SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P00520 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P00520
Domain Number 1 Region: 231-498
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.02e-84
Family Protein kinases, catalytic subunit 0.000000000114
Further Details:      
 
Domain Number 2 Region: 122-262
Classification Level Classification E-value
Superfamily SH2 domain 1.88e-37
Family SH2 domain 0.00000134
Further Details:      
 
Domain Number 3 Region: 62-147
Classification Level Classification E-value
Superfamily SH3-domain 5.25e-20
Family SH3-domain 0.000023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
actin cytoskeleton 1.374 28.46
ruffle 1.819 27.03
cell-cell junction 1.461 26.75
cytoplasmic vesicle part 1.417 18.46
apical junction complex 1.901 17.78
transporter complex 1.698 13.83
plasma membrane receptor complex 1.824 13.31
spindle 1.815 12.85
cytosol 1.295 12.48
endocytic vesicle 1.532 10.86

Protein sequence

External link(s) P00520
Sequence length 1123
Comment (sp|P00520|ABL1_MOUSE) p150 KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Abl1; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MLEICLKLVGCKSKKGLSSSSSCYLEEALQRPVASDFEPQGLSEAARWNSKENLLAGPSE
NDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVN
SLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYHYRINTAS
DGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRNKPTIYGVSPNYDKWEMERT
DITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQ
LLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVSAVVLLYMATQISSAMEYLEKKNFI
HRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKS
DVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNP
SDRPSFAEIHQAFETMFQESSISDEVEKELGKRGTRGGAGSMLQAPELPTKTRTCRRAAE
QKDAPDTPELLHTKGLGESDALDSEPAVSPLLPRKERGPPDGSLNEDERLLPRDRKTNLF
SALIKKKKKMAPTPPKRSSSFREMDGQPDRRGASEDDSRELCNGPPALTSDAAEPTKSPK
ASNGAGVPNGAFREPGNSGFRSPHMWKKSSTLTGSRLAAAEEESGMSSSKRFLRSCSASC
MPHGARDTEWRSVTLPRDLPSAGKQFDSSTFGGHKSEKPALPRKRTSESRSEQVAKSTAM
PPPRLVKKNEEAAEEGFKDTESSPGSSPPSLTPKLLRRQVTASPSSGLSHKEEATKGSAS
GMGTPATAEPAPPSNKVGLSKASSEEMRVRRHKHSSESPGRDKGRLAKLKPAPPPPPACT
GKAGKPAQSPSQEAGEAGGPTKTKCTSLAMDAVNTDPTKAGPPGEGLRKPVPPSVPKPQS
TAKPPGTPTSPVSTPSTAPAPSPLAGDQQPSSAAFIPLISTRVSLRKTRQPPERIASGTI
TKGVVLDSTEALCLAISRNSEQMASHSAVLEAGKNLYTFCVSYVDSIQQMRNKFAFREAI
NKLESNLRELQICPATASSGPAATQDFSKLLSSVKEISDIVRR
Download sequence
Identical sequences P00520
ENSMUSP00000028190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]