SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M9PCU1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M9PCU1
Domain Number 1 Region: 361-634
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.87e-86
Family Protein kinases, catalytic subunit 0.00000000211
Further Details:      
 
Domain Number 2 Region: 223-334,364-390
Classification Level Classification E-value
Superfamily SH2 domain 3.6e-37
Family SH2 domain 0.00000921
Further Details:      
 
Domain Number 3 Region: 161-254
Classification Level Classification E-value
Superfamily SH3-domain 7.34e-18
Family SH3-domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M9PCU1
Sequence length 1504
Comment (tr|M9PCU1|M9PCU1_DROME) Abl tyrosine kinase, isoform H {ECO:0000313|EMBL:AGB94657.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG4032 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MGAQQGKDRGAHSGGGGSGAPVSCIGLSSSPVASVSPHCISSSSGVSSAPLGGGSTLRGS
RIKSSSSGVASGSGSGGGGGGSGSGLSQRSGGHKDARCNPTVGLNIFTEHNEALLQSRPL
PHIPAGSTAASLLADAAELQQHQQDSGGLGLQGSSLGGGHSSTTSVFESAHRWTSKENLL
APGPEEDDPQLFVALYDFQAGGENQLSLKKGEQVRILSYNKSGEWCEAHSDSGNVGWVPS
NYVTPLNSLEKHSWYHGPISRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYH
YRISEDPDGKVFVTQEAKFNTLAELVHHHSVPHEGHGLITPLLYPAPKQNKPTVFPLSPE
PDEWEICRTDIMMKHKLGGGQYGEVYEAVWKRYGNTVAVKTLKEDTMALKDFLEEAAIMK
EMKHPNLVQLIGVCTREPPFYIITEFMSHGNLLDFLRSAGRETLDAVALLYMATQIASGM
SYLESRNYIHRDLAARNCLVGDNKLVKVADFGLARLMRDDTYTAHAGAKFPIKWTAPEGL
AYNKFSTKSDVWAFGVLLWEIATYGMSPYPAIDLTDVYHKLDKGYRMERPPGCPPEVYDL
MRQCWQWDATDRPTFKSIHHALEHMFQESSITEAVEKQLNANATSASSSAPSTSGVATGG
GATTTTAASGCASSSSATASLSLTPQMVKKGLPGGQALTPNAHHNDPHQQQASTPMSETG
STSTKLSTFSSQGKGNVQMRRTTNKQGKQAPAPPKRTSLLSSSRDSTYREEDPANARCNF
IDDLSTNGLARDINSLTQRYDSETDPAADPDTDATGDSLEQSLSQVIAAPVTNKMQHSLH
SGGGGGGIGPRSSQQHSSFKRPTGTPVMGNRGLETRQSKRSQLHSQAPGPGPPSTQPHHG
NNGVVTSAHPITVGALDVMNVKQVVNRYGTLPKGARIGAYLDSLEDSSEAAPALPATAPS
LPPANGHATPPAARLNPKASPIPPQQMIRSNSSGGVTMQNNAAASLNKLQRHRTTTEGTM
MTFSSFRAGGSSSSPKRSASGVASGVQPALANLEFPPPPLDLPPPPEEFEGGPPPPPPAP
ESAVQAIQQHLHAQLPNNGNISNGNGTNNNDSSHNDVSNIAPSVEEASSRFGVSLRKREP
STDSCSSLGSPPEDLKEKLITEIKAAGKDTAPASHLANGSGIAVVDPVSLLVTELAESMN
LPKPPPQQQQKLTNGNSTGSGFKAQLKKVEPKKMSAPMPKAEPANTIIDFKAHLRRVDKE
KEPATPAPAPATVAVANNANCNTTGTLNRKEDGSKKFSQAMQKTEIKIDVTNSNVEADAG
AAGEGDLGKRRSTDDEEQSHTEGLGSGGQGSADMTQSLYEQKPQIQQKPAVPHKPTKLTI
YATPIAKLTEPASSASSTQISRESILELVGLLEGSLKHPVNAIAGSQWLQLSDKLNILHN
SCVIFAENGAMPPHSKFQFRELVTRVEAQSQHLRSAGSKNVQDNERLVAEVGQSLRQISN
ALNR
Download sequence
Identical sequences M9PCU1
FBpp0303168 NP_001261964.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]