414535.1.13345 WP_003414535.1.13358 WP_003414535.1.13370 WP_003414535.1.13375 WP_003414535.1.1338 WP_003414535.1.13420 WP_003414535.1.13433 WP_003414535.1.13435 WP_003414535.1.13438 WP_003414535.1.13461 WP_003414535.1.13466 WP_003414535.1.13489 WP_003414535.1.13526 WP_003414535.1.13551 WP_003414535.1.13564 WP_003414535.1.13579 WP_003414535.1.13647 WP_003414535.1.13667 WP_003414535.1.13687 WP_003414535.1.13697 WP_003414535.1.13719 WP_003414535.1.13763 WP_003414535.1.1377 WP_003414535.1.13774 WP_003414535.1.13786 WP_003414535.1.13793 WP_003414535.1.13794 WP_003414535.1.13817 WP_003414535.1.13834 WP_003414535.1.13866 WP_003414535.1.13880 WP_003414535.1.13899 WP_003414535.1.13909 WP_003414535.1.13910 WP_003414535.1.13919 WP_003414535.1.13920 WP_003414535.1.13952 WP_003414535.1.13953 WP_003414535.1.13962 WP_003414535.1.1398 WP_003414535.1.13988 WP_003414535.1.14027 WP_003414535.1.14046 WP_003414535.1.14115 WP_003414535.1.1415 WP_003414535.1.14152 WP_003414535.1.14158 WP_003414535.1.14162 WP_003414535.1.14175 WP_003414535.1.14178 WP_003414535.1.14194 WP_003414535.1.14195 WP_003414535.1.14208 WP_003414535.1.14238 WP_003414535.1.14266 WP_003414535.1.14273 WP_003414535.1.14303 WP_003414535.1.14306 WP_003414535.1.14307 WP_003414535.1.14310 WP_003414535.1.14341 WP_003414535.1.14382 WP_003414535.1.14416 WP_003414535.1.14428 WP_003414535.1.14441 WP_003414535.1.14469 WP_003414535.1.14477 WP_003414535.1.14504 WP_003414535.1.14514 WP_003414535.1.1452 WP_003414535.1.14527 WP_003414535.1.1454 WP_003414535.1.14544 WP_003414535.1.14548 WP_003414535.1.14551 WP_003414535.1.14561 WP_003414535.1.14573 WP_003414535.1.1462 WP_003414535.1.14658 WP_003414535.1.14667 WP_003414535.1.14668 WP_003414535.1.14675 WP_003414535.1.14694 WP_003414535.1.14695 WP_003414535.1.14709 WP_003414535.1.14766 WP_003414535.1.14783 WP_003414535.1.14865 WP_003414535.1.14872 WP_003414535.1.14905 WP_003414535.1.14926 WP_003414535.1.14951 WP_003414535.1.14955 WP_003414535.1.15003 WP_003414535.1.15009 WP_003414535.1.15028 WP_003414535.1.15040 WP_003414535.1.15052 WP_003414535.1.15065 WP_003414535.1.15072 WP_003414535.1.15089 WP_003414535.1.1509 WP_003414535.1.15126 WP_003414535.1.15131 WP_003414535.1.15168 WP_003414535.1.15172 WP_003414535.1.15174 WP_003414535.1.15187 WP_003414535.1.15196 WP_003414535.1.15210 WP_003414535.1.15216 WP_003414535.1.15217 WP_003414535.1.1523 WP_003414535.1.15232 WP_003414535.1.15238 WP_003414535.1.15240 WP_003414535.1.15253 WP_003414535.1.15267 WP_003414535.1.1527 WP_003414535.1.15292 WP_003414535.1.15299 WP_003414535.1.15302 WP_003414535.1.15322 WP_003414535.1.1534 WP_003414535.1.15345 WP_003414535.1.15365 WP_003414535.1.15386 WP_003414535.1.15387 WP_003414535.1.15442 WP_003414535.1.15447 WP_003414535.1.15449 WP_003414535.1.15477 WP_003414535.1.15481 WP_003414535.1.15492 WP_003414535.1.15511 WP_003414535.1.15512 WP_003414535.1.15558 WP_003414535.1.15559 WP_003414535.1.15566 WP_003414535.1.15599 WP_003414535.1.1560 WP_003414535.1.15611 WP_003414535.1.1563 WP_003414535.1.15633 WP_003414535.1.15643 WP_003414535.1.15688 WP_003414535.1.15755 WP_003414535.1.15763 WP_003414535.1.15774 WP_003414535.1.1578 WP_003414535.1.15780 WP_003414535.1.15827 WP_003414535.1.15834 WP_003414535.1.15842 WP_003414535.1.15848 WP_003414535.1.15853 WP_003414535.1.15870 WP_003414535.1.15877 WP_003414535.1.15893 WP_003414535.1.15896 WP_003414535.1.15926 WP_003414535.1.15946 WP_003414535.1.15958 WP_003414535.1.15973 WP_003414535.1.15987 WP_003414535.1.15993 WP_003414535.1.16009 WP_003414535.1.16025 WP_003414535.1.16066 WP_003414535.1.16069 WP_003414535.1.16077 WP_003414535.1.16106 WP_003414535.1.16108 WP_003414535.1.16110 WP_003414535.1.16130 WP_003414535.1.16136 WP_003414535.1.16139 WP_003414535.1.16143 WP_003414535.1.1630 WP_003414535.1.16318 WP_003414535.1.1632 WP_003414535.1.16327 WP_003414535.1.16334 WP_003414535.1.16341 WP_003414535.1.16345 WP_003414535.1.16374 WP_003414535.1.16384 WP_003414535.1.16386 WP_003414535.1.164 WP_003414535.1.1642 WP_003414535.1.16421 WP_003414535.1.16424 WP_003414535.1.16431 WP_003414535.1.1644 WP_003414535.1.16442 WP_003414535.1.16448 WP_003414535.1.16451 WP_003414535.1.16480 WP_003414535.1.16494 WP_003414535.1.1652 WP_003414535.1.16549 WP_003414535.1.16560 WP_003414535.1.16598 WP_003414535.1.16609 WP_003414535.1.16619 WP_003414535.1.16620 WP_003414535.1.16622 WP_003414535.1.16637 WP_003414535.1.1669 WP_003414535.1.16707 WP_003414535.1.16724 WP_003414535.1.16731 WP_003414535.1.16743 WP_003414535.1.1683 WP_003414535.1.16837 WP_003414535.1.16852 WP_003414535.1.16937 WP_003414535.1.16940 WP_003414535.1.16950 WP_003414535.1.16959 WP_003414535.1.16968 WP_003414535.1.1697 WP_003414535.1.16973 WP_003414535.1.16977 WP_003414535.1.16987 WP_003414535.1.17005 WP_003414535.1.17006 WP_003414535.1.17010 WP_003414535.1.17015 WP_003414535.1.17019 WP_003414535.1.17039 WP_003414535.1.17041 WP_003414535.1.17052 WP_003414535.1.17057 WP_003414535.1.17062 WP_003414535.1.1707 WP_003414535.1.17094 WP_003414535.1.17130 WP_003414535.1.17138 WP_003414535.1.17147 WP_003414535.1.17224 WP_003414535.1.17251 WP_003414535.1.17288 WP_003414535.1.17304 WP_003414535.1.17314 WP_003414535.1.17345 WP_003414535.1.17381 WP_003414535.1.17391 WP_003414535.1.17412 WP_003414535.1.1743 WP_003414535.1.17440 WP_003414535.1.17466 WP_003414535.1.17477 WP_003414535.1.17483 WP_003414535.1.17505 WP_003414535.1.17527 WP_003414535.1.17535 WP_003414535.1.17540 WP_003414535.1.17553 WP_003414535.1.17558 WP_003414535.1.17599 WP_003414535.1.17635 WP_003414535.1.17655 WP_003414535.1.17679 WP_003414535.1.1768 WP_003414535.1.17687 WP_003414535.1.17700 WP_003414535.1.17710 WP_003414535.1.17713 WP_003414535.1.17722 WP_003414535.1.17746 WP_003414535.1.17788 WP_003414535.1.17798 WP_003414535.1.17803 WP_003414535.1.17816 WP_003414535.1.17821 WP_003414535.1.17830 WP_003414535.1.17868 WP_003414535.1.17878 WP_003414535.1.1792 WP_003414535.1.17923 WP_003414535.1.1795 WP_003414535.1.17955 WP_003414535.1.17973 WP_003414535.1.18009 WP_003414535.1.18013 WP_003414535.1.18033 WP_003414535.1.18057 WP_003414535.1.18065 WP_003414535.1.18070 WP_003414535.1.18116 WP_003414535.1.18120 WP_003414535.1.18126 WP_003414535.1.1817 WP_003414535.1.18170 WP_003414535.1.18206 WP_003414535.1.18216 WP_003414535.1.18240 WP_003414535.1.18257 WP_003414535.1.18297 WP_003414535.1.18306 WP_003414535.1.18364 WP_003414535.1.18399 WP_003414535.1.18411 WP_003414535.1.18444 WP_003414535.1.18448 WP_003414535.1.18467 WP_003414535.1.18476 WP_003414535.1.18522 WP_003414535.1.18580 WP_003414535.1.18582 WP_003414535.1.18587 WP_003414535.1.186 WP_003414535.1.18601 WP_003414535.1.18639 WP_003414535.1.18646 WP_003414535.1.18647 WP_003414535.1.1868 WP_003414535.1.18694 WP_003414535.1.18710 WP_003414535.1.18751 WP_003414535.1.18793 WP_003414535.1.18804 WP_003414535.1.18816 WP_003414535.1.18823 WP_003414535.1.18827 WP_003414535.1.18838 WP_003414535.1.18849 WP_003414535.1.18856 WP_003414535.1.18945 WP_003414535.1.1898 WP_003414535.1.19005 WP_003414535.1.19056 WP_003414535.1.19063 WP_003414535.1.19066 WP_003414535.1.19071 WP_003414535.1.19085 WP_003414535.1.19094 WP_003414535.1.19144 WP_003414535.1.19159 WP_003414535.1.19193 WP_003414535.1.19231 WP_003414535.1.19243 WP_003414535.1.19264 WP_003414535.1.19295 WP_003414535.1.19307 WP_003414535.1.19326 WP_003414535.1.1933 WP_003414535.1.19364 WP_003414535.1.19382 WP_003414535.1.19400 WP_003414535.1.19426 WP_003414535.1.19429 WP_003414535.1.19464 WP_003414535.1.19480 WP_003414535.1.19512 WP_003414535.1.19553 WP_003414535.1.19562 WP_003414535.1.19564 WP_003414535.1.19568 WP_003414535.1.19572 WP_003414535.1.19595 WP_003414535.1.19596 WP_003414535.1.19600 WP_003414535.1.19630 WP_003414535.1.1967 WP_003414535.1.19694 WP_003414535.1.1970 WP_003414535.1.19707 WP_003414535.1.19742 WP_003414535.1.19785 WP_003414535.1.19820 WP_003414535.1.19868 WP_003414535.1.19874 WP_003414535.1.19890 WP_003414535.1.19900 WP_003414535.1.19922 WP_003414535.1.19936 WP_003414535.1.19946 WP_003414535.1.19949 WP_003414535.1.19960 WP_003414535.1.19964 WP_003414535.1.20007 WP_003414535.1.20016 WP_003414535.1.20028 WP_003414535.1.2003 WP_003414535.1.20037 WP_003414535.1.20039 WP_003414535.1.20082 WP_003414535.1.20085 WP_003414535.1.20097 WP_003414535.1.20116 WP_003414535.1.20130 WP_003414535.1.20140 WP_003414535.1.20141 WP_003414535.1.20142 WP_003414535.1.20158 WP_003414535.1.20239 WP_003414535.1.20243 WP_003414535.1.20259 WP_003414535.1.20262 WP_003414535.1.20268 WP_003414535.1.20272 WP_003414535.1.20273 WP_003414535.1.20280 WP_003414535.1.20294 WP_003414535.1.20300 WP_003414535.1.20309 WP_003414535.1.20322 WP_003414535.1.2037 WP_003414535.1.20372 WP_003414535.1.20381 WP_003414535.1.204 WP_003414535.1.20427 WP_003414535.1.20432 WP_003414535.1.20457 WP_003414535.1.20459 WP_003414535.1.20460 WP_003414535.1.20542 WP_003414535.1.20578 WP_003414535.1.20608 WP_003414535.1.20624 WP_003414535.1.20628 WP_003414535.1.2066 WP_003414535.1.20707 WP_003414535.1.20722 WP_003414535.1.20729 WP_003414535.1.20742 WP_003414535.1.20751 WP_003414535.1.20776 WP_003414535.1.20843 WP_003414535.1.20850 WP_003414535.1.2086 WP_003414535.1.20868 WP_003414535.1.20876 WP_003414535.1.20897 WP_003414535.1.20898 WP_003414535.1.2090 WP_003414535.1.20911 WP_003414535.1.20916 WP_003414535.1.20921 WP_003414535.1.20926 WP_003414535.1.20927 WP_003414535.1.20951 WP_003414535.1.20970 WP_003414535.1.2104 WP_003414535.1.21070 WP_003414535.1.21127 WP_003414535.1.21135 WP_003414535.1.21173 WP_003414535.1.21187 WP_003414535.1.212 WP_003414535.1.2120 WP_003414535.1.21218 WP_003414535.1.21219 WP_003414535.1.2123 WP_003414535.1.21231 WP_003414535.1.21234 WP_003414535.1.2126 WP_003414535.1.21292 WP_003414535.1.21307 WP_003414535.1.2131 WP_003414535.1.21311 WP_003414535.1.21321 WP_003414535.1.21365 WP_003414535.1.2137 WP_003414535.1.21392 WP_003414535.1.21397 WP_003414535.1.21403 WP_003414535.1.21415 WP_003414535.1.21418 WP_003414535.1.21430 WP_003414535.1.21434 WP_003414535.1.21444 WP_003414535.1.21468 WP_003414535.1.21498 WP_003414535.1.21509 WP_003414535.1.21513 WP_003414535.1.21560 WP_003414535.1.21565 WP_003414535.1.21586 WP_003414535.1.21591 WP_003414535.1.21594 WP_003414535.1.21602 WP_003414535.1.21615 WP_003414535.1.21638 WP_003414535.1.21639 WP_003414535.1.21655 WP_003414535.1.21658 WP_003414535.1.2168 WP_003414535.1.2174 WP_003414535.1.21741 WP_003414535.1.21742 WP_003414535.1.21777 WP_003414535.1.21786 WP_003414535.1.21795 WP_003414535.1.218 WP_003414535.1.21826 WP_003414535.1.21829 WP_003414535.1.21840 WP_003414535.1.21843 WP_003414535.1.21872 WP_003414535.1.21873 WP_003414535.1.2188 WP_003414535.1.21882 WP_003414535.1.21906 WP_003414535.1.21912 WP_003414535.1.2194 WP_003414535.1.21941 WP_003414535.1.21956 WP_003414535.1.21958 WP_003414535.1.21960 WP_003414535.1.21971 WP_003414535.1.21973 WP_003414535.1.21983 WP_003414535.1.22003 WP_003414535.1.22013 WP_003414535.1.22025 WP_003414535.1.22036 WP_003414535.1.22075 WP_003414535.1.22092 WP_003414535.1.2212 WP_003414535.1.22127 WP_003414535.1.22140 WP_003414535.1.22233 WP_003414535.1.22255 WP_003414535.1.22277 WP_003414535.1.22305 WP_003414535.1.22348 WP_003414535.1.22356 WP_003414535.1.22366 WP_003414535.1.2238 WP_003414535.1.22380 WP_003414535.1.22437 WP_003414535.1.22438 WP_003414535.1.22445 WP_003414535.1.22490 WP_003414535.1.22511 WP_003414535.1.2253 WP_003414535.1.22585 WP_003414535.1.22589 WP_003414535.1.22606 WP_003414535.1.22608 WP_003414535.1.22609 WP_003414535.1.22618 WP_003414535.1.2262 WP_003414535.1.22624 WP_003414535.1.22629 WP_003414535.1.22647 WP_003414535.1.22664 WP_003414535.1.22665 WP_003414535.1.22670 WP_003414535.1.22674 WP_003414535.1.22680 WP_003414535.1.22725 WP_003414535.1.22728 WP_003414535.1.22733 WP_003414535.1.22737 WP_003414535.1.2275 WP_003414535.1.22754 WP_003414535.1.22797 WP_003414535.1.22800 WP_003414535.1.22804 WP_003414535.1.22829 WP_003414535.1.22840 WP_003414535.1.22844 WP_003414535.1.22963 WP_003414535.1.22970 WP_003414535.1.22996 WP_003414535.1.22997 WP_003414535.1.22999 WP_003414535.1.23015 WP_003414535.1.23032 WP_003414535.1.231 WP_003414535.1.23101 WP_003414535.1.2312 WP_003414535.1.23140 WP_003414535.1.23153 WP_003414535.1.23171 WP_003414535.1.23199 WP_003414535.1.2320 WP_003414535.1.23204 WP_003414535.1.23216 WP_003414535.1.23229 WP_003414535.1.23233 WP_003414535.1.2326 WP_003414535.1.23261 WP_003414535.1.23272 WP_003414535.1.23289 WP_003414535.1.2329 WP_003414535.1.23308 WP_003414535.1.23316 WP_003414535.1.23321 WP_003414535.1.23325 WP_003414535.1.2339 WP_003414535.1.23406 WP_003414535.1.23438 WP_003414535.1.23445 WP_003414535.1.23447 WP_003414535.1.23452 WP_003414535.1.23461 WP_003414535.1.2349 WP_003414535.1.23496 WP_003414535.1.23497 WP_003414535.1.23506 WP_003414535.1.23530 WP_003414535.1.23539 WP_003414535.1.23546 WP_003414535.1.23551 WP_003414535.1.23573 WP_003414535.1.23583 WP_003414535.1.23588 WP_003414535.1.23628 WP_003414535.1.23677 WP_003414535.1.23683 WP_003414535.1.23692 WP_003414535.1.23694 