SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A1L170 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A1L170
Sequence length 272
Comment (sp|A1L170|CA226_HUMAN) Uncharacterized protein C1orf226 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=C1orf226; OC=Catarrhini; Hominidae; Homo.
Sequence
MFENLNTALTPKLQASRSFPHLSKPVAPGSAPLGSGEPGGPGLWVGSSQHLKNLGKAMGA
KVNDFLRRKEPSSLGSVGVTEINKTAGAQLASGTDAAPEAWLEDERSVLQETFPRLDPPP
PITRKRTPRALKTTQDMLISSQPVLSSLEYGTEPSPGQAQDSAPTAQPDVPADASQPEAT
MEREERGKVLPNGEVSLSVPDLIHKDSQDESKLKMTECRRASSPSLIERNGFKLSLSPIS
LAESWEDGSPPPQARTSSLDNEGPHPDLLSFE
Download sequence
Identical sequences A1L170
ENSP00000437071 ENSP00000437071 gi|145977194|ref|NP_001078844.1| NP_001078844.1.87134 NP_001078844.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]