SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q95PX0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q95PX0
Domain Number 1 Region: 138-284
Classification Level Classification E-value
Superfamily SH2 domain 1.25e-27
Family SH2 domain 0.00044
Further Details:      
 
Domain Number 2 Region: 4-73
Classification Level Classification E-value
Superfamily SH3-domain 5.64e-23
Family SH3-domain 0.00048
Further Details:      
 
Domain Number 3 Region: 104-172
Classification Level Classification E-value
Superfamily SH3-domain 2.76e-21
Family SH3-domain 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q95PX0
Sequence length 286
Comment (tr|Q95PX0|Q95PX0_CAEEL) NCK (Non-Catalytic region of tyrosine Kinase) adaptor protein family {ECO:0000313|EMBL:CCD69110.1} KW=Complete proteome; Reference proteome OX=6239 OS=Caenorhabditis elegans. GN=CELE_ZK470.5 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MSSKTKAVVKFTYEPRLEDELGLTKGDFVYVVEKSTDGWWKGEAPNGGVGWFPSNYVEEV
EASTNGNQGSIENRNPAAAAVPAPIMMQAPPPKLQASRSSFEIQVVVALYSFDASSSEEL
SFKKGERLEIVDHPEHDPDWWMARNASGTTGLVPRNYIEVVVNDSSSSKASHQDFAPQYS
GNGEIPMEQQPWYFGRISRERAEDLLLHGREGEFLVRDSESNPGDLSISMRGIERNKHFK
VQNVDGLLKIGNRTFVDMNALINHYTTSPIFSSPTEKLFLTGPLPK
Download sequence
Identical sequences Q95PX0
ZK470.5b.1 ZK470.5b.2 ZK470.5b.3 ZK470.5b NP_508707.1.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]