WP_003414535.1.23699 WP_003414535.1.2371 WP_003414535.1.23807 WP_003414535.1.23825 WP_003414535.1.23832 WP_003414535.1.2384 WP_003414535.1.23843 WP_003414535.1.23863 WP_003414535.1.2387 WP_003414535.1.23894 WP_003414535.1.23993 WP_003414535.1.2400 WP_003414535.1.24007 WP_003414535.1.24008 WP_003414535.1.24046 WP_003414535.1.24057 WP_003414535.1.24062 WP_003414535.1.24113 WP_003414535.1.24119 WP_003414535.1.24128 WP_003414535.1.24140 WP_003414535.1.24176 WP_003414535.1.24190 WP_003414535.1.24202 WP_003414535.1.24244 WP_003414535.1.24261 WP_003414535.1.24284 WP_003414535.1.24294 WP_003414535.1.24357 WP_003414535.1.24396 WP_003414535.1.24414 WP_003414535.1.24423 WP_003414535.1.2443 WP_003414535.1.24446 WP_003414535.1.24461 WP_003414535.1.24500 WP_003414535.1.24507 WP_003414535.1.24509 WP_003414535.1.24529 WP_003414535.1.24553 WP_003414535.1.24599 WP_003414535.1.24629 WP_003414535.1.24638 WP_003414535.1.24648 WP_003414535.1.2466 WP_003414535.1.24767 WP_003414535.1.24824 WP_003414535.1.24831 WP_003414535.1.24840 WP_003414535.1.24848 WP_003414535.1.24857 WP_003414535.1.2487 WP_003414535.1.24893 WP_003414535.1.24907 WP_003414535.1.24933 WP_003414535.1.24956 WP_003414535.1.24958 WP_003414535.1.24985 WP_003414535.1.2499 WP_003414535.1.25004 WP_003414535.1.2505 WP_003414535.1.25051 WP_003414535.1.2507 WP_003414535.1.25096 WP_003414535.1.25103 WP_003414535.1.25129 WP_003414535.1.25171 WP_003414535.1.25184 WP_003414535.1.25247 WP_003414535.1.25252 WP_003414535.1.25278 WP_003414535.1.25283 WP_003414535.1.25309 WP_003414535.1.25313 WP_003414535.1.25338 WP_003414535.1.25342 WP_003414535.1.25343 WP_003414535.1.25367 WP_003414535.1.25393 WP_003414535.1.25406 WP_003414535.1.25435 WP_003414535.1.25437 WP_003414535.1.25445 WP_003414535.1.25455 WP_003414535.1.25473 WP_003414535.1.25504 WP_003414535.1.25513 WP_003414535.1.25542 WP_003414535.1.25579 WP_003414535.1.25594 WP_003414535.1.25606 WP_003414535.1.25645 WP_003414535.1.2566 WP_003414535.1.25673 WP_003414535.1.25674 WP_003414535.1.25693 WP_003414535.1.25699 WP_003414535.1.25727 WP_003414535.1.25736 WP_003414535.1.25738 WP_003414535.1.25756 WP_003414535.1.25759 WP_003414535.1.2580 WP_003414535.1.25813 WP_003414535.1.25853 WP_003414535.1.25854 WP_003414535.1.25874 WP_003414535.1.25885 WP_003414535.1.25892 WP_003414535.1.25906 WP_003414535.1.25914 WP_003414535.1.25916 WP_003414535.1.2594 WP_003414535.1.25954 WP_003414535.1.25965 WP_003414535.1.25972 WP_003414535.1.26017 WP_003414535.1.26032 WP_003414535.1.26038 WP_003414535.1.26072 WP_003414535.1.26089 WP_003414535.1.26097 WP_003414535.1.26098 WP_003414535.1.26108 WP_003414535.1.26109 WP_003414535.1.26118 WP_003414535.1.26126 WP_003414535.1.2614 WP_003414535.1.26168 WP_003414535.1.26182 WP_003414535.1.26190 WP_003414535.1.2620 WP_003414535.1.26234 WP_003414535.1.26243 WP_003414535.1.26265 WP_003414535.1.26267 WP_003414535.1.26292 WP_003414535.1.26310 WP_003414535.1.26328 WP_003414535.1.26349 WP_003414535.1.26366 WP_003414535.1.26374 WP_003414535.1.26407 WP_003414535.1.26412 WP_003414535.1.26454 WP_003414535.1.26464 WP_003414535.1.2653 WP_003414535.1.26560 WP_003414535.1.26571 WP_003414535.1.2659 WP_003414535.1.26597 WP_003414535.1.26603 WP_003414535.1.26629 WP_003414535.1.26702 WP_003414535.1.26707 WP_003414535.1.26710 WP_003414535.1.26719 WP_003414535.1.26737 WP_003414535.1.26738 WP_003414535.1.26745 WP_003414535.1.26756 WP_003414535.1.2676 WP_003414535.1.2677 WP_003414535.1.26779 WP_003414535.1.26780 WP_003414535.1.26798 WP_003414535.1.26854 WP_003414535.1.26868 WP_003414535.1.26876 WP_003414535.1.26888 WP_003414535.1.26914 WP_003414535.1.26945 WP_003414535.1.26959 WP_003414535.1.26969 WP_003414535.1.26984 WP_003414535.1.26992 WP_003414535.1.27004 WP_003414535.1.27017 WP_003414535.1.27045 WP_003414535.1.27074 WP_003414535.1.27075 WP_003414535.1.27128 WP_003414535.1.27130 WP_003414535.1.27139 WP_003414535.1.27152 WP_003414535.1.27162 WP_003414535.1.27164 WP_003414535.1.27193 WP_003414535.1.27235 WP_003414535.1.27254 WP_003414535.1.27278 WP_003414535.1.27343 WP_003414535.1.27352 WP_003414535.1.27369 WP_003414535.1.27391 WP_003414535.1.27398 WP_003414535.1.27402 WP_003414535.1.27410 WP_003414535.1.27411 WP_003414535.1.27449 WP_003414535.1.27460 WP_003414535.1.27463 WP_003414535.1.2749 WP_003414535.1.27492 WP_003414535.1.27528 WP_003414535.1.27541 WP_003414535.1.27576 WP_003414535.1.27582 WP_003414535.1.27596 WP_003414535.1.27607 WP_003414535.1.2766 WP_003414535.1.277 WP_003414535.1.27724 WP_003414535.1.27730 WP_003414535.1.27736 WP_003414535.1.27743 WP_003414535.1.27750 WP_003414535.1.27771 WP_003414535.1.27779 WP_003414535.1.27795 WP_003414535.1.27803 WP_003414535.1.27819 WP_003414535.1.27915 WP_003414535.1.27935 WP_003414535.1.27962 WP_003414535.1.28053 WP_003414535.1.28092 WP_003414535.1.28106 WP_003414535.1.28131 WP_003414535.1.28142 WP_003414535.1.28159 WP_003414535.1.2816 WP_003414535.1.28161 WP_003414535.1.28192 WP_003414535.1.28202 WP_003414535.1.28241 WP_003414535.1.28242 WP_003414535.1.28251 WP_003414535.1.28255 WP_003414535.1.28269 WP_003414535.1.28276 WP_003414535.1.28293 WP_003414535.1.28331 WP_003414535.1.28367 WP_003414535.1.28378 WP_003414535.1.28391 WP_003414535.1.2842 WP_003414535.1.28448 WP_003414535.1.28471 WP_003414535.1.28473 WP_003414535.1.28493 WP_003414535.1.28497 WP_003414535.1.28530 WP_003414535.1.28545 WP_003414535.1.28561 WP_003414535.1.28567 WP_003414535.1.28585 WP_003414535.1.286 WP_003414535.1.28610 WP_003414535.1.28617 WP_003414535.1.28634 WP_003414535.1.28642 WP_003414535.1.28671 WP_003414535.1.28682 WP_003414535.1.28698 WP_003414535.1.28703 WP_003414535.1.28739 WP_003414535.1.28758 WP_003414535.1.28781 WP_003414535.1.28787 WP_003414535.1.28827 WP_003414535.1.28839 WP_003414535.1.28847 WP_003414535.1.28850 WP_003414535.1.28851 WP_003414535.1.28865 WP_003414535.1.28897 WP_003414535.1.28914 WP_003414535.1.28935 WP_003414535.1.28936 WP_003414535.1.28939 WP_003414535.1.28943 WP_003414535.1.28952 WP_003414535.1.28975 WP_003414535.1.2899 WP_003414535.1.28993 WP_003414535.1.29000 WP_003414535.1.2901 WP_003414535.1.29028 WP_003414535.1.29033 WP_003414535.1.29058 WP_003414535.1.29078 WP_003414535.1.29102 WP_003414535.1.29115 WP_003414535.1.2916 WP_003414535.1.29217 WP_003414535.1.29223 WP_003414535.1.29234 WP_003414535.1.29264 WP_003414535.1.29275 WP_003414535.1.29306 WP_003414535.1.29339 WP_003414535.1.29348 WP_003414535.1.29364 WP_003414535.1.29367 WP_003414535.1.2944 WP_003414535.1.29449 WP_003414535.1.29450 WP_003414535.1.29452 WP_003414535.1.2949 WP_003414535.1.29510 WP_003414535.1.29515 WP_003414535.1.29525 WP_003414535.1.2953 WP_003414535.1.29559 WP_003414535.1.29587 WP_003414535.1.2959 WP_003414535.1.29592 WP_003414535.1.29599 WP_003414535.1.29611 WP_003414535.1.29632 WP_003414535.1.29649 WP_003414535.1.2965 WP_003414535.1.29659 WP_003414535.1.2969 WP_003414535.1.29696 WP_003414535.1.29698 WP_003414535.1.29718 WP_003414535.1.29742 WP_003414535.1.29745 WP_003414535.1.29747 WP_003414535.1.29769 WP_003414535.1.29825 WP_003414535.1.29830 WP_003414535.1.29847 WP_003414535.1.29861 WP_003414535.1.29869 WP_003414535.1.29883 WP_003414535.1.29890 WP_003414535.1.29931 WP_003414535.1.30014 WP_003414535.1.3004 WP_003414535.1.30040 WP_003414535.1.30074 WP_003414535.1.30097 WP_003414535.1.30101 WP_003414535.1.30106 WP_003414535.1.30114 WP_003414535.1.30126 WP_003414535.1.30131 WP_003414535.1.30138 WP_003414535.1.30139 WP_003414535.1.30145 WP_003414535.1.30224 WP_003414535.1.30235 WP_003414535.1.30237 WP_003414535.1.3027 WP_003414535.1.30279 WP_003414535.1.30282 WP_003414535.1.30283 WP_003414535.1.30288 WP_003414535.1.30291 WP_003414535.1.30363 WP_003414535.1.30374 WP_003414535.1.30404 WP_003414535.1.3043 WP_003414535.1.30433 WP_003414535.1.30438 WP_003414535.1.30462 WP_003414535.1.30464 WP_003414535.1.30468 WP_003414535.1.30500 WP_003414535.1.3057 WP_003414535.1.30574 WP_003414535.1.30628 WP_003414535.1.30641 WP_003414535.1.30642 WP_003414535.1.30661 WP_003414535.1.30669 WP_003414535.1.30683 WP_003414535.1.30699 WP_003414535.1.30709 WP_003414535.1.30713 WP_003414535.1.30716 WP_003414535.1.30719 WP_003414535.1.30730 WP_003414535.1.30732 WP_003414535.1.30736 WP_003414535.1.30745 WP_003414535.1.30760 WP_003414535.1.30791 WP_003414535.1.308 WP_003414535.1.30807 WP_003414535.1.30818 WP_003414535.1.30824 WP_003414535.1.30877 WP_003414535.1.30888 WP_003414535.1.30901 WP_003414535.1.30903 WP_003414535.1.30912 WP_003414535.1.30913 WP_003414535.1.30914 WP_003414535.1.30919 WP_003414535.1.30977 WP_003414535.1.3100 WP_003414535.1.31002 WP_003414535.1.3101 WP_003414535.1.31034 WP_003414535.1.31047 WP_003414535.1.31074 WP_003414535.1.31102 WP_003414535.1.31127 WP_003414535.1.31184 WP_003414535.1.31199 WP_003414535.1.31226 WP_003414535.1.31230 WP_003414535.1.31233 WP_003414535.1.31263 WP_003414535.1.31264 WP_003414535.1.31270 WP_003414535.1.31287 WP_003414535.1.31290 WP_003414535.1.31304 WP_003414535.1.31346 WP_003414535.1.31348 WP_003414535.1.31354 WP_003414535.1.31390 WP_003414535.1.31414 WP_003414535.1.31417 WP_003414535.1.31428 WP_003414535.1.3143 WP_003414535.1.31458 WP_003414535.1.31483 WP_003414535.1.3149 WP_003414535.1.31498 WP_003414535.1.31507 WP_003414535.1.31548 WP_003414535.1.31569 WP_003414535.1.316 WP_003414535.1.31629 WP_003414535.1.31666 WP_003414535.1.31693 WP_003414535.1.31744 WP_003414535.1.31770 WP_003414535.1.31776 WP_003414535.1.31783 WP_003414535.1.318 WP_003414535.1.3184 WP_003414535.1.31840 WP_003414535.1.31880 WP_003414535.1.31930 WP_003414535.1.31932 WP_003414535.1.31955 WP_003414535.1.31985 WP_003414535.1.31991 WP_003414535.1.31995 WP_003414535.1.32004 WP_003414535.1.32039 WP_003414535.1.3204 WP_003414535.1.32045 WP_003414535.1.32071 WP_003414535.1.32098 WP_003414535.1.32132 WP_003414535.1.32157 WP_003414535.1.32164 WP_003414535.1.32179 WP_003414535.1.32198 WP_003414535.1.32297 WP_003414535.1.32317 WP_003414535.1.32383 WP_003414535.1.32403 WP_003414535.1.32416 WP_003414535.1.32433 WP_003414535.1.32461 WP_003414535.1.32482 WP_003414535.1.32503 WP_003414535.1.32556 WP_003414535.1.32562 WP_003414535.1.32569 WP_003414535.1.32592 WP_003414535.1.32620 WP_003414535.1.32647 WP_003414535.1.32653 WP_003414535.1.32654 WP_003414535.1.3268 WP_003414535.1.32695 WP_003414535.1.32706 WP_003414535.1.32716 WP_003414535.1.32738 WP_003414535.1.32752 WP_003414535.1.32780 WP_003414535.1.32781 WP_003414535.1.32793 WP_003414535.1.32799 WP_003414535.1.32822 WP_003414535.1.32833 WP_003414535.1.32862 WP_003414535.1.32880 WP_003414535.1.32909 WP_003414535.1.32935 WP_003414535.1.32974 WP_003414535.1.33007 WP_003414535.1.3302 WP_003414535.1.33028 WP_003414535.1.33035 WP_003414535.1.33044 WP_003414535.1.33054 WP_003414535.1.33141 WP_003414535.1.33155 WP_003414535.1.33168 WP_003414535.1.3321 WP_003414535.1.33215 WP_003414535.1.3325 WP_003414535.1.3327 WP_003414535.1.33278 WP_003414535.1.33288 WP_003414535.1.33305 WP_003414535.1.3331 WP_003414535.1.33319 WP_003414535.1.3333 WP_003414535.1.33393 WP_003414535.1.33403 WP_003414535.1.33452 WP_003414535.1.33467 WP_003414535.1.33477 WP_003414535.1.3349 WP_003414535.1.33519 WP_003414535.1.33542 WP_003414535.1.33601 WP_003414535.1.33602 WP_003414535.1.33633 WP_003414535.1.33646 WP_003414535.1.33673 WP_003414535.1.3369 WP_003414535.1.33705 WP_003414535.1.33762 WP_003414535.1.33783 WP_003414535.1.33789 WP_003414535.1.3383 WP_003414535.1.33832 WP_003414535.1.33839 WP_003414535.1.33848 WP_003414535.1.3387 WP_003414535.1.33886 WP_003414535.1.33895 WP_003414535.1.33906 WP_003414535.1.33912 WP_003414535.1.33954 WP_003414535.1.3399 WP_003414535.1.34042 WP_003414535.1.3405 WP_003414535.1.34055 WP_003414535.1.34056 WP_003414535.1.34065 WP_003414535.1.3408 WP_003414535.1.34090 WP_003414535.1.34109 WP_003414535.1.34111 WP_003414535.1.34131 WP_003414535.1.34152 WP_003414535.1.34153 WP_003414535.1.34163 WP_003414535.1.34181 WP_003414535.1.34197 WP_003414535.1.34198 WP_003414535.1.34215 WP_003414535.1.34219 WP_003414535.1.34255 WP_003414535.1.34260 WP_003414535.1.34275 WP_003414535.1.343 WP_003414535.1.34347 WP_003414535.1.34358 WP_003414535.1.344 WP_003414535.1.34428 WP_003414535.1.3443 WP_003414535.1.34435 WP_003414535.1.34446 WP_003414535.1.34499 WP_003414535.1.34505 WP_003414535.1.34516 WP_003414535.1.34529 WP_003414535.1.34551 WP_003414535.1.34563 WP_003414535.1.34576 WP_003414535.1.34581 WP_003414535.1.34588 WP_003414535.1.34596 WP_003414535.1.34599 WP_003414535.1.34639 WP_003414535.1.34673 WP_003414535.1.34724 WP_003414535.1.34740 WP_003414535.1.34755 WP_003414535.1.34777 WP_003414535.1.34783 WP_003414535.1.34841 WP_003414535.1.34908 WP_003414535.1.34919 WP_003414535.1.3492 WP_003414535.1.34933 WP_003414535.1.34945 WP_003414535.1.34946 WP_003414535.1.34954 WP_003414535.1.34960 WP_003414535.1.34961 WP_003414535.1.34963 WP_003414535.1.34965 WP_003414535.1.34968 WP_003414535.1.35023 WP_003414535.1.35069 WP_003414535.1.35072 WP_003414535.1.35078 WP_003414535.1.35100 WP_003414535.1.35146 WP_003414535.1.35156 WP_003414535.1.35160 WP_003414535.1.35162 