SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q20933 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q20933
Domain Number 1 Region: 95-368
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.58e-74
Family Protein kinases, catalytic subunit 0.0000107
Further Details:      
 
Domain Number 2 Region: 3-119
Classification Level Classification E-value
Superfamily SH2 domain 3.1e-22
Family SH2 domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q20933
Sequence length 444
Comment (tr|Q20933|Q20933_CAEEL) Tyrosine-protein kinase {ECO:0000256|RuleBase:RU362096} KW=Complete proteome; Reference proteome OX=6239 OS=Caenorhabditis elegans. GN=CELE_F57B9.8 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MEINEQPFFHGLLPREEVKLLLQKNGDYLMRTSEPQGQARHLIISVMQNETSQEVAHYVI
RTSDGAYSITDKIKFGTLTELVNHHKQAKISEEVASSVLVNPIGRQSWELNHADITMTKV
LGEGAFGEVKLGTLKMGSTTVDVAIKVAKLEKVTKEQIKEIITEARLMRGFDHKNVVKCY
GVAAIDEPLLVVMELVPGGALDKYLQKNSSVQWPEKLDIIAQVAAGLAYIHSKNIIHRDI
AARNILYGKGVAKVSDFGLSRVGTEYQMDPSKRVPIRWLSPETIVSFLYTPQTDVFAFSI
LCWEVIENGAQPYPEMLVVQVHQKVGRDDYRMPISQKAPAMLADVIKKCWIRDPQQRPTM
SQVVQMMYEITGKKDKTSVNKSTGQLRAKMMSTGPMSDPMRDKTAKKTGRRNKKKPSSAS
NGPGGNSGPSSGPLSGKDSRLKKP
Download sequence
Identical sequences Q20933
6239.F57B9.8 F57B9.8 F57B9.8 F57B9.8 NP_498511.1.50509 F57B9.8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]