SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for O61768 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O61768
Domain Number 1 Region: 103-258
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.73e-37
Family Protein kinases, catalytic subunit 0.00037
Further Details:      
 
Domain Number 2 Region: 4-118
Classification Level Classification E-value
Superfamily SH2 domain 4.85e-21
Family SH2 domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) O61768
Sequence length 262
Comment (tr|O61768|O61768_CAEEL) Tyrosine-protein kinase {ECO:0000256|RuleBase:RU362096} KW=Complete proteome; Reference proteome OX=6239 OS=Caenorhabditis elegans. GN=C35E7.10 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MTDKDLLHQKYYHGLLPREDIQEMLNKPGQFLLRTSEPVKGEKRQFVLSVVGEKKTSANH
FVVRESDHKVYVDKIGFPTIIELVNHYVSTKESFSTKDGTVKAVLKQAVERQKWELYHED
VELTKKLGEGAFGEVWKGKLLKILDANHQPVLVAVKTAKLESMTKEQIKEIMREARLMRN
LDHINVVKFFGVAAGTEPLYVIMELADGGALDSALGKLHFPMIKKYELIYQAANGLAYIH
EKNLMHRDVAARNCLYGGGQVL
Download sequence
Identical sequences O61768
NP_492827.1.50509 C35E7.10B C35E7.10b C35E7.10b

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]