WP_003414535.1.35173 WP_003414535.1.35176 WP_003414535.1.3520 WP_003414535.1.35213 WP_003414535.1.35221 WP_003414535.1.35246 WP_003414535.1.35278 WP_003414535.1.35301 WP_003414535.1.35311 WP_003414535.1.35312 WP_003414535.1.35317 WP_003414535.1.35319 WP_003414535.1.35347 WP_003414535.1.35363 WP_003414535.1.35382 WP_003414535.1.35385 WP_003414535.1.35396 WP_003414535.1.35397 WP_003414535.1.35426 WP_003414535.1.35439 WP_003414535.1.35455 WP_003414535.1.3548 WP_003414535.1.35484 WP_003414535.1.35492 WP_003414535.1.3553 WP_003414535.1.35553 WP_003414535.1.35555 WP_003414535.1.35561 WP_003414535.1.35602 WP_003414535.1.35610 WP_003414535.1.35635 WP_003414535.1.35657 WP_003414535.1.35680 WP_003414535.1.35687 WP_003414535.1.35689 WP_003414535.1.35707 WP_003414535.1.35732 WP_003414535.1.35754 WP_003414535.1.35767 WP_003414535.1.35770 WP_003414535.1.35771 WP_003414535.1.35780 WP_003414535.1.35805 WP_003414535.1.35811 WP_003414535.1.35821 WP_003414535.1.3584 WP_003414535.1.35848 WP_003414535.1.35864 WP_003414535.1.35874 WP_003414535.1.35876 WP_003414535.1.35897 WP_003414535.1.35899 WP_003414535.1.35923 WP_003414535.1.3593 WP_003414535.1.35954 WP_003414535.1.36005 WP_003414535.1.36014 WP_003414535.1.36023 WP_003414535.1.36051 WP_003414535.1.36053 WP_003414535.1.36075 WP_003414535.1.36089 WP_003414535.1.36097 WP_003414535.1.36098 WP_003414535.1.36116 WP_003414535.1.36145 WP_003414535.1.36156 WP_003414535.1.36205 WP_003414535.1.36228 WP_003414535.1.36246 WP_003414535.1.36252 WP_003414535.1.36260 WP_003414535.1.36270 WP_003414535.1.36271 WP_003414535.1.36303 WP_003414535.1.36309 WP_003414535.1.36315 WP_003414535.1.36319 WP_003414535.1.36321 WP_003414535.1.36326 WP_003414535.1.3634 WP_003414535.1.36356 WP_003414535.1.36357 WP_003414535.1.3636 WP_003414535.1.36385 WP_003414535.1.36399 WP_003414535.1.36436 WP_003414535.1.36465 WP_003414535.1.36469 WP_003414535.1.36473 WP_003414535.1.36485 WP_003414535.1.36508 WP_003414535.1.36540 WP_003414535.1.36561 WP_003414535.1.36571 WP_003414535.1.36573 WP_003414535.1.36578 WP_003414535.1.36585 WP_003414535.1.36597 WP_003414535.1.36614 WP_003414535.1.36657 WP_003414535.1.36674 WP_003414535.1.36720 WP_003414535.1.36727 WP_003414535.1.36733 WP_003414535.1.36785 WP_003414535.1.36810 WP_003414535.1.36844 WP_003414535.1.36851 WP_003414535.1.36862 WP_003414535.1.36893 WP_003414535.1.36921 WP_003414535.1.36935 WP_003414535.1.36941 WP_003414535.1.3695 WP_003414535.1.36951 WP_003414535.1.36968 WP_003414535.1.3700 WP_003414535.1.37004 WP_003414535.1.37012 WP_003414535.1.37071 WP_003414535.1.37088 WP_003414535.1.37131 WP_003414535.1.37157 WP_003414535.1.37175 WP_003414535.1.37188 WP_003414535.1.37213 WP_003414535.1.37229 WP_003414535.1.3724 WP_003414535.1.37277 WP_003414535.1.37305 WP_003414535.1.37330 WP_003414535.1.37389 WP_003414535.1.37400 WP_003414535.1.37440 WP_003414535.1.37459 WP_003414535.1.37468 WP_003414535.1.37475 WP_003414535.1.37484 WP_003414535.1.37601 WP_003414535.1.37612 WP_003414535.1.37632 WP_003414535.1.37643 WP_003414535.1.37655 WP_003414535.1.37660 WP_003414535.1.37674 WP_003414535.1.37700 WP_003414535.1.37701 WP_003414535.1.37709 WP_003414535.1.37711 WP_003414535.1.37721 WP_003414535.1.37722 WP_003414535.1.37747 WP_003414535.1.37765 WP_003414535.1.37772 WP_003414535.1.37809 WP_003414535.1.37859 WP_003414535.1.37877 WP_003414535.1.37913 WP_003414535.1.37943 WP_003414535.1.37950 WP_003414535.1.37973 WP_003414535.1.37975 WP_003414535.1.37983 WP_003414535.1.38 WP_003414535.1.38002 WP_003414535.1.3802 WP_003414535.1.38039 WP_003414535.1.38040 WP_003414535.1.38067 WP_003414535.1.38068 WP_003414535.1.38135 WP_003414535.1.38138 WP_003414535.1.38144 WP_003414535.1.38158 WP_003414535.1.38159 WP_003414535.1.38210 WP_003414535.1.38233 WP_003414535.1.38240 WP_003414535.1.38299 WP_003414535.1.38332 WP_003414535.1.38347 WP_003414535.1.38354 WP_003414535.1.38380 WP_003414535.1.38384 WP_003414535.1.38389 WP_003414535.1.38398 WP_003414535.1.38402 WP_003414535.1.38418 WP_003414535.1.38421 WP_003414535.1.38466 WP_003414535.1.38477 WP_003414535.1.38483 WP_003414535.1.3849 WP_003414535.1.385 WP_003414535.1.38530 WP_003414535.1.38535 WP_003414535.1.38539 WP_003414535.1.38594 WP_003414535.1.38601 WP_003414535.1.38611 WP_003414535.1.38638 WP_003414535.1.38639 WP_003414535.1.38646 WP_003414535.1.38648 WP_003414535.1.38654 WP_003414535.1.38659 WP_003414535.1.38660 WP_003414535.1.38666 WP_003414535.1.38671 WP_003414535.1.38672 WP_003414535.1.38750 WP_003414535.1.38772 WP_003414535.1.38812 WP_003414535.1.38821 WP_003414535.1.38844 WP_003414535.1.38863 WP_003414535.1.38873 WP_003414535.1.3889 WP_003414535.1.38894 WP_003414535.1.38909 WP_003414535.1.38939 WP_003414535.1.38974 WP_003414535.1.38975 WP_003414535.1.38991 WP_003414535.1.39025 WP_003414535.1.39070 WP_003414535.1.39072 WP_003414535.1.39095 WP_003414535.1.39106 WP_003414535.1.39165 WP_003414535.1.39174 WP_003414535.1.39176 WP_003414535.1.39178 WP_003414535.1.39190 WP_003414535.1.39201 WP_003414535.1.39207 WP_003414535.1.39211 WP_003414535.1.39236 WP_003414535.1.39239 WP_003414535.1.39252 WP_003414535.1.39288 WP_003414535.1.39295 WP_003414535.1.39306 WP_003414535.1.39359 WP_003414535.1.39364 WP_003414535.1.39400 WP_003414535.1.39447 WP_003414535.1.3945 WP_003414535.1.39450 WP_003414535.1.39455 WP_003414535.1.3949 WP_003414535.1.39521 WP_003414535.1.39560 WP_003414535.1.39592 WP_003414535.1.39593 WP_003414535.1.396 WP_003414535.1.3960 WP_003414535.1.39616 WP_003414535.1.39654 WP_003414535.1.39657 WP_003414535.1.39661 WP_003414535.1.39674 WP_003414535.1.39678 WP_003414535.1.3968 WP_003414535.1.39694 WP_003414535.1.3971 WP_003414535.1.39718 WP_003414535.1.39728 WP_003414535.1.39739 WP_003414535.1.39748 WP_003414535.1.39751 WP_003414535.1.39759 WP_003414535.1.39801 WP_003414535.1.39804 WP_003414535.1.39848 WP_003414535.1.39877 WP_003414535.1.39925 WP_003414535.1.3994 WP_003414535.1.39959 WP_003414535.1.3997 WP_003414535.1.39980 WP_003414535.1.40000 WP_003414535.1.40028 WP_003414535.1.40029 WP_003414535.1.4003 WP_003414535.1.40094 WP_003414535.1.40096 WP_003414535.1.40150 WP_003414535.1.40156 WP_003414535.1.40174 WP_003414535.1.40186 WP_003414535.1.40277 WP_003414535.1.40323 WP_003414535.1.40336 WP_003414535.1.40353 WP_003414535.1.4036 WP_003414535.1.40402 WP_003414535.1.40413 WP_003414535.1.40440 WP_003414535.1.40446 WP_003414535.1.40451 WP_003414535.1.40455 WP_003414535.1.40523 WP_003414535.1.40543 WP_003414535.1.40641 WP_003414535.1.40646 WP_003414535.1.40651 WP_003414535.1.40653 WP_003414535.1.4067 WP_003414535.1.40705 WP_003414535.1.40723 WP_003414535.1.40731 WP_003414535.1.40735 WP_003414535.1.40799 WP_003414535.1.40852 WP_003414535.1.40876 WP_003414535.1.40881 WP_003414535.1.40922 WP_003414535.1.40948 WP_003414535.1.4095 WP_003414535.1.40956 WP_003414535.1.40957 WP_003414535.1.40964 WP_003414535.1.4097 WP_003414535.1.410 WP_003414535.1.41000 WP_003414535.1.41055 WP_003414535.1.41108 WP_003414535.1.41123 WP_003414535.1.41177 WP_003414535.1.41202 WP_003414535.1.41219 WP_003414535.1.41231 WP_003414535.1.41249 WP_003414535.1.4127 WP_003414535.1.41296 WP_003414535.1.41355 WP_003414535.1.41376 WP_003414535.1.41430 WP_003414535.1.41447 WP_003414535.1.41469 WP_003414535.1.41504 WP_003414535.1.41564 WP_003414535.1.41583 WP_003414535.1.41616 WP_003414535.1.41632 WP_003414535.1.41635 WP_003414535.1.41648 WP_003414535.1.41660 WP_003414535.1.41685 WP_003414535.1.41695 WP_003414535.1.41704 WP_003414535.1.4171 WP_003414535.1.41719 WP_003414535.1.41744 WP_003414535.1.41774 WP_003414535.1.41791 WP_003414535.1.41803 WP_003414535.1.41820 WP_003414535.1.41828 WP_003414535.1.41829 WP_003414535.1.41912 WP_003414535.1.41921 WP_003414535.1.41933 WP_003414535.1.41944 WP_003414535.1.42043 WP_003414535.1.42075 WP_003414535.1.42078 WP_003414535.1.42094 WP_003414535.1.42112 WP_003414535.1.4212 WP_003414535.1.42122 WP_003414535.1.42134 WP_003414535.1.42183 WP_003414535.1.42188 WP_003414535.1.42201 WP_003414535.1.42202 WP_003414535.1.42208 WP_003414535.1.42247 WP_003414535.1.42255 WP_003414535.1.42273 WP_003414535.1.42278 WP_003414535.1.42304 WP_003414535.1.42309 WP_003414535.1.42370 WP_003414535.1.42385 WP_003414535.1.42400 WP_003414535.1.42409 WP_003414535.1.42414 WP_003414535.1.42417 WP_003414535.1.42430 WP_003414535.1.42461 WP_003414535.1.42465 WP_003414535.1.42467 WP_003414535.1.42473 WP_003414535.1.42474 WP_003414535.1.4248 WP_003414535.1.42494 WP_003414535.1.42519 WP_003414535.1.42524 WP_003414535.1.42534 WP_003414535.1.4255 WP_003414535.1.42562 WP_003414535.1.42568 WP_003414535.1.42570 WP_003414535.1.42618 WP_003414535.1.42660 WP_003414535.1.42695 WP_003414535.1.42704 WP_003414535.1.42705 WP_003414535.1.42722 WP_003414535.1.42777 WP_003414535.1.42782 WP_003414535.1.42835 WP_003414535.1.42839 WP_003414535.1.42842 WP_003414535.1.42905 WP_003414535.1.42916 WP_003414535.1.42930 WP_003414535.1.42971 WP_003414535.1.43005 WP_003414535.1.43009 WP_003414535.1.43053 WP_003414535.1.43082 WP_003414535.1.43087 WP_003414535.1.43098 WP_003414535.1.43208 WP_003414535.1.43236 WP_003414535.1.43246 WP_003414535.1.43255 WP_003414535.1.43266 WP_003414535.1.43269 WP_003414535.1.43273 WP_003414535.1.43296 WP_003414535.1.43368 WP_003414535.1.43395 WP_003414535.1.43457 WP_003414535.1.43475 WP_003414535.1.43478 WP_003414535.1.43484 WP_003414535.1.43557 WP_003414535.1.43578 WP_003414535.1.43588 WP_003414535.1.43643 WP_003414535.1.43664 WP_003414535.1.43684 WP_003414535.1.43686 WP_003414535.1.43706 WP_003414535.1.43716 WP_003414535.1.4377 WP_003414535.1.43781 WP_003414535.1.43794 WP_003414535.1.43815 WP_003414535.1.43846 WP_003414535.1.43861 WP_003414535.1.43863 WP_003414535.1.43866 WP_003414535.1.43872 WP_003414535.1.43885 WP_003414535.1.43897 WP_003414535.1.4390 WP_003414535.1.43902 WP_003414535.1.43921 WP_003414535.1.43936 WP_003414535.1.43937 WP_003414535.1.43960 WP_003414535.1.43965 WP_003414535.1.4399 WP_003414535.1.43993 WP_003414535.1.43996 WP_003414535.1.44 WP_003414535.1.44001 WP_003414535.1.44008 WP_003414535.1.44016 WP_003414535.1.44033 WP_003414535.1.44037 WP_003414535.1.44041 WP_003414535.1.44070 WP_003414535.1.44071 WP_003414535.1.44076 WP_003414535.1.44104 WP_003414535.1.44111 WP_003414535.1.44124 WP_003414535.1.44169 WP_003414535.1.44219 WP_003414535.1.44237 WP_003414535.1.44277 WP_003414535.1.44279 WP_003414535.1.44336 WP_003414535.1.44355 WP_003414535.1.44358 WP_003414535.1.4438 WP_003414535.1.44390 WP_003414535.1.44392 WP_003414535.1.4441 WP_003414535.1.44415 WP_003414535.1.44464 WP_003414535.1.44466 WP_003414535.1.44489 WP_003414535.1.44492 WP_003414535.1.44494 WP_003414535.1.44500 WP_003414535.1.44519 WP_003414535.1.44526 WP_003414535.1.44532 WP_003414535.1.44534 WP_003414535.1.44562 WP_003414535.1.44589 WP_003414535.1.44597 WP_003414535.1.44600 WP_003414535.1.44602 WP_003414535.1.44615 WP_003414535.1.4464 WP_003414535.1.44651 WP_003414535.1.44659 WP_003414535.1.44665 WP_003414535.1.44694 WP_003414535.1.44700 WP_003414535.1.44713 WP_003414535.1.44735 WP_003414535.1.44740 WP_003414535.1.44757 WP_003414535.1.4476 WP_003414535.1.44761 WP_003414535.1.44767 WP_003414535.1.44776 WP_003414535.1.44779 WP_003414535.1.44786 WP_003414535.1.44808 WP_003414535.1.44864 WP_003414535.1.44901 WP_003414535.1.44908 WP_003414535.1.44913 WP_003414535.1.4492 WP_003414535.1.44939 WP_003414535.1.44979 WP_003414535.1.44981 WP_003414535.1.45002 WP_003414535.1.45011 WP_003414535.1.4504 WP_003414535.1.45062 WP_003414535.1.45066 WP_003414535.1.45081 WP_003414535.1.45113 WP_003414535.1.45129 WP_003414535.1.45135 WP_003414535.1.45147 WP_003414535.1.45168 WP_003414535.1.4517 WP_003414535.1.45181 WP_003414535.1.45185 WP_003414535.1.45192 WP_003414535.1.45200 WP_003414535.1.45205 WP_003414535.1.45211 WP_003414535.1.45249 WP_003414535.1.4526 WP_003414535.1.45286 WP_003414535.1.45326 WP_003414535.1.45347 WP_003414535.1.45374 WP_003414535.1.45390 WP_003414535.1.454 WP_003414535.1.45407 WP_003414535.1.45451 WP_003414535.1.45453 WP_003414535.1.45460 WP_003414535.1.45463 WP_003414535.1.45470 WP_003414535.1.45474 WP_003414535.1.45491 WP_003414535.1.45510 WP_003414535.1.45563 WP_003414535.1.45584 WP_003414535.1.45590 WP_003414535.1.45619 WP_003414535.1.45626 WP_003414535.1.45631 WP_003414535.1.45666 WP_003414535.1.45697 WP_003414535.1.45731 WP_003414535.1.45743 WP_003414535.1.45765 WP_003414535.1.45776 WP_003414535.1.45783 WP_003414535.1.45805 WP_003414535.1.45815 WP_003414535.1.45849 WP_003414535.1.45867 WP_003414535.1.45884 WP_003414535.1.4590 WP_003414535.1.45923 WP_003414535.1.45926 WP_003414535.1.45963 WP_003414535.1.45989 WP_003414535.1.45992 WP_003414535.1.46025 WP_003414535.1.46083 WP_003414535.1.46090 WP_003414535.1.46092 WP_003414535.1.46100 WP_003414535.1.46101 WP_003414535.1.46103 WP_003414535.1.46107 WP_003414535.1.46127 WP_003414535.1.46128 WP_003414535.1.46129 WP_003414535.1.46141 WP_003414535.1.46150 WP_003414535.1.46201 WP_003414535.1.46226 WP_003414535.1.4624 WP_003414535.1.46253 WP_003414535.1.46268 WP_003414535.1.46285 