SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for P23051 from Uniprot 2014_06

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  P23051
Domain Number - Region: 69-117
Classification Level Classification E-value
Superfamily Virus attachment protein globular domain 0.00149
Family Adenovirus fiber protein "knob" domain 0.014
Further Details:      
 

Protein sequence

External link(s) P23051
Sequence length 160
Comment (sp|P23051|NCAP_BEV) Nucleocapsid protein KW=Complete proteome OX=11156 OS=Berne virus (BEV). GN=N OC=Coronaviridae; Torovirinae; Torovirus; Equine torovirus. OH=9796
Sequence
MNSMLNPNAVPFQPSPQVVALPMQYPSGFSSGYRRQRDPAFRPMFRRQNNGNQNRSRQNR
QRLQNNNRGNNRNRNQFNRRQNQPSQSMSFEQQLLLMANETAYAATYPSDMQNIAPTKLV
KIAKRAAMQIVSGHATVEISNGTEDSNQRVATFTIKVVMN
Download sequence
Identical sequences P23051
NCAP_BEV

Jump to [ Top of page · Domain architecture · Domain assignment details ]