SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A4D1S0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A4D1S0
Domain Number 1 Region: 255-406
Classification Level Classification E-value
Superfamily C-type lectin-like 9.62e-24
Family C-type lectin domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A4D1S0
Sequence length 409
Comment (sp|A4D1S0|KLRG2_HUMAN) C-type lectin domain family 15 member B KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=KLRG2; OC=Catarrhini; Hominidae; Homo.
Sequence
MEESWEAAPGGQAGAELPMEPVGSLVPTLEQPQVPAKVRQPEGPESSPSPAGAVEKAAGA
GLEPSSKKKPPSPRPGSPRVPPLSLGYGVCPEPPSPGPALVKLPRNGEAPGAEPAPSAWA
PMELQVDVRVKPVGAAGGSSTPSPRPSTRFLKVPVPESPAFSRHADPAHQLLLRAPSQGG
TWGRRSPLAAARTESGCDAEGRASPAEGSAGSPGSPTCCRCKELGLEKEDAALLPRAGLD
GDEKLPRAVTLTGLPMYVKSLYWALAFMAVLLAVSGVVIVVLASRAGARCQQCPPGWVLS
EEHCYYFSAEAQAWEASQAFCSAYHATLPLLSHTQDFLGRYPVSRHSWVGAWRGPQGWHW
IDEAPLPPQLLPEDGEDNLDINCGALEEGTLVAANCSTPRPWVCAKGTQ
Download sequence
Identical sequences A4D1S0
ENSP00000339356 9606.ENSP00000339356 gi|38348332|ref|NP_940910.1| NP_940910.1.87134 NP_940910.1.92137 ENSP00000339356 ENSP00000339356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]