WP_003414535.1.46300 WP_003414535.1.46313 WP_003414535.1.46336 WP_003414535.1.46365 WP_003414535.1.46370 WP_003414535.1.46381 WP_003414535.1.46402 WP_003414535.1.46411 WP_003414535.1.4644 WP_003414535.1.46442 WP_003414535.1.46453 WP_003414535.1.46463 WP_003414535.1.46478 WP_003414535.1.46492 WP_003414535.1.46521 WP_003414535.1.4653 WP_003414535.1.46532 WP_003414535.1.46539 WP_003414535.1.46568 WP_003414535.1.46585 WP_003414535.1.46609 WP_003414535.1.46613 WP_003414535.1.46625 WP_003414535.1.46642 WP_003414535.1.46647 WP_003414535.1.46674 WP_003414535.1.46724 WP_003414535.1.46758 WP_003414535.1.46773 WP_003414535.1.46777 WP_003414535.1.46786 WP_003414535.1.46792 WP_003414535.1.46847 WP_003414535.1.46851 WP_003414535.1.4687 WP_003414535.1.46897 WP_003414535.1.46936 WP_003414535.1.46980 WP_003414535.1.47011 WP_003414535.1.47012 WP_003414535.1.47066 WP_003414535.1.47077 WP_003414535.1.47083 WP_003414535.1.47106 WP_003414535.1.47142 WP_003414535.1.47147 WP_003414535.1.47178 WP_003414535.1.47179 WP_003414535.1.47194 WP_003414535.1.47207 WP_003414535.1.47210 WP_003414535.1.47261 WP_003414535.1.47262 WP_003414535.1.47402 WP_003414535.1.47423 WP_003414535.1.47467 WP_003414535.1.47502 WP_003414535.1.4751 WP_003414535.1.47511 WP_003414535.1.47537 WP_003414535.1.47540 WP_003414535.1.47568 WP_003414535.1.47572 WP_003414535.1.47588 WP_003414535.1.47636 WP_003414535.1.4764 WP_003414535.1.47653 WP_003414535.1.47679 WP_003414535.1.47681 WP_003414535.1.47690 WP_003414535.1.4771 WP_003414535.1.47717 WP_003414535.1.47743 WP_003414535.1.47754 WP_003414535.1.47773 WP_003414535.1.47776 WP_003414535.1.47780 WP_003414535.1.47805 WP_003414535.1.47832 WP_003414535.1.47847 WP_003414535.1.47858 WP_003414535.1.47861 WP_003414535.1.47868 WP_003414535.1.47893 WP_003414535.1.47899 WP_003414535.1.479 WP_003414535.1.47912 WP_003414535.1.47913 WP_003414535.1.47926 WP_003414535.1.4794 WP_003414535.1.47943 WP_003414535.1.47944 WP_003414535.1.47959 WP_003414535.1.47974 WP_003414535.1.47993 WP_003414535.1.48004 WP_003414535.1.48039 WP_003414535.1.48050 WP_003414535.1.48084 WP_003414535.1.48097 WP_003414535.1.48101 WP_003414535.1.48109 WP_003414535.1.4813 WP_003414535.1.48130 WP_003414535.1.48135 WP_003414535.1.48143 WP_003414535.1.48152 WP_003414535.1.48155 WP_003414535.1.48170 WP_003414535.1.48173 WP_003414535.1.48177 WP_003414535.1.48185 WP_003414535.1.48204 WP_003414535.1.48219 WP_003414535.1.4823 WP_003414535.1.48240 WP_003414535.1.48256 WP_003414535.1.48264 WP_003414535.1.48287 WP_003414535.1.48330 WP_003414535.1.48333 WP_003414535.1.48348 WP_003414535.1.48354 WP_003414535.1.48372 WP_003414535.1.48383 WP_003414535.1.48388 WP_003414535.1.48419 WP_003414535.1.48423 WP_003414535.1.48443 WP_003414535.1.48450 WP_003414535.1.48462 WP_003414535.1.48543 WP_003414535.1.48550 WP_003414535.1.48605 WP_003414535.1.4863 WP_003414535.1.48648 WP_003414535.1.48658 WP_003414535.1.48666 WP_003414535.1.48687 WP_003414535.1.48779 WP_003414535.1.4878 WP_003414535.1.48798 WP_003414535.1.48802 WP_003414535.1.48826 WP_003414535.1.48843 WP_003414535.1.48857 WP_003414535.1.4890 WP_003414535.1.48946 WP_003414535.1.48979 WP_003414535.1.49017 WP_003414535.1.49048 WP_003414535.1.49059 WP_003414535.1.4906 WP_003414535.1.4907 WP_003414535.1.49103 WP_003414535.1.49110 WP_003414535.1.49111 WP_003414535.1.49112 WP_003414535.1.4919 WP_003414535.1.49251 WP_003414535.1.49254 WP_003414535.1.49263 WP_003414535.1.49291 WP_003414535.1.49296 WP_003414535.1.49335 WP_003414535.1.49337 WP_003414535.1.49419 WP_003414535.1.49426 WP_003414535.1.49437 WP_003414535.1.49439 WP_003414535.1.49474 WP_003414535.1.49506 WP_003414535.1.49516 WP_003414535.1.49523 WP_003414535.1.49526 WP_003414535.1.49532 WP_003414535.1.49588 WP_003414535.1.4959 WP_003414535.1.49678 WP_003414535.1.49687 WP_003414535.1.49699 WP_003414535.1.49709 WP_003414535.1.4971 WP_003414535.1.4972 WP_003414535.1.49736 WP_003414535.1.49746 WP_003414535.1.49764 WP_003414535.1.49773 WP_003414535.1.49796 WP_003414535.1.49814 WP_003414535.1.49815 WP_003414535.1.49816 WP_003414535.1.49839 WP_003414535.1.49857 WP_003414535.1.49878 WP_003414535.1.49880 WP_003414535.1.49944 WP_003414535.1.4999 WP_003414535.1.49990 WP_003414535.1.50068 WP_003414535.1.5008 WP_003414535.1.50081 WP_003414535.1.50122 WP_003414535.1.50126 WP_003414535.1.50149 WP_003414535.1.50162 WP_003414535.1.5018 WP_003414535.1.50194 WP_003414535.1.50218 WP_003414535.1.50249 WP_003414535.1.50265 WP_003414535.1.50271 WP_003414535.1.50347 WP_003414535.1.50372 WP_003414535.1.50398 WP_003414535.1.50407 WP_003414535.1.50444 WP_003414535.1.50466 WP_003414535.1.50472 WP_003414535.1.5048 WP_003414535.1.50498 WP_003414535.1.5050 WP_003414535.1.50540 WP_003414535.1.50554 WP_003414535.1.50557 WP_003414535.1.50601 WP_003414535.1.50610 WP_003414535.1.50632 WP_003414535.1.50633 WP_003414535.1.50642 WP_003414535.1.50655 WP_003414535.1.50659 WP_003414535.1.50683 WP_003414535.1.50689 WP_003414535.1.50692 WP_003414535.1.50714 WP_003414535.1.50729 WP_003414535.1.50756 WP_003414535.1.50784 WP_003414535.1.50794 WP_003414535.1.50841 WP_003414535.1.50860 WP_003414535.1.50868 WP_003414535.1.50877 WP_003414535.1.5096 WP_003414535.1.50981 WP_003414535.1.50987 WP_003414535.1.51003 WP_003414535.1.51009 WP_003414535.1.51037 WP_003414535.1.51074 WP_003414535.1.51082 WP_003414535.1.51101 WP_003414535.1.51116 WP_003414535.1.51149 WP_003414535.1.51156 WP_003414535.1.51157 WP_003414535.1.51213 WP_003414535.1.51232 WP_003414535.1.51247 WP_003414535.1.51266 WP_003414535.1.51279 WP_003414535.1.51291 WP_003414535.1.51294 WP_003414535.1.51329 WP_003414535.1.51391 WP_003414535.1.51422 WP_003414535.1.51445 WP_003414535.1.51455 WP_003414535.1.51466 WP_003414535.1.51468 WP_003414535.1.51478 WP_003414535.1.51497 WP_003414535.1.51520 WP_003414535.1.51593 WP_003414535.1.51628 WP_003414535.1.5164 WP_003414535.1.51647 WP_003414535.1.51660 WP_003414535.1.51696 WP_003414535.1.51721 WP_003414535.1.51788 WP_003414535.1.51795 WP_003414535.1.51801 WP_003414535.1.51817 WP_003414535.1.51819 WP_003414535.1.51854 WP_003414535.1.51923 WP_003414535.1.51942 WP_003414535.1.51948 WP_003414535.1.51963 WP_003414535.1.51969 WP_003414535.1.52000 WP_003414535.1.52001 WP_003414535.1.52003 WP_003414535.1.52006 WP_003414535.1.52036 WP_003414535.1.52038 WP_003414535.1.52046 WP_003414535.1.52059 WP_003414535.1.52069 WP_003414535.1.52082 WP_003414535.1.52102 WP_003414535.1.52106 WP_003414535.1.52166 WP_003414535.1.52168 WP_003414535.1.52173 WP_003414535.1.52178 WP_003414535.1.52206 WP_003414535.1.52216 WP_003414535.1.52238 WP_003414535.1.52241 WP_003414535.1.52280 WP_003414535.1.52314 WP_003414535.1.52385 WP_003414535.1.52390 WP_003414535.1.524 WP_003414535.1.52460 WP_003414535.1.52485 WP_003414535.1.52486 WP_003414535.1.52495 WP_003414535.1.52504 WP_003414535.1.52522 WP_003414535.1.52531 WP_003414535.1.52533 WP_003414535.1.52545 WP_003414535.1.52553 WP_003414535.1.52563 WP_003414535.1.52564 WP_003414535.1.52574 WP_003414535.1.52641 WP_003414535.1.52673 WP_003414535.1.52674 WP_003414535.1.52708 WP_003414535.1.52713 WP_003414535.1.52761 WP_003414535.1.52778 WP_003414535.1.52791 WP_003414535.1.52797 WP_003414535.1.52818 WP_003414535.1.52872 WP_003414535.1.52873 WP_003414535.1.52891 WP_003414535.1.52892 WP_003414535.1.52909 WP_003414535.1.52970 WP_003414535.1.52998 WP_003414535.1.53053 WP_003414535.1.53056 WP_003414535.1.5306 WP_003414535.1.53088 WP_003414535.1.5309 WP_003414535.1.531 WP_003414535.1.53117 WP_003414535.1.53118 WP_003414535.1.53142 WP_003414535.1.53143 WP_003414535.1.53157 WP_003414535.1.53167 WP_003414535.1.53200 WP_003414535.1.53213 WP_003414535.1.53217 WP_003414535.1.53226 WP_003414535.1.53229 WP_003414535.1.53230 WP_003414535.1.53237 WP_003414535.1.53254 WP_003414535.1.53257 WP_003414535.1.5327 WP_003414535.1.53276 WP_003414535.1.53278 WP_003414535.1.533 WP_003414535.1.53302 WP_003414535.1.53306 WP_003414535.1.5334 WP_003414535.1.5335 WP_003414535.1.53353 WP_003414535.1.53381 WP_003414535.1.53413 WP_003414535.1.53458 WP_003414535.1.53460 WP_003414535.1.53480 WP_003414535.1.53517 WP_003414535.1.53522 WP_003414535.1.53525 WP_003414535.1.53526 WP_003414535.1.53553 WP_003414535.1.53606 WP_003414535.1.53609 WP_003414535.1.53628 WP_003414535.1.53643 WP_003414535.1.53667 WP_003414535.1.53679 WP_003414535.1.53715 WP_003414535.1.53730 WP_003414535.1.53742 WP_003414535.1.53743 WP_003414535.1.53754 WP_003414535.1.53775 WP_003414535.1.53787 WP_003414535.1.53803 WP_003414535.1.53818 WP_003414535.1.53822 WP_003414535.1.53853 WP_003414535.1.53865 WP_003414535.1.53900 WP_003414535.1.53912 WP_003414535.1.53914 WP_003414535.1.53952 WP_003414535.1.5398 WP_003414535.1.5408 WP_003414535.1.54089 WP_003414535.1.54093 WP_003414535.1.54099 WP_003414535.1.54112 WP_003414535.1.54125 WP_003414535.1.54141 WP_003414535.1.54162 WP_003414535.1.54179 WP_003414535.1.54206 WP_003414535.1.54218 WP_003414535.1.54225 WP_003414535.1.54227 WP_003414535.1.54232 WP_003414535.1.54241 WP_003414535.1.54245 WP_003414535.1.54247 WP_003414535.1.54260 WP_003414535.1.54275 WP_003414535.1.54280 WP_003414535.1.5429 WP_003414535.1.54294 WP_003414535.1.54314 WP_003414535.1.54347 WP_003414535.1.54351 WP_003414535.1.54370 WP_003414535.1.54428 WP_003414535.1.54449 WP_003414535.1.54494 WP_003414535.1.54502 WP_003414535.1.54514 WP_003414535.1.54519 WP_003414535.1.5452 WP_003414535.1.54531 WP_003414535.1.54537 WP_003414535.1.54553 WP_003414535.1.54555 WP_003414535.1.54633 WP_003414535.1.54686 WP_003414535.1.54687 WP_003414535.1.54705 WP_003414535.1.54730 WP_003414535.1.54732 WP_003414535.1.5475 WP_003414535.1.54797 WP_003414535.1.54807 WP_003414535.1.54836 WP_003414535.1.54838 WP_003414535.1.54860 WP_003414535.1.54888 WP_003414535.1.54905 WP_003414535.1.54909 WP_003414535.1.54937 WP_003414535.1.54939 WP_003414535.1.54944 WP_003414535.1.54945 WP_003414535.1.54953 WP_003414535.1.54964 WP_003414535.1.55015 WP_003414535.1.55022 WP_003414535.1.55023 WP_003414535.1.55051 WP_003414535.1.55072 WP_003414535.1.55088 WP_003414535.1.55106 WP_003414535.1.55126 WP_003414535.1.55128 WP_003414535.1.55140 WP_003414535.1.55150 WP_003414535.1.55210 WP_003414535.1.55227 WP_003414535.1.55248 WP_003414535.1.55257 WP_003414535.1.55258 WP_003414535.1.55267 WP_003414535.1.55279 WP_003414535.1.55307 WP_003414535.1.55326 WP_003414535.1.55328 WP_003414535.1.5533 WP_003414535.1.55345 WP_003414535.1.55396 WP_003414535.1.55398 WP_003414535.1.55441 WP_003414535.1.55459 WP_003414535.1.55501 WP_003414535.1.55504 WP_003414535.1.55578 WP_003414535.1.55626 WP_003414535.1.55641 WP_003414535.1.5569 WP_003414535.1.55723 WP_003414535.1.55735 WP_003414535.1.5574 WP_003414535.1.55772 WP_003414535.1.55802 WP_003414535.1.55807 WP_003414535.1.55821 WP_003414535.1.5583 WP_003414535.1.55849 WP_003414535.1.55856 WP_003414535.1.55860 WP_003414535.1.55882 WP_003414535.1.55883 WP_003414535.1.55894 WP_003414535.1.55902 WP_003414535.1.55908 WP_003414535.1.55909 WP_003414535.1.5591 WP_003414535.1.55961 WP_003414535.1.55977 WP_003414535.1.55983 WP_003414535.1.56028 WP_003414535.1.56060 WP_003414535.1.56107 WP_003414535.1.56132 WP_003414535.1.56163 WP_003414535.1.56167 WP_003414535.1.56178 WP_003414535.1.56287 WP_003414535.1.56292 WP_003414535.1.56327 WP_003414535.1.56341 WP_003414535.1.56359 WP_003414535.1.56365 WP_003414535.1.56394 WP_003414535.1.56443 WP_003414535.1.56473 WP_003414535.1.56478 WP_003414535.1.56500 WP_003414535.1.56517 WP_003414535.1.56534 WP_003414535.1.56577 WP_003414535.1.56593 WP_003414535.1.56625 WP_003414535.1.56637 WP_003414535.1.56670 WP_003414535.1.56697 WP_003414535.1.567 WP_003414535.1.56701 WP_003414535.1.56729 WP_003414535.1.56743 WP_003414535.1.56755 WP_003414535.1.56764 WP_003414535.1.56769 WP_003414535.1.56770 WP_003414535.1.56795 WP_003414535.1.5681 WP_003414535.1.56827 WP_003414535.1.56839 WP_003414535.1.56863 WP_003414535.1.56868 WP_003414535.1.56869 WP_003414535.1.56915 WP_003414535.1.56926 WP_003414535.1.56961 WP_003414535.1.56971 WP_003414535.1.56972 WP_003414535.1.57023 WP_003414535.1.57035 WP_003414535.1.57077 WP_003414535.1.57087 WP_003414535.1.57094 WP_003414535.1.57134 WP_003414535.1.57151 WP_003414535.1.57169 WP_003414535.1.57208 WP_003414535.1.57212 WP_003414535.1.57230 WP_003414535.1.5724 WP_003414535.1.5725 WP_003414535.1.5727 WP_003414535.1.57273 WP_003414535.1.573 WP_003414535.1.57314 WP_003414535.1.57326 WP_003414535.1.57328 WP_003414535.1.57331 WP_003414535.1.57340 WP_003414535.1.57351 WP_003414535.1.57352 WP_003414535.1.57380 WP_003414535.1.57430 WP_003414535.1.5744 WP_003414535.1.57440 WP_003414535.1.5745 WP_003414535.1.57461 WP_003414535.1.57469 WP_003414535.1.57489 WP_003414535.1.575 WP_003414535.1.57509 WP_003414535.1.57519 WP_003414535.1.57525 WP_003414535.1.57551 WP_003414535.1.5758 WP_003414535.1.57596 WP_003414535.1.57604 WP_003414535.1.57616 WP_003414535.1.57617 WP_003414535.1.57619 WP_003414535.1.57627 WP_003414535.1.57642 WP_003414535.1.57658 WP_003414535.1.57667 WP_003414535.1.57675 WP_003414535.1.57689 WP_003414535.1.57708 