SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for O45539 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O45539
Domain Number 1 Region: 224-491
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-80
Family Protein kinases, catalytic subunit 0.000000043
Further Details:      
 
Domain Number 2 Region: 119-260
Classification Level Classification E-value
Superfamily SH2 domain 2.13e-38
Family SH2 domain 0.0000651
Further Details:      
 
Domain Number 3 Region: 54-129
Classification Level Classification E-value
Superfamily SH3-domain 1.14e-23
Family SH3-domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) O45539
Sequence length 507
Comment (sp|O45539|SRC2_CAEEL) SRC oncogene related protein 2 {ECO:0000312|WormBase:F49B2.5} KW=Complete proteome; Reference proteome OX=6239 OS=Caenorhabditis elegans. GN=F49B2.5 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MGSCIGKEDPPPGATSPVHTSSTLGRESLPSHPRIPSIGPIAASSSGNTIDKNQNISQSA
NFVALFQYDARTDDDLSFKKDDILEILNDTQGDWWFARHKATGRTGYIPSNYVAREKSIE
SQPWYFGKMRRIDAEKCLLHTLNEHGAFLVRDSESRQHDLSLSVRENDSVKHYRIRQLDH
GGYFIARRRPFATLHDLIAHYQREADGLCVNLGAPCAKSEAPQTTTFTYDDQWEVDRRSV
RLIRQIGAGQFGEVWEGRWNVNVPVAVKKLKAGTADPTDFLAEAQIMKKLRHPKLLSLYA
VCTRDEPILIVTELMQENLLTFLQRRGRQCQMPQLVEISAQVAAGMAYLEEMNFIHRDLA
ARNILINNSLSVKIADFGLARILMKENEYEARTGARFPIKWTAPEAANYNRFTTKSDVWS
FGILLTEIVTFGRLPYPGMTNAEVLQQVDAGYRMPCPAGCPVTLYDIMQQCWRSDPDKRP
TFETLQWKLEDLFNLDSSEYKEASINF
Download sequence
Identical sequences O45539
NP_493502.1.50509 F49B2.5 F49B2.5 232260 F49B2.5 F49B2.5 6239.F49B2.5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]