SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P59048 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P59048
Domain Number 1 Region: 32-105
Classification Level Classification E-value
Superfamily Prefoldin 0.00000131
Family Prefoldin 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P59048
Sequence length 133
Comment (sp|P59048|PDRG1_MOUSE) p53 and DNA damage-regulated protein 1 KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Pdrg1; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MLSPEAERVLRYLVEVEELAEAVLSDKRQIVDLDTKRNQNREGLRALQKDLSVSEDVMVC
FGNMFIKMPHPKTKEMIQKDQEHLDKEIERLRSQLKVKVNRLFEAQGKPELKGFNLNPLS
PDEVKALKVILKG
Download sequence
Identical sequences P59048 Q3UKN2
ENSMUSP00000028972 10090.ENSMUSP00000028972 ENSMUSP00000028972 ENSMUSP00000028972 NP_849270.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]