WP_003414535.1.57794 WP_003414535.1.57821 WP_003414535.1.57825 WP_003414535.1.57843 WP_003414535.1.57906 WP_003414535.1.57924 WP_003414535.1.57926 WP_003414535.1.57930 WP_003414535.1.57957 WP_003414535.1.57960 WP_003414535.1.57964 WP_003414535.1.57991 WP_003414535.1.58000 WP_003414535.1.58086 WP_003414535.1.58101 WP_003414535.1.58103 WP_003414535.1.58108 WP_003414535.1.5811 WP_003414535.1.58121 WP_003414535.1.58145 WP_003414535.1.58164 WP_003414535.1.58174 WP_003414535.1.582 WP_003414535.1.58202 WP_003414535.1.58209 WP_003414535.1.5824 WP_003414535.1.58250 WP_003414535.1.58259 WP_003414535.1.58283 WP_003414535.1.58288 WP_003414535.1.5830 WP_003414535.1.58303 WP_003414535.1.58311 WP_003414535.1.58330 WP_003414535.1.58359 WP_003414535.1.58386 WP_003414535.1.58393 WP_003414535.1.58431 WP_003414535.1.5844 WP_003414535.1.58457 WP_003414535.1.58488 WP_003414535.1.58518 WP_003414535.1.58534 WP_003414535.1.58559 WP_003414535.1.58567 WP_003414535.1.58573 WP_003414535.1.58602 WP_003414535.1.58612 WP_003414535.1.58619 WP_003414535.1.58630 WP_003414535.1.5865 WP_003414535.1.58671 WP_003414535.1.58690 WP_003414535.1.58702 WP_003414535.1.58743 WP_003414535.1.58754 WP_003414535.1.5879 WP_003414535.1.5881 WP_003414535.1.58848 WP_003414535.1.58857 WP_003414535.1.58891 WP_003414535.1.58892 WP_003414535.1.5890 WP_003414535.1.58904 WP_003414535.1.58921 WP_003414535.1.58930 WP_003414535.1.58939 WP_003414535.1.58941 WP_003414535.1.58953 WP_003414535.1.58961 WP_003414535.1.5898 WP_003414535.1.59025 WP_003414535.1.59029 WP_003414535.1.59037 WP_003414535.1.59044 WP_003414535.1.59085 WP_003414535.1.59088 WP_003414535.1.59112 WP_003414535.1.59130 WP_003414535.1.5914 WP_003414535.1.59147 WP_003414535.1.59166 WP_003414535.1.59205 WP_003414535.1.59209 WP_003414535.1.59237 WP_003414535.1.59240 WP_003414535.1.59253 WP_003414535.1.59254 WP_003414535.1.59262 WP_003414535.1.59270 WP_003414535.1.5928 WP_003414535.1.59304 WP_003414535.1.59305 WP_003414535.1.59309 WP_003414535.1.59316 WP_003414535.1.59326 WP_003414535.1.59328 WP_003414535.1.59333 WP_003414535.1.59338 WP_003414535.1.59388 WP_003414535.1.59428 WP_003414535.1.59487 WP_003414535.1.59537 WP_003414535.1.59561 WP_003414535.1.59677 WP_003414535.1.59722 WP_003414535.1.59727 WP_003414535.1.59732 WP_003414535.1.59738 WP_003414535.1.59750 WP_003414535.1.59757 WP_003414535.1.59761 WP_003414535.1.59808 WP_003414535.1.59850 WP_003414535.1.59856 WP_003414535.1.59860 WP_003414535.1.59861 WP_003414535.1.5987 WP_003414535.1.59878 WP_003414535.1.59888 WP_003414535.1.59952 WP_003414535.1.5996 WP_003414535.1.59961 WP_003414535.1.59974 WP_003414535.1.6000 WP_003414535.1.60007 WP_003414535.1.60016 WP_003414535.1.6003 WP_003414535.1.60047 WP_003414535.1.6007 WP_003414535.1.60121 WP_003414535.1.60125 WP_003414535.1.60135 WP_003414535.1.60139 WP_003414535.1.60152 WP_003414535.1.60171 WP_003414535.1.60197 WP_003414535.1.6020 WP_003414535.1.60205 WP_003414535.1.60207 WP_003414535.1.60215 WP_003414535.1.60217 WP_003414535.1.60267 WP_003414535.1.60288 WP_003414535.1.60291 WP_003414535.1.60301 WP_003414535.1.60305 WP_003414535.1.60312 WP_003414535.1.60313 WP_003414535.1.60314 WP_003414535.1.60367 WP_003414535.1.60376 WP_003414535.1.60403 WP_003414535.1.60413 WP_003414535.1.60421 WP_003414535.1.60451 WP_003414535.1.60460 WP_003414535.1.60479 WP_003414535.1.60487 WP_003414535.1.60512 WP_003414535.1.60573 WP_003414535.1.60583 WP_003414535.1.60632 WP_003414535.1.60657 WP_003414535.1.60687 WP_003414535.1.60689 WP_003414535.1.60727 WP_003414535.1.60738 WP_003414535.1.60763 WP_003414535.1.6077 WP_003414535.1.60791 WP_003414535.1.60834 WP_003414535.1.60870 WP_003414535.1.60878 WP_003414535.1.60879 WP_003414535.1.60913 WP_003414535.1.60978 WP_003414535.1.61000 WP_003414535.1.61001 WP_003414535.1.61012 WP_003414535.1.61014 WP_003414535.1.61015 WP_003414535.1.61037 WP_003414535.1.61052 WP_003414535.1.61065 WP_003414535.1.61100 WP_003414535.1.61101 WP_003414535.1.61138 WP_003414535.1.61142 WP_003414535.1.61198 WP_003414535.1.612 WP_003414535.1.61234 WP_003414535.1.61256 WP_003414535.1.61281 WP_003414535.1.61314 WP_003414535.1.61321 WP_003414535.1.61326 WP_003414535.1.61328 WP_003414535.1.61368 WP_003414535.1.61391 WP_003414535.1.61406 WP_003414535.1.61409 WP_003414535.1.61420 WP_003414535.1.61425 WP_003414535.1.61428 WP_003414535.1.61469 WP_003414535.1.61494 WP_003414535.1.61522 WP_003414535.1.61552 WP_003414535.1.61557 WP_003414535.1.61567 WP_003414535.1.61571 WP_003414535.1.61573 WP_003414535.1.61584 WP_003414535.1.61586 WP_003414535.1.6159 WP_003414535.1.61592 WP_003414535.1.6160 WP_003414535.1.61614 WP_003414535.1.6163 WP_003414535.1.61655 WP_003414535.1.61665 WP_003414535.1.61669 WP_003414535.1.61682 WP_003414535.1.61692 WP_003414535.1.61719 WP_003414535.1.61728 WP_003414535.1.61750 WP_003414535.1.61754 WP_003414535.1.61755 WP_003414535.1.61757 WP_003414535.1.61778 WP_003414535.1.6179 WP_003414535.1.61793 WP_003414535.1.61816 WP_003414535.1.61842 WP_003414535.1.61850 WP_003414535.1.61862 WP_003414535.1.61865 WP_003414535.1.61868 WP_003414535.1.61911 WP_003414535.1.61925 WP_003414535.1.61941 WP_003414535.1.61953 WP_003414535.1.61979 WP_003414535.1.61986 WP_003414535.1.61987 WP_003414535.1.61998 WP_003414535.1.62021 WP_003414535.1.62087 WP_003414535.1.62089 WP_003414535.1.62101 WP_003414535.1.62104 WP_003414535.1.6211 WP_003414535.1.62132 WP_003414535.1.62162 WP_003414535.1.62225 WP_003414535.1.62238 WP_003414535.1.62249 WP_003414535.1.62270 WP_003414535.1.62281 WP_003414535.1.62307 WP_003414535.1.6231 WP_003414535.1.62359 WP_003414535.1.62360 WP_003414535.1.62371 WP_003414535.1.62379 WP_003414535.1.62395 WP_003414535.1.62408 WP_003414535.1.62449 WP_003414535.1.62468 WP_003414535.1.6248 WP_003414535.1.62508 WP_003414535.1.62565 WP_003414535.1.62594 WP_003414535.1.62606 WP_003414535.1.62616 WP_003414535.1.62666 WP_003414535.1.62687 WP_003414535.1.62715 WP_003414535.1.62730 WP_003414535.1.62738 WP_003414535.1.62761 WP_003414535.1.62766 WP_003414535.1.62786 WP_003414535.1.62813 WP_003414535.1.62839 WP_003414535.1.62841 WP_003414535.1.62909 WP_003414535.1.62936 WP_003414535.1.6294 WP_003414535.1.6295 WP_003414535.1.62962 WP_003414535.1.63007 WP_003414535.1.63019 WP_003414535.1.63032 WP_003414535.1.63037 WP_003414535.1.63064 WP_003414535.1.63066 WP_003414535.1.6308 WP_003414535.1.63081 WP_003414535.1.63096 WP_003414535.1.63106 WP_003414535.1.6314 WP_003414535.1.63144 WP_003414535.1.63154 WP_003414535.1.63160 WP_003414535.1.63161 WP_003414535.1.63166 WP_003414535.1.63175 WP_003414535.1.63194 WP_003414535.1.6322 WP_003414535.1.63222 WP_003414535.1.63247 WP_003414535.1.6328 WP_003414535.1.63291 WP_003414535.1.63317 WP_003414535.1.63331 WP_003414535.1.63373 WP_003414535.1.63384 WP_003414535.1.63403 WP_003414535.1.63424 WP_003414535.1.63428 WP_003414535.1.6345 WP_003414535.1.63464 WP_003414535.1.63483 WP_003414535.1.63502 WP_003414535.1.63504 WP_003414535.1.63522 WP_003414535.1.63530 WP_003414535.1.63538 WP_003414535.1.63564 WP_003414535.1.63567 WP_003414535.1.63596 WP_003414535.1.63600 WP_003414535.1.63623 WP_003414535.1.63624 WP_003414535.1.63625 WP_003414535.1.63627 WP_003414535.1.63654 WP_003414535.1.63662 WP_003414535.1.63711 WP_003414535.1.63734 WP_003414535.1.63807 WP_003414535.1.63819 WP_003414535.1.63844 WP_003414535.1.63888 WP_003414535.1.63913 WP_003414535.1.63915 WP_003414535.1.63918 WP_003414535.1.63961 WP_003414535.1.63970 WP_003414535.1.64000 WP_003414535.1.64027 WP_003414535.1.64058 WP_003414535.1.64065 WP_003414535.1.6407 WP_003414535.1.64082 WP_003414535.1.64091 WP_003414535.1.64102 WP_003414535.1.64104 WP_003414535.1.64169 WP_003414535.1.64219 WP_003414535.1.6422 WP_003414535.1.64222 WP_003414535.1.64223 WP_003414535.1.64228 WP_003414535.1.64235 WP_003414535.1.64249 WP_003414535.1.6427 WP_003414535.1.64278 WP_003414535.1.64287 WP_003414535.1.64414 WP_003414535.1.64419 WP_003414535.1.6443 WP_003414535.1.64463 WP_003414535.1.64480 WP_003414535.1.64497 WP_003414535.1.64506 WP_003414535.1.64511 WP_003414535.1.64513 WP_003414535.1.64514 WP_003414535.1.64515 WP_003414535.1.64522 WP_003414535.1.64543 WP_003414535.1.6456 WP_003414535.1.64567 WP_003414535.1.64588 WP_003414535.1.64589 WP_003414535.1.64594 WP_003414535.1.64595 WP_003414535.1.64608 WP_003414535.1.64619 WP_003414535.1.64629 WP_003414535.1.6464 WP_003414535.1.64664 WP_003414535.1.64669 WP_003414535.1.64672 WP_003414535.1.64680 WP_003414535.1.64682 WP_003414535.1.64727 WP_003414535.1.64729 WP_003414535.1.64774 WP_003414535.1.64776 WP_003414535.1.64802 WP_003414535.1.64832 WP_003414535.1.6486 WP_003414535.1.64870 WP_003414535.1.64898 WP_003414535.1.64922 WP_003414535.1.64924 WP_003414535.1.6493 WP_003414535.1.64937 WP_003414535.1.64941 WP_003414535.1.64966 WP_003414535.1.64973 WP_003414535.1.65001 WP_003414535.1.65026 WP_003414535.1.65053 WP_003414535.1.65070 WP_003414535.1.65079 WP_003414535.1.65102 WP_003414535.1.65157 WP_003414535.1.65181 WP_003414535.1.65212 WP_003414535.1.65229 WP_003414535.1.6523 WP_003414535.1.65253 WP_003414535.1.65289 WP_003414535.1.65291 WP_003414535.1.65315 WP_003414535.1.65359 WP_003414535.1.6536 WP_003414535.1.65374 WP_003414535.1.65414 WP_003414535.1.65416 WP_003414535.1.65433 WP_003414535.1.65455 WP_003414535.1.65467 WP_003414535.1.65488 WP_003414535.1.65529 WP_003414535.1.65539 WP_003414535.1.65583 WP_003414535.1.65612 WP_003414535.1.65623 WP_003414535.1.65635 WP_003414535.1.65637 WP_003414535.1.65648 WP_003414535.1.65683 WP_003414535.1.65686 WP_003414535.1.65688 WP_003414535.1.65707 WP_003414535.1.65733 WP_003414535.1.65746 WP_003414535.1.65747 WP_003414535.1.65759 WP_003414535.1.65816 WP_003414535.1.65830 WP_003414535.1.65858 WP_003414535.1.65862 WP_003414535.1.65869 WP_003414535.1.65893 WP_003414535.1.65929 WP_003414535.1.65958 WP_003414535.1.65974 WP_003414535.1.66004 WP_003414535.1.66013 WP_003414535.1.6606 WP_003414535.1.66089 WP_003414535.1.66149 WP_003414535.1.66151 WP_003414535.1.66229 WP_003414535.1.66276 WP_003414535.1.66293 WP_003414535.1.66297 WP_003414535.1.66323 WP_003414535.1.66325 WP_003414535.1.6633 WP_003414535.1.66334 WP_003414535.1.66355 WP_003414535.1.66367 WP_003414535.1.66394 WP_003414535.1.66396 WP_003414535.1.66451 WP_003414535.1.66455 WP_003414535.1.66457 WP_003414535.1.66460 WP_003414535.1.66464 WP_003414535.1.66466 WP_003414535.1.66487 WP_003414535.1.66504 WP_003414535.1.66544 WP_003414535.1.66582 WP_003414535.1.66612 WP_003414535.1.66615 WP_003414535.1.66617 WP_003414535.1.66635 WP_003414535.1.66656 WP_003414535.1.66663 WP_003414535.1.66675 WP_003414535.1.66715 WP_003414535.1.66718 WP_003414535.1.66762 WP_003414535.1.66776 WP_003414535.1.66808 WP_003414535.1.66817 WP_003414535.1.66819 WP_003414535.1.66826 WP_003414535.1.66830 WP_003414535.1.66842 WP_003414535.1.66868 WP_003414535.1.66878 WP_003414535.1.66880 WP_003414535.1.66893 WP_003414535.1.66961 WP_003414535.1.67005 WP_003414535.1.6704 WP_003414535.1.67044 WP_003414535.1.67061 WP_003414535.1.67098 WP_003414535.1.67146 WP_003414535.1.67170 WP_003414535.1.67197 WP_003414535.1.67198 WP_003414535.1.6720 WP_003414535.1.67207 WP_003414535.1.67218 WP_003414535.1.67220 WP_003414535.1.67225 WP_003414535.1.67231 WP_003414535.1.6724 WP_003414535.1.67257 WP_003414535.1.67298 WP_003414535.1.67307 WP_003414535.1.67324 WP_003414535.1.67332 WP_003414535.1.67346 WP_003414535.1.67354 WP_003414535.1.67360 WP_003414535.1.67381 WP_003414535.1.67396 WP_003414535.1.67417 WP_003414535.1.67422 WP_003414535.1.67453 WP_003414535.1.67459 WP_003414535.1.6746 WP_003414535.1.67473 WP_003414535.1.67481 WP_003414535.1.67482 WP_003414535.1.67496 WP_003414535.1.67499 WP_003414535.1.67523 WP_003414535.1.67536 WP_003414535.1.67575 WP_003414535.1.67587 WP_003414535.1.67598 WP_003414535.1.67600 WP_003414535.1.67602 WP_003414535.1.67630 WP_003414535.1.67679 WP_003414535.1.67692 WP_003414535.1.67744 WP_003414535.1.6775 WP_003414535.1.67750 WP_003414535.1.6777 WP_003414535.1.67809 WP_003414535.1.67816 WP_003414535.1.67844 WP_003414535.1.67848 WP_003414535.1.67870 WP_003414535.1.67888 WP_003414535.1.67915 WP_003414535.1.67945 WP_003414535.1.67949 WP_003414535.1.67980 WP_003414535.1.67982 WP_003414535.1.68022 WP_003414535.1.68029 WP_003414535.1.68037 WP_003414535.1.68038 WP_003414535.1.68045 WP_003414535.1.68057 WP_003414535.1.68083 WP_003414535.1.68088 WP_003414535.1.68106 WP_003414535.1.68110 WP_003414535.1.68164 WP_003414535.1.68169 WP_003414535.1.68193 WP_003414535.1.68212 WP_003414535.1.68227 WP_003414535.1.68243 WP_003414535.1.6825 WP_003414535.1.68297 WP_003414535.1.68309 WP_003414535.1.68325 WP_003414535.1.68329 WP_003414535.1.68340 WP_003414535.1.68384 WP_003414535.1.68388 WP_003414535.1.68429 WP_003414535.1.6843 WP_003414535.1.68433 WP_003414535.1.68444 WP_003414535.1.68465 WP_003414535.1.68484 WP_003414535.1.68518 WP_003414535.1.68569 WP_003414535.1.68576 WP_003414535.1.68580 WP_003414535.1.68586 WP_003414535.1.68623 WP_003414535.1.68624 WP_003414535.1.68637 WP_003414535.1.68646 WP_003414535.1.68667 