SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for P23051 from Uniprot 2014_06

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  P23051
Domain Number - Region: 69-117
Classification Level Classification E-value
Superfamily Virus attachment protein globular domain 0.00149
Family Adenovirus fiber protein "knob" domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) P23051
Sequence length 160
Comment (sp|P23051|NCAP_BEV) Nucleocapsid protein KW=Complete proteome OX=11156 OS=Berne virus (BEV). GN=N OC=Coronaviridae; Torovirinae; Torovirus; Equine torovirus. OH=9796
Sequence
MNSMLNPNAVPFQPSPQVVALPMQYPSGFSSGYRRQRDPAFRPMFRRQNNGNQNRSRQNR
QRLQNNNRGNNRNRNQFNRRQNQPSQSMSFEQQLLLMANETAYAATYPSDMQNIAPTKLV
KIAKRAAMQIVSGHATVEISNGTEDSNQRVATFTIKVVMN
Download sequence
Identical sequences P23051
NCAP_BEV

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]