WP_003414535.1.68669 WP_003414535.1.68672 WP_003414535.1.68684 WP_003414535.1.68704 WP_003414535.1.68708 WP_003414535.1.6872 WP_003414535.1.68730 WP_003414535.1.68734 WP_003414535.1.68748 WP_003414535.1.68754 WP_003414535.1.6876 WP_003414535.1.68761 WP_003414535.1.68763 WP_003414535.1.68766 WP_003414535.1.68774 WP_003414535.1.68796 WP_003414535.1.68824 WP_003414535.1.68832 WP_003414535.1.68833 WP_003414535.1.68841 WP_003414535.1.68859 WP_003414535.1.68876 WP_003414535.1.68906 WP_003414535.1.68916 WP_003414535.1.68923 WP_003414535.1.68945 WP_003414535.1.6896 WP_003414535.1.68981 WP_003414535.1.68984 WP_003414535.1.68997 WP_003414535.1.69008 WP_003414535.1.69076 WP_003414535.1.69079 WP_003414535.1.6908 WP_003414535.1.69082 WP_003414535.1.69178 WP_003414535.1.69181 WP_003414535.1.69208 WP_003414535.1.69231 WP_003414535.1.69256 WP_003414535.1.69311 WP_003414535.1.69315 WP_003414535.1.69322 WP_003414535.1.69342 WP_003414535.1.6935 WP_003414535.1.6936 WP_003414535.1.69374 WP_003414535.1.69398 WP_003414535.1.69401 WP_003414535.1.69426 WP_003414535.1.69427 WP_003414535.1.69429 WP_003414535.1.6949 WP_003414535.1.6951 WP_003414535.1.69511 WP_003414535.1.69526 WP_003414535.1.69528 WP_003414535.1.69547 WP_003414535.1.69573 WP_003414535.1.69581 WP_003414535.1.6960 WP_003414535.1.69617 WP_003414535.1.69634 WP_003414535.1.69647 WP_003414535.1.69659 WP_003414535.1.69673 WP_003414535.1.69682 WP_003414535.1.69684 WP_003414535.1.69686 WP_003414535.1.69707 WP_003414535.1.69709 WP_003414535.1.69723 WP_003414535.1.69736 WP_003414535.1.69778 WP_003414535.1.69800 WP_003414535.1.69802 WP_003414535.1.69845 WP_003414535.1.69870 WP_003414535.1.69873 WP_003414535.1.69898 WP_003414535.1.69913 WP_003414535.1.69925 WP_003414535.1.69931 WP_003414535.1.69938 WP_003414535.1.69955 WP_003414535.1.69957 WP_003414535.1.69981 WP_003414535.1.69990 WP_003414535.1.70 WP_003414535.1.70000 WP_003414535.1.70017 WP_003414535.1.70055 WP_003414535.1.70062 WP_003414535.1.70072 WP_003414535.1.70131 WP_003414535.1.70132 WP_003414535.1.7022 WP_003414535.1.70227 WP_003414535.1.70255 WP_003414535.1.70271 WP_003414535.1.70274 WP_003414535.1.7029 WP_003414535.1.70325 WP_003414535.1.70328 WP_003414535.1.70356 WP_003414535.1.70364 WP_003414535.1.70368 WP_003414535.1.70369 WP_003414535.1.70418 WP_003414535.1.70422 WP_003414535.1.70435 WP_003414535.1.70444 WP_003414535.1.70463 WP_003414535.1.70471 WP_003414535.1.70480 WP_003414535.1.70494 WP_003414535.1.70498 WP_003414535.1.70505 WP_003414535.1.70525 WP_003414535.1.70573 WP_003414535.1.70577 WP_003414535.1.70610 WP_003414535.1.70615 WP_003414535.1.70618 WP_003414535.1.70622 WP_003414535.1.70626 WP_003414535.1.70668 WP_003414535.1.70699 WP_003414535.1.70704 WP_003414535.1.70729 WP_003414535.1.70757 WP_003414535.1.70782 WP_003414535.1.70796 WP_003414535.1.70830 WP_003414535.1.70834 WP_003414535.1.7084 WP_003414535.1.70840 WP_003414535.1.70864 WP_003414535.1.70871 WP_003414535.1.70915 WP_003414535.1.70955 WP_003414535.1.70958 WP_003414535.1.70964 WP_003414535.1.70976 WP_003414535.1.71015 WP_003414535.1.71026 WP_003414535.1.71063 WP_003414535.1.71076 WP_003414535.1.71083 WP_003414535.1.7111 WP_003414535.1.71118 WP_003414535.1.71128 WP_003414535.1.7113 WP_003414535.1.71187 WP_003414535.1.71191 WP_003414535.1.71255 WP_003414535.1.71258 WP_003414535.1.71259 WP_003414535.1.71289 WP_003414535.1.71326 WP_003414535.1.71329 WP_003414535.1.71331 WP_003414535.1.71344 WP_003414535.1.71390 WP_003414535.1.71414 WP_003414535.1.71440 WP_003414535.1.71457 WP_003414535.1.7146 WP_003414535.1.71464 WP_003414535.1.71490 WP_003414535.1.71492 WP_003414535.1.71509 WP_003414535.1.71516 WP_003414535.1.71517 WP_003414535.1.71527 WP_003414535.1.71532 WP_003414535.1.71545 WP_003414535.1.71546 WP_003414535.1.71569 WP_003414535.1.71604 WP_003414535.1.71621 WP_003414535.1.71630 WP_003414535.1.71638 WP_003414535.1.71654 WP_003414535.1.71664 WP_003414535.1.71665 WP_003414535.1.71683 WP_003414535.1.71701 WP_003414535.1.71718 WP_003414535.1.71731 WP_003414535.1.71778 WP_003414535.1.71781 WP_003414535.1.71803 WP_003414535.1.71820 WP_003414535.1.71847 WP_003414535.1.7185 WP_003414535.1.71851 WP_003414535.1.71871 WP_003414535.1.71909 WP_003414535.1.71957 WP_003414535.1.71970 WP_003414535.1.72047 WP_003414535.1.72061 WP_003414535.1.72062 WP_003414535.1.72072 WP_003414535.1.72111 WP_003414535.1.72122 WP_003414535.1.72128 WP_003414535.1.72143 WP_003414535.1.7216 WP_003414535.1.72168 WP_003414535.1.72179 WP_003414535.1.72209 WP_003414535.1.72218 WP_003414535.1.72219 WP_003414535.1.72227 WP_003414535.1.7224 WP_003414535.1.72268 WP_003414535.1.72332 WP_003414535.1.72380 WP_003414535.1.72401 WP_003414535.1.72405 WP_003414535.1.72420 WP_003414535.1.72441 WP_003414535.1.72451 WP_003414535.1.72452 WP_003414535.1.72457 WP_003414535.1.72459 WP_003414535.1.72460 WP_003414535.1.72466 WP_003414535.1.72487 WP_003414535.1.72488 WP_003414535.1.72492 WP_003414535.1.72506 WP_003414535.1.72543 WP_003414535.1.7256 WP_003414535.1.72576 WP_003414535.1.72578 WP_003414535.1.72585 WP_003414535.1.72591 WP_003414535.1.72592 WP_003414535.1.72640 WP_003414535.1.7266 WP_003414535.1.72661 WP_003414535.1.72684 WP_003414535.1.72739 WP_003414535.1.72744 WP_003414535.1.72759 WP_003414535.1.72784 WP_003414535.1.72792 WP_003414535.1.72826 WP_003414535.1.72831 WP_003414535.1.72852 WP_003414535.1.72853 WP_003414535.1.72879 WP_003414535.1.72938 WP_003414535.1.72954 WP_003414535.1.72957 WP_003414535.1.72959 WP_003414535.1.72973 WP_003414535.1.7298 WP_003414535.1.72982 WP_003414535.1.72988 WP_003414535.1.72993 WP_003414535.1.73006 WP_003414535.1.73013 WP_003414535.1.73025 WP_003414535.1.73028 WP_003414535.1.73042 WP_003414535.1.73045 WP_003414535.1.73092 WP_003414535.1.73118 WP_003414535.1.7312 WP_003414535.1.73127 WP_003414535.1.73134 WP_003414535.1.73154 WP_003414535.1.73163 WP_003414535.1.73182 WP_003414535.1.73205 WP_003414535.1.7321 WP_003414535.1.73310 WP_003414535.1.73365 WP_003414535.1.73391 WP_003414535.1.73404 WP_003414535.1.73424 WP_003414535.1.73436 WP_003414535.1.73445 WP_003414535.1.73453 WP_003414535.1.73465 WP_003414535.1.73466 WP_003414535.1.73470 WP_003414535.1.73471 WP_003414535.1.73478 WP_003414535.1.73482 WP_003414535.1.73507 WP_003414535.1.73532 WP_003414535.1.73550 WP_003414535.1.73564 WP_003414535.1.73623 WP_003414535.1.73629 WP_003414535.1.73644 WP_003414535.1.73661 WP_003414535.1.7368 WP_003414535.1.73688 WP_003414535.1.73744 WP_003414535.1.73750 WP_003414535.1.73760 WP_003414535.1.73774 WP_003414535.1.7379 WP_003414535.1.73813 WP_003414535.1.73840 WP_003414535.1.73876 WP_003414535.1.7389 WP_003414535.1.74016 WP_003414535.1.74039 WP_003414535.1.74083 WP_003414535.1.74101 WP_003414535.1.74107 WP_003414535.1.74120 WP_003414535.1.74129 WP_003414535.1.74144 WP_003414535.1.7417 WP_003414535.1.74190 WP_003414535.1.74210 WP_003414535.1.7423 WP_003414535.1.74259 WP_003414535.1.74262 WP_003414535.1.74269 WP_003414535.1.74282 WP_003414535.1.74291 WP_003414535.1.74296 WP_003414535.1.74304 WP_003414535.1.7432 WP_003414535.1.74347 WP_003414535.1.7436 WP_003414535.1.74378 WP_003414535.1.74382 WP_003414535.1.74395 WP_003414535.1.74400 WP_003414535.1.74401 WP_003414535.1.74432 WP_003414535.1.74442 WP_003414535.1.74487 WP_003414535.1.74499 WP_003414535.1.74504 WP_003414535.1.74511 WP_003414535.1.74523 WP_003414535.1.74525 WP_003414535.1.74551 WP_003414535.1.74555 WP_003414535.1.74628 WP_003414535.1.74641 WP_003414535.1.74653 WP_003414535.1.74660 WP_003414535.1.74683 WP_003414535.1.7469 WP_003414535.1.74725 WP_003414535.1.74760 WP_003414535.1.74786 WP_003414535.1.74809 WP_003414535.1.74820 WP_003414535.1.74870 WP_003414535.1.74881 WP_003414535.1.74888 WP_003414535.1.74952 WP_003414535.1.7496 WP_003414535.1.74988 WP_003414535.1.75043 WP_003414535.1.75045 WP_003414535.1.75055 WP_003414535.1.75078 WP_003414535.1.75081 WP_003414535.1.75120 WP_003414535.1.75163 WP_003414535.1.75188 WP_003414535.1.75200 WP_003414535.1.75202 WP_003414535.1.75234 WP_003414535.1.75239 WP_003414535.1.75250 WP_003414535.1.75263 WP_003414535.1.75281 WP_003414535.1.75342 WP_003414535.1.7535 WP_003414535.1.75376 WP_003414535.1.75391 WP_003414535.1.75395 WP_003414535.1.75441 WP_003414535.1.75510 WP_003414535.1.75581 WP_003414535.1.75598 WP_003414535.1.75635 WP_003414535.1.75645 WP_003414535.1.75665 WP_003414535.1.75671 WP_003414535.1.75741 WP_003414535.1.75749 WP_003414535.1.75772 WP_003414535.1.75774 WP_003414535.1.75811 WP_003414535.1.75833 WP_003414535.1.7585 WP_003414535.1.75868 WP_003414535.1.75878 WP_003414535.1.75927 WP_003414535.1.75946 WP_003414535.1.75968 WP_003414535.1.75974 WP_003414535.1.76007 WP_003414535.1.76016 WP_003414535.1.76032 WP_003414535.1.76037 WP_003414535.1.7604 WP_003414535.1.76045 WP_003414535.1.76052 WP_003414535.1.76058 WP_003414535.1.76064 WP_003414535.1.76110 WP_003414535.1.76126 WP_003414535.1.76138 WP_003414535.1.76157 WP_003414535.1.76172 WP_003414535.1.76177 WP_003414535.1.76183 WP_003414535.1.76272 WP_003414535.1.76277 WP_003414535.1.76280 WP_003414535.1.76281 WP_003414535.1.76291 WP_003414535.1.76297 WP_003414535.1.76379 WP_003414535.1.76403 WP_003414535.1.76413 WP_003414535.1.76414 WP_003414535.1.76427 WP_003414535.1.76436 WP_003414535.1.76442 WP_003414535.1.76443 WP_003414535.1.76456 WP_003414535.1.76521 WP_003414535.1.76533 WP_003414535.1.76616 WP_003414535.1.76625 WP_003414535.1.76629 WP_003414535.1.76635 WP_003414535.1.76638 WP_003414535.1.76639 WP_003414535.1.76640 WP_003414535.1.76644 WP_003414535.1.76677 WP_003414535.1.76678 WP_003414535.1.76679 WP_003414535.1.76734 WP_003414535.1.76744 WP_003414535.1.76750 WP_003414535.1.76754 WP_003414535.1.76757 WP_003414535.1.76781 WP_003414535.1.76818 WP_003414535.1.76824 WP_003414535.1.76835 WP_003414535.1.76873 WP_003414535.1.76881 WP_003414535.1.76888 WP_003414535.1.76900 WP_003414535.1.7691 WP_003414535.1.76947 WP_003414535.1.76954 WP_003414535.1.76955 WP_003414535.1.76963 WP_003414535.1.76976 WP_003414535.1.770 WP_003414535.1.77000 WP_003414535.1.77008 WP_003414535.1.77021 WP_003414535.1.77056 WP_003414535.1.77065 WP_003414535.1.77075 WP_003414535.1.77093 WP_003414535.1.77107 WP_003414535.1.77115 WP_003414535.1.77118 WP_003414535.1.77125 WP_003414535.1.77141 WP_003414535.1.77142 WP_003414535.1.77166 WP_003414535.1.77252 WP_003414535.1.77260 WP_003414535.1.77266 WP_003414535.1.77280 WP_003414535.1.77285 WP_003414535.1.77312 WP_003414535.1.77348 WP_003414535.1.77351 WP_003414535.1.77352 WP_003414535.1.77361 WP_003414535.1.774 WP_003414535.1.7740 WP_003414535.1.77404 WP_003414535.1.77425 WP_003414535.1.77463 WP_003414535.1.77474 WP_003414535.1.7748 WP_003414535.1.77484 WP_003414535.1.77491 WP_003414535.1.77499 WP_003414535.1.77510 WP_003414535.1.77530 WP_003414535.1.77554 WP_003414535.1.77559 WP_003414535.1.77599 WP_003414535.1.77605 WP_003414535.1.7762 WP_003414535.1.77627 WP_003414535.1.77649 WP_003414535.1.77654 WP_003414535.1.7766 WP_003414535.1.77667 WP_003414535.1.77704 WP_003414535.1.77706 WP_003414535.1.77774 WP_003414535.1.7778 WP_003414535.1.77790 WP_003414535.1.77809 WP_003414535.1.77820 WP_003414535.1.77843 WP_003414535.1.77855 WP_003414535.1.77865 WP_003414535.1.77868 WP_003414535.1.77879 WP_003414535.1.77909 WP_003414535.1.77911 WP_003414535.1.77931 WP_003414535.1.77984 WP_003414535.1.78020 WP_003414535.1.78024 WP_003414535.1.78075 WP_003414535.1.78084 WP_003414535.1.78086 WP_003414535.1.7809 WP_003414535.1.78098 WP_003414535.1.78105 WP_003414535.1.78113 WP_003414535.1.78136 WP_003414535.1.78162 WP_003414535.1.7817 WP_003414535.1.78200 WP_003414535.1.78216 WP_003414535.1.78236 WP_003414535.1.78238 WP_003414535.1.78322 WP_003414535.1.78338 WP_003414535.1.7836 WP_003414535.1.78360 WP_003414535.1.78386 WP_003414535.1.78429 WP_003414535.1.78435 WP_003414535.1.7844 WP_003414535.1.78459 WP_003414535.1.78488 WP_003414535.1.7849 WP_003414535.1.78499 WP_003414535.1.785 WP_003414535.1.78516 WP_003414535.1.78524 WP_003414535.1.78526 WP_003414535.1.78538 WP_003414535.1.78544 WP_003414535.1.78545 WP_003414535.1.78547 WP_003414535.1.78574 WP_003414535.1.78580 WP_003414535.1.7860 WP_003414535.1.78620 WP_003414535.1.78646 WP_003414535.1.78648 WP_003414535.1.78649 WP_003414535.1.78655 WP_003414535.1.78657 WP_003414535.1.78659 WP_003414535.1.7869 WP_003414535.1.78692 WP_003414535.1.78760 WP_003414535.1.78766 WP_003414535.1.78776 WP_003414535.1.78778 WP_003414535.1.78784 WP_003414535.1.78788 WP_003414535.1.78790 WP_003414535.1.78793 WP_003414535.1.78848 WP_003414535.1.78860 WP_003414535.1.7887 WP_003414535.1.78884 WP_003414535.1.78932 WP_003414535.1.78969 WP_003414535.1.78977 WP_003414535.1.78980 WP_003414535.1.79005 WP_003414535.1.79016 WP_003414535.1.79033 WP_003414535.1.79064 WP_003414535.1.79066 WP_003414535.1.79068 WP_003414535.1.79077 WP_003414535.1.79095 WP_003414535.1.79112 WP_003414535.1.79122 WP_003414535.1.79145 WP_003414535.1.79152 WP_003414535.1.79163 WP_003414535.1.79182 WP_003414535.1.79213 WP_003414535.1.79218 WP_003414535.1.79268 WP_003414535.1.79278 WP_003414535.1.79290 WP_003414535.1.79319 WP_003414535.1.79326 WP_003414535.1.79330 WP_003414535.1.79339 WP_003414535.1.79394 WP_003414535.1.79399 WP_003414535.1.79413 WP_003414535.1.79422 WP_003414535.1.79445 WP_003414535.1.79447 WP_003414535.1.79455 WP_003414535.1.79471 WP_003414535.1.79480 WP_003414535.1.79482 WP_003414535.1.79488 WP_003414535.1.79500 WP_003414535.1.79502 WP_003414535.1.79508 WP_003414535.1.79514 WP_003414535.1.79561 WP_003414535.1.79565 WP_003414535.1.79578 WP_003414535.1.79588 WP_003414535.1.79598 WP_003414535.1.79615 WP_003414535.1.79684 WP_003414535.1.79698 WP_003414535.1.797 WP_003414535.1.79744 WP_003414535.1.79784 WP_003414535.1.79802 WP_003414535.1.79806 WP_003414535.1.79819 WP_003414535.1.79826 WP_003414535.1.79828 WP_003414535.1.79851 WP_003414535.1.79853 WP_003414535.1.79863 WP_003414535.1.79881 WP_003414535.1.79885 WP_003414535.1.79898 WP_003414535.1.7990 WP_003414535.1.79900 WP_003414535.1.79913 WP_003414535.1.79947 WP_003414535.1.79948 WP_003414535.1.7995 WP_003414535.1.7997 WP_003414535.1.80004 WP_003414535.1.80015 WP_003414535.1.80022 WP_003414535.1.80030 WP_003414535.1.80054 WP_003414535.1.80084 WP_003414535.1.80099 WP_003414535.1.80129 WP_003414535.1.80177 WP_003414535.1.80234 WP_003414535.1.8026 WP_003414535.1.80275 WP_003414535.1.8029 WP_003414535.1.80299 WP_003414535.1.80300 WP_003414535.1.80304 WP_003414535.1.80326 WP_003414535.1.80351 WP_003414535.1.8037 WP_003414535.1.80370 WP_003414535.1.80399 WP_003414535.1.8044 WP_003414535.1.80451 WP_003414535.1.80458 WP_003414535.1.80461 WP_003414535.1.80490 WP_003414535.1.80503 WP_003414535.1.80507 WP_003414535.1.80552 WP_003414535.1.80576 WP_003414535.1.80588 WP_003414535.1.80599 WP_003414535.1.8060 WP_003414535.1.80624 WP_003414535.1.80636 WP_003414535.1.80673 WP_003414535.1.80711 WP_003414535.1.80714 WP_003414535.1.80784 WP_003414535.1.80815 WP_003414535.1.80853 WP_003414535.1.80918 WP_003414535.1.8093 WP_003414535.1.80967 WP_003414535.1.8097 WP_003414535.1.80988 WP_003414535.1.81007 WP_003414535.1.81013 WP_003414535.1.8105 WP_003414535.1.81059 WP_003414535.1.81063 WP_003414535.1.81066 WP_003414535.1.81075 WP_003414535.1.81091 WP_003414535.1.81119 WP_003414535.1.81125 WP_003414535.1.81136 WP_003414535.1.8114 WP_003414535.1.81189 WP_003414535.1.81192 WP_003414535.1.812 WP_003414535.1.81230 WP_003414535.1.81249 WP_003414535.1.81250 WP_003414535.1.81264 WP_003414535.1.8128 WP_003414535.1.81287 WP_003414535.1.81297 WP_003414535.1.8138 WP_003414535.1.81407 WP_003414535.1.8143 WP_003414535.1.81439 WP_003414535.1.81465 WP_003414535.1.81505 WP_003414535.1.81529 WP_003414535.1.81538 WP_003414535.1.81541 WP_003414535.1.81560 WP_003414535.1.81561 WP_003414535.1.81583 WP_003414535.1.81686 WP_003414535.1.81712 WP_003414535.1.81720 WP_003414535.1.81731 WP_003414535.1.81774 WP_003414535.1.81788 WP_003414535.1.81809 WP_003414535.1.81820 WP_003414535.1.81850 WP_003414535.1.81883 WP_003414535.1.81891 WP_003414535.1.81911 WP_003414535.1.81918 WP_003414535.1.82011 WP_003414535.1.82048 WP_003414535.1.82069 WP_003414535.1.82071 WP_003414535.1.82108 WP_003414535.1.82136 WP_003414535.1.82142 WP_003414535.1.8215 WP_003414535.1.82158 WP_003414535.1.8217 WP_003414535.1.82209 WP_003414535.1.82210 WP_003414535.1.82228 WP_003414535.1.82236 WP_003414535.1.82251 WP_003414535.1.82271 WP_003414535.1.82305 WP_003414535.1.82307 WP_003414535.1.82309 WP_003414535.1.82317 WP_003414535.1.8232 WP_003414535.1.82346 WP_003414535.1.82374 WP_003414535.1.82385 WP_003414535.1.82429 WP_003414535.1.82460 WP_003414535.1.82462 WP_003414535.1.82483 WP_003414535.1.82494 WP_003414535.1.82531 WP_003414535.1.82546 WP_003414535.1.82549 WP_003414535.1.82577 WP_003414535.1.82592 WP_003414535.1.82597 WP_003414535.1.82598 WP_003414535.1.82625 WP_003414535.1.82642 WP_003414535.1.82651 WP_003414535.1.82653 WP_003414535.1.82681 WP_003414535.1.82685 WP_003414535.1.8271 WP_003414535.1.82712 WP_003414535.1.8273 WP_003414535.1.82743 WP_003414535.1.82757 WP_003414535.1.82774 WP_003414535.1.82803 WP_003414535.1.82836 WP_003414535.1.82860 WP_003414535.1.82871 WP_003414535.1.82892 WP_003414535.1.82935 WP_003414535.1.82957 WP_003414535.1.82973 WP_003414535.1.82981 WP_003414535.1.82983 WP_003414535.1.83004 WP_003414535.1.83009 WP_003414535.1.83044 WP_003414535.1.83074 WP_003414535.1.83110 WP_003414535.1.83146 WP_003414535.1.83149 WP_003414535.1.83159 WP_003414535.1.8317 WP_003414535.1.83181 WP_003414535.1.83182 WP_003414535.1.83191 WP_003414535.1.83197 WP_003414535.1.83212 WP_003414535.1.8326 WP_003414535.1.83262 WP_003414535.1.83268 WP_003414535.1.83273 WP_003414535.1.83309 WP_003414535.1.83332 WP_003414535.1.83334 WP_003414535.1.83341 WP_003414535.1.83349 WP_003414535.1.8335 WP_003414535.1.83353 WP_003414535.1.83367 WP_003414535.1.83380 WP_003414535.1.83381 WP_003414535.1.83389 WP_003414535.1.83408 WP_003414535.1.83409 WP_003414535.1.83435 WP_003414535.1.83470 WP_003414535.1.83524 WP_003414535.1.83526 WP_003414535.1.8358 WP_003414535.1.83589 WP_003414535.1.83601 WP_003414535.1.83611 WP_003414535.1.83638 WP_003414535.1.83656 WP_003414535.1.83667 WP_003414535.1.83689 WP_003414535.1.83692 WP_003414535.1.83704 WP_003414535.1.83705 WP_003414535.1.83766 WP_003414535.1.83793 WP_003414535.1.83794 WP_003414535.1.83802 WP_003414535.1.83805 WP_003414535.1.83839 WP_003414535.1.83842 WP_003414535.1.83861 WP_003414535.1.83884 WP_003414535.1.83920 WP_003414535.1.83929 WP_003414535.1.83930 WP_003414535.1.83975 WP_003414535.1.83991 WP_003414535.1.8400 WP_003414535.1.84027 WP_003414535.1.8404 WP_003414535.1.84057 WP_003414535.1.84070 WP_003414535.1.8409 WP_003414535.1.84112 WP_003414535.1.84146 WP_003414535.1.8415 WP_003414535.1.84176 WP_003414535.1.84186 WP_003414535.1.84192 WP_003414535.1.84228 WP_003414535.1.8424 WP_003414535.1.84244 WP_003414535.1.84259 WP_003414535.1.8426 WP_003414535.1.84277 WP_003414535.1.84287 WP_003414535.1.8434 WP_003414535.1.84388 WP_003414535.1.84408 WP_003414535.1.84409 WP_003414535.1.84438 WP_003414535.1.84460 WP_003414535.1.84488 WP_003414535.1.84504 WP_003414535.1.84620 WP_003414535.1.84623 WP_003414535.1.84641 WP_003414535.1.84655 WP_003414535.1.84666 WP_003414535.1.84670 WP_003414535.1.84739 WP_003414535.1.84748 WP_003414535.1.84766 WP_003414535.1.84772 WP_003414535.1.84774 WP_003414535.1.848 WP_003414535.1.84812 WP_003414535.1.84836 WP_003414535.1.84839 WP_003414535.1.84846 WP_003414535.1.84873 WP_003414535.1.84911 WP_003414535.1.84938 WP_003414535.1.84968 WP_003414535.1.84973 WP_003414535.1.84981 WP_003414535.1.84985 WP_003414535.1.8503 WP_003414535.1.85038 WP_003414535.1.85041 WP_003414535.1.85043 WP_003414535.1.8505 WP_003414535.1.85074 WP_003414535.1.8509 WP_003414535.1.8512 WP_003414535.1.85148 WP_003414535.1.8518 WP_003414535.1.8522 WP_003414535.1.85242 WP_003414535.1.85276 WP_003414535.1.85281 WP_003414535.1.85314 WP_003414535.1.85319 WP_003414535.1.85330 WP_003414535.1.85341 WP_003414535.1.85346 WP_003414535.1.8535 WP_003414535.1.85363 WP_003414535.1.85371 WP_003414535.1.85377 WP_003414535.1.85387 WP_003414535.1.85399 WP_003414535.1.85458 WP_003414535.1.8546 WP_003414535.1.85464 WP_003414535.1.85478 WP_003414535.1.85480 WP_003414535.1.85488 WP_003414535.1.85495 WP_003414535.1.85551 WP_003414535.1.85557 WP_003414535.1.85577 WP_003414535.1.85597 WP_003414535.1.85599 WP_003414535.1.85610 WP_003414535.1.8563 WP_003414535.1.85648 WP_003414535.1.85679 WP_003414535.1.85704 WP_003414535.1.85717 WP_003414535.1.85727 WP_003414535.1.85737 WP_003414535.1.85763 WP_003414535.1.85808 WP_003414535.1.85819 WP_003414535.1.85820 WP_003414535.1.85823 WP_003414535.1.85832 WP_003414535.1.8586 WP_003414535.1.85872 WP_003414535.1.85894 WP_003414535.1.85913 WP_003414535.1.85953 WP_003414535.1.85986 WP_003414535.1.86000 WP_003414535.1.86024 WP_003414535.1.86025 WP_003414535.1.86032 WP_003414535.1.86048 WP_003414535.1.86052 WP_003414535.1.86067 WP_003414535.1.86103 WP_003414535.1.86122 WP_003414535.1.86124 WP_003414535.1.86160 WP_003414535.1.86164 WP_003414535.1.86168 WP_003414535.1.86190 WP_003414535.1.86204 WP_003414535.1.86235 WP_003414535.1.86249 WP_003414535.1.86260 WP_003414535.1.86290 WP_003414535.1.863 WP_003414535.1.86327 WP_003414535.1.86334 WP_003414535.1.86337 WP_003414535.1.86368 WP_003414535.1.86377 WP_003414535.1.86425 WP_003414535.1.86459 WP_003414535.1.8649 WP_003414535.1.86499 WP_003414535.1.86520 WP_003414535.1.86561 WP_003414535.1.86568 WP_003414535.1.86575 WP_003414535.1.86584 WP_003414535.1.86605 WP_003414535.1.86626 WP_003414535.1.86648 WP_003414535.1.8666 WP_003414535.1.86684 WP_003414535.1.86696 WP_003414535.1.86705 WP_003414535.1.86718 WP_003414535.1.86766 WP_003414535.1.86801 WP_003414535.1.86814 WP_003414535.1.86820 WP_003414535.1.86825 WP_003414535.1.86834 WP_003414535.1.8685 WP_003414535.1.86851 WP_003414535.1.86855 WP_003414535.1.86867 WP_003414535.1.86877 WP_003414535.1.86883 WP_003414535.1.8689 WP_003414535.1.86892 WP_003414535.1.86933 WP_003414535.1.86941 WP_003414535.1.86950 WP_003414535.1.86962 WP_003414535.1.86963 WP_003414535.1.86979 WP_003414535.1.8700 WP_003414535.1.87001 WP_003414535.1.87002 WP_003414535.1.87031 WP_003414535.1.87116 WP_003414535.1.87117 WP_003414535.1.8714 WP_003414535.1.87162 WP_003414535.1.87178 WP_003414535.1.87191 WP_003414535.1.87201 WP_003414535.1.87209 WP_003414535.1.87240 WP_003414535.1.87266 WP_003414535.1.87273 WP_003414535.1.87275 WP_003414535.1.8733 WP_003414535.1.87345 WP_003414535.1.87369 WP_003414535.1.8737 WP_003414535.1.87401 WP_003414535.1.87404 WP_003414535.1.87406 WP_003414535.1.87409 WP_003414535.1.87444 WP_003414535.1.87446 WP_003414535.1.87459 WP_003414535.1.87472 WP_003414535.1.87489 WP_003414535.1.87494 WP_003414535.1.87496 WP_003414535.1.87582 WP_003414535.1.87588 WP_003414535.1.87617 WP_003414535.1.87619 WP_003414535.1.87620 WP_003414535.1.87634 WP_003414535.1.87643 WP_003414535.1.8765 WP_003414535.1.87650 WP_003414535.1.87654 WP_003414535.1.87658 WP_003414535.1.87665 WP_003414535.1.87676 WP_003414535.1.87677 WP_003414535.1.87684 WP_003414535.1.87692 WP_003414535.1.87707 WP_003414535.1.87732 WP_003414535.1.87784 WP_003414535.1.87796 WP_003414535.1.87809 WP_003414535.1.87817 WP_003414535.1.87827 WP_003414535.1.87831 WP_003414535.1.87835 WP_003414535.1.87837 WP_003414535.1.87866 WP_003414535.1.8789 WP_003414535.1.87911 WP_003414535.1.87924 WP_003414535.1.87951 WP_003414535.1.87956 WP_003414535.1.87991 WP_003414535.1.88 WP_003414535.1.88037 WP_003414535.1.88039 WP_003414535.1.88072 WP_003414535.1.88077 WP_003414535.1.88121 WP_003414535.1.88180 WP_003414535.1.88191 WP_003414535.1.88205 WP_003414535.1.88217 WP_003414535.1.88219 WP_003414535.1.88245 WP_003414535.1.88253 WP_003414535.1.88294 WP_003414535.1.88315 WP_003414535.1.88316 WP_003414535.1.88320 WP_003414535.1.88338 WP_003414535.1.8840 WP_003414535.1.88437 WP_003414535.1.88453 WP_003414535.1.88469 WP_003414535.1.88489 WP_003414535.1.88507 WP_003414535.1.88521 WP_003414535.1.88530 WP_003414535.1.88537 WP_003414535.1.88541 WP_003414535.1.88592 WP_003414535.1.88616 WP_003414535.1.88618 WP_003414535.1.8862 WP_003414535.1.88625 WP_003414535.1.88632 WP_003414535.1.88634 WP_003414535.1.88649 WP_003414535.1.8870 WP_003414535.1.88737 WP_003414535.1.888 WP_003414535.1.88824 WP_003414535.1.88886 WP_003414535.1.88965 WP_003414535.1.88985 WP_003414535.1.8902 WP_003414535.1.89025 WP_003414535.1.89041 WP_003414535.1.89046 WP_003414535.1.89082 WP_003414535.1.89162 WP_003414535.1.89168 WP_003414535.1.8917 WP_003414535.1.89193 WP_003414535.1.89205 WP_003414535.1.89207 WP_003414535.1.89225 WP_003414535.1.8925 WP_003414535.1.89277 WP_003414535.1.89286 WP_003414535.1.89293 WP_003414535.1.89320 WP_003414535.1.8935 WP_003414535.1.89371 WP_003414535.1.89378 WP_003414535.1.89392 WP_003414535.1.89406 WP_003414535.1.8943 WP_003414535.1.89451 WP_003414535.1.89453 WP_003414535.1.89473 WP_003414535.1.89475 WP_003414535.1.89483 WP_003414535.1.895 WP_003414535.1.89513 WP_003414535.1.89517 WP_003414535.1.89522 WP_003414535.1.8954 WP_003414535.1.89543 WP_003414535.1.89567 WP_003414535.1.8957 WP_003414535.1.89572 WP_003414535.1.89589 WP_003414535.1.89607 WP_003414535.1.89625 WP_003414535.1.89648 WP_003414535.1.8967 WP_003414535.1.89670 WP_003414535.1.89676 WP_003414535.1.89729 WP_003414535.1.89739 WP_003414535.1.89762 WP_003414535.1.8977 WP_003414535.1.89802 WP_003414535.1.89808 WP_003414535.1.8982 WP_003414535.1.89829 WP_003414535.1.89831 WP_003414535.1.89844 WP_003414535.1.89849 WP_003414535.1.8989 WP_003414535.1.89901 WP_003414535.1.89903 WP_003414535.1.89909 WP_003414535.1.89922 WP_003414535.1.89926 WP_003414535.1.89963 WP_003414535.1.89971 WP_003414535.1.8998 WP_003414535.1.89987 WP_003414535.1.900 WP_003414535.1.90048 WP_003414535.1.9007 WP_003414535.1.90080 WP_003414535.1.90130 WP_003414535.1.90134 WP_003414535.1.90137 WP_003414535.1.90157 WP_003414535.1.90184 WP_003414535.1.90199 WP_003414535.1.90231 WP_003414535.1.90245 WP_003414535.1.90308 WP_003414535.1.90322 WP_003414535.1.90328 WP_003414535.1.90372 WP_003414535.1.90439 WP_003414535.1.90481 WP_003414535.1.90499 WP_003414535.1.9050 WP_003414535.1.90527 WP_003414535.1.90550 WP_003414535.1.90560 WP_003414535.1.90612 WP_003414535.1.90640 WP_003414535.1.90672 WP_003414535.1.90687 WP_003414535.1.90691 WP_003414535.1.90711 WP_003414535.1.90722 WP_003414535.1.90744 WP_003414535.1.9075 WP_003414535.1.90756 WP_003414535.1.90767 WP_003414535.1.90771 WP_003414535.1.90785 WP_003414535.1.90788 WP_003414535.1.90800 WP_003414535.1.90810 WP_003414535.1.90816 WP_003414535.1.90819 WP_003414535.1.9082 WP_003414535.1.90831 WP_003414535.1.90884 WP_003414535.1.90899 WP_003414535.1.90906 WP_003414535.1.90958 WP_003414535.1.90976 WP_003414535.1.90977 WP_003414535.1.90987 WP_003414535.1.9102 WP_003414535.1.91026 WP_003414535.1.91032 WP_003414535.1.91053 WP_003414535.1.91082 WP_003414535.1.91106 WP_003414535.1.91112 WP_003414535.1.91144 WP_003414535.1.91151 WP_003414535.1.91157 WP_003414535.1.91167 WP_003414535.1.91169 WP_003414535.1.91192 WP_003414535.1.91201 WP_003414535.1.91207 WP_003414535.1.91208 WP_003414535.1.91211 WP_003414535.1.91214 WP_003414535.1.91230 WP_003414535.1.91244 WP_003414535.1.91251 WP_003414535.1.91260 WP_003414535.1.91265 WP_003414535.1.9128 WP_003414535.1.91284 WP_003414535.1.91294 WP_003414535.1.91303 WP_003414535.1.91322 WP_003414535.1.91352 WP_003414535.1.91386 WP_003414535.1.9139 WP_003414535.1.91398 WP_003414535.1.91411 WP_003414535.1.91430 WP_003414535.1.91436 WP_003414535.1.91483 WP_003414535.1.91496 WP_003414535.1.91507 WP_003414535.1.91508 WP_003414535.1.91576 WP_003414535.1.91589 WP_003414535.1.91694 WP_003414535.1.91695 WP_003414535.1.91713 WP_003414535.1.91716 WP_003414535.1.91717 WP_003414535.1.91728 WP_003414535.1.91743 WP_003414535.1.91759 WP_003414535.1.91784 WP_003414535.1.91785 WP_003414535.1.91786 WP_003414535.1.91802 WP_003414535.1.91822 WP_003414535.1.91828 WP_003414535.1.9189 WP_003414535.1.91896 WP_003414535.1.9190 WP_003414535.1.91915 WP_003414535.1.91931 WP_003414535.1.91937 WP_003414535.1.91944 WP_003414535.1.91953 WP_003414535.1.91957 WP_003414535.1.91976 WP_003414535.1.91978 WP_003414535.1.92021 WP_003414535.1.92083 WP_003414535.1.92127 WP_003414535.1.92144 WP_003414535.1.92150 WP_003414535.1.92153 WP_003414535.1.92190 WP_003414535.1.92192 WP_003414535.1.92200 WP_003414535.1.92220 WP_003414535.1.92221 WP_003414535.1.92222 WP_003414535.1.92273 WP_003414535.1.9229 WP_003414535.1.92294 WP_003414535.1.92300 WP_003414535.1.92317 WP_003414535.1.92334 WP_003414535.1.92338 WP_003414535.1.92345 WP_003414535.1.92356 WP_003414535.1.92364 WP_003414535.1.92380 WP_003414535.1.92416 WP_003414535.1.92428 WP_003414535.1.92447 WP_003414535.1.92456 WP_003414535.1.92467 WP_003414535.1.92471 WP_003414535.1.92490 WP_003414535.1.92508 WP_003414535.1.9251 WP_003414535.1.92511 WP_003414535.1.92523 WP_003414535.1.92527 WP_003414535.1.92536 WP_003414535.1.92592 WP_003414535.1.92603 WP_003414535.1.92606 WP_003414535.1.92610 WP_003414535.1.92613 WP_003414535.1.9263 WP_003414535.1.9265 WP_003414535.1.92650 WP_003414535.1.92660 WP_003414535.1.92677 WP_003414535.1.92685 WP_003414535.1.92689 WP_003414535.1.92690 WP_003414535.1.92706 WP_003414535.1.92714 WP_003414535.1.92736 WP_003414535.1.9274 WP_003414535.1.92752 WP_003414535.1.92760 WP_003414535.1.92777 WP_003414535.1.92803 WP_003414535.1.92833 WP_003414535.1.92856 WP_003414535.1.92881 WP_003414535.1.92892 WP_003414535.1.92907 WP_003414535.1.92908 WP_003414535.1.9291 WP_003414535.1.92917 WP_003414535.1.92996 WP_003414535.1.93006 WP_003414535.1.93008 WP_003414535.1.93009 WP_003414535.1.93015 WP_003414535.1.93043 WP_003414535.1.9307 WP_003414535.1.93083 WP_003414535.1.93097 WP_003414535.1.93137 WP_003414535.1.93192 WP_003414535.1.93199 WP_003414535.1.93203 WP_003414535.1.93212 WP_003414535.1.93234 WP_003414535.1.93245 WP_003414535.1.93257 WP_003414535.1.93265 WP_003414535.1.93297 WP_003414535.1.93320 WP_003414535.1.93328 WP_003414535.1.93337 WP_003414535.1.93343 WP_003414535.1.93349 WP_003414535.1.93363 WP_003414535.1.93377 WP_003414535.1.9338 WP_003414535.1.93407 WP_003414535.1.93417 WP_003414535.1.93419 WP_003414535.1.93426 WP_003414535.1.9344 WP_003414535.1.93443 WP_003414535.1.93447 WP_003414535.1.93470 WP_003414535.1.93483 WP_003414535.1.93487 WP_003414535.1.93495 WP_003414535.1.93499 WP_003414535.1.93516 WP_003414535.1.93536 WP_003414535.1.93544 WP_003414535.1.93555 WP_003414535.1.93560 WP_003414535.1.93564 WP_003414535.1.9357 WP_003414535.1.93573 WP_003414535.1.93576 WP_003414535.1.93588 WP_003414535.1.9363 WP_003414535.1.93645 WP_003414535.1.93649 WP_003414535.1.93659 WP_003414535.1.93677 WP_003414535.1.9368 WP_003414535.1.93689 WP_003414535.1.93693 WP_003414535.1.93698 WP_003414535.1.93706 WP_003414535.1.9371 WP_003414535.1.93792 WP_003414535.1.93823 WP_003414535.1.93871 WP_003414535.1.9388 WP_003414535.1.93894 WP_003414535.1.93903 WP_003414535.1.93907 WP_003414535.1.93913 WP_003414535.1.93946 WP_003414535.1.93950 WP_003414535.1.93953 WP_003414535.1.93954 WP_003414535.1.93988 WP_003414535.1.9407 WP_003414535.1.94143 WP_003414535.1.94154 WP_003414535.1.94184 WP_003414535.1.94204 WP_003414535.1.94205 WP_003414535.1.94226 WP_003414535.1.94231 WP_003414535.1.94256 WP_003414535.1.94261 WP_003414535.1.94281 WP_003414535.1.94292 WP_003414535.1.94297 WP_003414535.1.9431 WP_003414535.1.94326 WP_003414535.1.94339 WP_003414535.1.94392 WP_003414535.1.94416 WP_003414535.1.94421 WP_003414535.1.94456 WP_003414535.1.94480 WP_003414535.1.94495 WP_003414535.1.94511 WP_003414535.1.94512 WP_003414535.1.94525 WP_003414535.1.94528 WP_003414535.1.94564 WP_003414535.1.946 WP_003414535.1.94602 WP_003414535.1.94623 WP_003414535.1.94629 WP_003414535.1.9465 WP_003414535.1.94673 WP_003414535.1.94714 WP_003414535.1.94730 WP_003414535.1.94736 WP_003414535.1.94776 WP_003414535.1.9478 WP_003414535.1.94834 WP_003414535.1.94852 WP_003414535.1.94872 WP_003414535.1.9488 WP_003414535.1.94902 WP_003414535.1.94916 WP_003414535.1.94979 WP_003414535.1.94994 WP_003414535.1.94996 WP_003414535.1.94998 WP_003414535.1.95007 WP_003414535.1.95010 WP_003414535.1.95015 WP_003414535.1.95034 WP_003414535.1.95081 WP_003414535.1.95082 WP_003414535.1.9509 WP_003414535.1.95096 WP_003414535.1.95112 WP_003414535.1.95138 WP_003414535.1.9514 WP_003414535.1.95179 WP_003414535.1.95188 WP_003414535.1.95190 WP_003414535.1.95234 WP_003414535.1.95241 WP_003414535.1.95245 WP_003414535.1.95257 WP_003414535.1.95279 WP_003414535.1.9531 WP_003414535.1.95335 WP_003414535.1.95344 WP_003414535.1.9535 WP_003414535.1.95370 WP_003414535.1.95392 WP_003414535.1.95416 WP_003414535.1.95417 WP_003414535.1.95454 WP_003414535.1.95455 WP_003414535.1.95491 WP_003414535.1.95497 WP_003414535.1.95508 WP_003414535.1.95509 WP_003414535.1.95529 WP_003414535.1.95556 WP_003414535.1.95557 WP_003414535.1.95565 WP_003414535.1.95578 WP_003414535.1.95580 WP_003414535.1.95585 WP_003414535.1.95643 WP_003414535.1.95679 WP_003414535.1.95685 WP_003414535.1.957 WP_003414535.1.95724 WP_003414535.1.95727 WP_003414535.1.95730 WP_003414535.1.95735 WP_003414535.1.95758 WP_003414535.1.95772 WP_003414535.1.95797 WP_003414535.1.95839 WP_003414535.1.9585 WP_003414535.1.9590 WP_003414535.1.95902 WP_003414535.1.95908 WP_003414535.1.95924 WP_003414535.1.95926 WP_003414535.1.95953 WP_003414535.1.95958 WP_003414535.1.95964 WP_003414535.1.95973 WP_003414535.1.96006 WP_003414535.1.9602 WP_003414535.1.96036 WP_003414535.1.96062 WP_003414535.1.96065 WP_003414535.1.96098 WP_003414535.1.96146 WP_003414535.1.96171 WP_003414535.1.96182 WP_003414535.1.96204 WP_003414535.1.96230 WP_003414535.1.96235 WP_003414535.1.96242 WP_003414535.1.96245 WP_003414535.1.96254 WP_003414535.1.96259 WP_003414535.1.96286 WP_003414535.1.96313 WP_003414535.1.96318 WP_003414535.1.96345 WP_003414535.1.96360 WP_003414535.1.96373 WP_003414535.1.96456 WP_003414535.1.96486 WP_003414535.1.96560 WP_003414535.1.96569 WP_003414535.1.96573 WP_003414535.1.96575 WP_003414535.1.96576 WP_003414535.1.96611 WP_003414535.1.96621 WP_003414535.1.9667 WP_003414535.1.96681 WP_003414535.1.96726 WP_003414535.1.96733 WP_003414535.1.96742 WP_003414535.1.96754 WP_003414535.1.9678 WP_003414535.1.96832 WP_003414535.1.9685 WP_003414535.1.97008 WP_003414535.1.97009 WP_003414535.1.97056 WP_003414535.1.97084 WP_003414535.1.97087 WP_003414535.1.97096 WP_003414535.1.97099 WP_003414535.1.97108 WP_003414535.1.97113 WP_003414535.1.97122 WP_003414535.1.97127 WP_003414535.1.97129 WP_003414535.1.97136 WP_003414535.1.9716 WP_003414535.1.97176 WP_003414535.1.97222 WP_003414535.1.97223 WP_003414535.1.97237 WP_003414535.1.97242 WP_003414535.1.97270 WP_003414535.1.97283 WP_003414535.1.97296 WP_003414535.1.97321 WP_003414535.1.97325 WP_003414535.1.97330 WP_003414535.1.97366 WP_003414535.1.97376 WP_003414535.1.97380 WP_003414535.1.9739 WP_003414535.1.97462 WP_003414535.1.97517 WP_003414535.1.97519 WP_003414535.1.97535 WP_003414535.1.97540 WP_003414535.1.97545 WP_003414535.1.97546 WP_003414535.1.97550 WP_003414535.1.97568 WP_003414535.1.97577 WP_003414535.1.97584 WP_003414535.1.9759 WP_003414535.1.97591 WP_003414535.1.97596 WP_003414535.1.97609 WP_003414535.1.97618 WP_003414535.1.9763 WP_003414535.1.97669 WP_003414535.1.97673 WP_003414535.1.97700 WP_003414535.1.97701 WP_003414535.1.9773 WP_003414535.1.97730 WP_003414535.1.97740 WP_003414535.1.97751 WP_003414535.1.97754 WP_003414535.1.97797 WP_003414535.1.9782 WP_003414535.1.9784 WP_003414535.1.97888 WP_003414535.1.9795 WP_003414535.1.97951 WP_003414535.1.97958 WP_003414535.1.97966 WP_003414535.1.97977 WP_003414535.1.97979 WP_003414535.1.97995 WP_003414535.1.98018 WP_003414535.1.98034 WP_003414535.1.98052 WP_003414535.1.98071 WP_003414535.1.98072 WP_003414535.1.98113 WP_003414535.1.98114 WP_003414535.1.98128 WP_003414535.1.98181 WP_003414535.1.98188 WP_003414535.1.98189 WP_003414535.1.98213 WP_003414535.1.98225 WP_003414535.1.98291 WP_003414535.1.98335 WP_003414535.1.98350 WP_003414535.1.98395 WP_003414535.1.98412 WP_003414535.1.98441 WP_003414535.1.98443 WP_003414535.1.98462 WP_003414535.1.9848 WP_003414535.1.98482 WP_003414535.1.98486 WP_003414535.1.98488 WP_003414535.1.98503 WP_003414535.1.98516 WP_003414535.1.98524 WP_003414535.1.98536 WP_003414535.1.98541 WP_003414535.1.98566 WP_003414535.1.98576 WP_003414535.1.98590 WP_003414535.1.98594 WP_003414535.1.98599 WP_003414535.1.98629 WP_003414535.1.98645 WP_003414535.1.98646 WP_003414535.1.98649 WP_003414535.1.98656 WP_003414535.1.9867 WP_003414535.1.98674 WP_003414535.1.98697 WP_003414535.1.98701 WP_003414535.1.98739 WP_003414535.1.98749 WP_003414535.1.98765 WP_003414535.1.98770 WP_003414535.1.98777 WP_003414535.1.98778 WP_003414535.1.98802 WP_003414535.1.98838 WP_003414535.1.98850 WP_003414535.1.98906 WP_003414535.1.98935 WP_003414535.1.98948 WP_003414535.1.98953 WP_003414535.1.98984 WP_003414535.1.99000 WP_003414535.1.99023 WP_003414535.1.99030 WP_003414535.1.99037 WP_003414535.1.99055 WP_003414535.1.99062 WP_003414535.1.99086 WP_003414535.1.99115 WP_003414535.1.99117 WP_003414535.1.99161 WP_003414535.1.99176 WP_003414535.1.99205 WP_003414535.1.99211 WP_003414535.1.99216 WP_003414535.1.99251 WP_003414535.1.99269 WP_003414535.1.99294 WP_003414535.1.99312 WP_003414535.1.99315 WP_003414535.1.99316 WP_003414535.1.99322 WP_003414535.1.99328 WP_003414535.1.99365 WP_003414535.1.99368 WP_003414535.1.99396 WP_003414535.1.99402 WP_003414535.1.99404 WP_003414535.1.99419 WP_003414535.1.99438 WP_003414535.1.99460 WP_003414535.1.99468 WP_003414535.1.99513 WP_003414535.1.99529 WP_003414535.1.99548 WP_003414535.1.99572 WP_003414535.1.99575 WP_003414535.1.99578 WP_003414535.1.99605 WP_003414535.1.99609 WP_003414535.1.99617 WP_003414535.1.99635 WP_003414535.1.99650 WP_003414535.1.99672 WP_003414535.1.99701 WP_003414535.1.99711 WP_003414535.1.99716 WP_003414535.1.99740 WP_003414535.1.99745 WP_003414535.1.99749 WP_003414535.1.9976 WP_003414535.1.99798 WP_003414535.1.99817 WP_003414535.1.99832 WP_003414535.1.99847 WP_003414535.1.99852 WP_003414535.1.99886 WP_003414535.1.99897 WP_003414535.1.99899 WP_003414535.1.99915 WP_003414535.1.9993 WP_003414535.1.99982 WP_003414535.1.99991 gi|386005716|ref|YP_005923995.1| gi|479056810|ref|YP_007352616.1| gi|224991219|ref|YP_002645908.1| gi|383308598|ref|YP_005361409.1| gi|506927388|ref|YP_008007838.1| gi|31794024|ref|NP_856517.1| gi|525675361|ref|YP_008226942.1| gi|148824037|ref|YP_001288791.1| gi|385999632|ref|YP_005917931.1| gi|57117027|ref|NP_215025.2| gi|506927388|ref|YP_008007838.1| gi|494701281|ref|YP_007966763.1| gi|392431543|ref|YP_006472587.1| gi|121638727|ref|YP_978951.1| gi|57117027|ref|NP_215025.2| gi|148662688|ref|YP_001284211.1| gi|449064921|ref|YP_007432004.1| gi|544161998|ref|YP_008537784.1| gi|340627840|ref|YP_004746292.1| gi|375295335|ref|YP_005099602.1| gi|479315804|ref|YP_007855856.1| 233413.Mb2872c 336982.TBFG_12862 410289.BCG_2867c 419947.MRA_2870 478434.TBMG_01125 561275.JTY_2862 83331.MT2913 83332.Rv2847c gi|471338865|ref|YP_007611578.1| gi|392387476|ref|YP_005309105.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]